HHsearch alignment of GI: 254780598 and MMDB domain: 2vdf_A_

>2vdf_A (A:) OPCA, outer membrane protein; invasin, adhesin, beta barrel; 1.95A {Neisseria meningitidis}
Probab=92.95  E-value=0.41  Score=23.16  Aligned_cols=50  Identities=30%  Similarity=0.416  Sum_probs=25.0

Q ss_pred             CCCEEEEEEEEEEEE-CCCCC--EEEEEEEEEEECCCC---------------C--CCCEEEEEEEEEEC
Q ss_conf             752047997346610-04886--799999999750565---------------5--66226999998539
Q gi|254780598|r  156 PIAIGGTAGVGVEVG-GLSES--LVARLEYRASKYSKV---------------E--GFYNTISLGVGMKF  205 (205)
Q Consensus       156 ~~~~g~~~G~Gvey~-~it~~--~~~r~EY~y~df~~~---------------~--~~~~~~~~G~~ykF  205 (205)
                      .+..++.+++|++.. .++++  ++++.=|||-...+-               +  ...++.-+.++|||
T Consensus       184 ~~q~g~g~~~ga~i~k~l~~~~~l~~~P~yr~w~I~~S~~~~~~~~~~~~~~~ep~n~~~~yGv~~~~~F  253 (253)
T 2vdf_A          184 QKTNGWGFGLGANIGKKLGESASIEAGPFYKQRTYKESGEFSVTTKSGDVSLTIPKTSIREYGLRVGIKF  253 (253)
T ss_dssp             EECCEEEEEEEEEEEEECC--CEEEEEEEEEEEEECCCCCBCC-------CBCCCCEEEEEEEEEEEEEC
T ss_pred             HHCCCCCEEEEEEEHHCCCCCCCEEEECEEEEEEECCCCCEEEEECCCCEEEECCCCCCEEEEEEEEEEC
T ss_conf             0016833799788022036645366402045445404765378605884357658875225327888759