HHsearch alignment of GI: 254780598 and MMDB domain: 2wjr_A_

>2wjr_A (A:) Probable N-acetylneuraminic acid outer membrane channel protein NANC; cell membrane, ION transport, transmembrane, porin, transport; HET: EPE; 1.80A {Escherichia coli} PDB: 2wjq_A*
Probab=95.33  E-value=0.12  Score=25.92  Aligned_cols=98  Identities=4%  Similarity=-0.152  Sum_probs=53.1

Q ss_pred             EEEEEEEEEECC-CEEEEEEEEEEECCCCCCCCCCCCCCEEEEEEEEEEEEECCCEEEEEEEEEEEEEEEECCCCCCCCC
Q ss_conf             689985464048-3799845101321555666621223214899989754312767789885447764443134555677
Q gi|254780598|r   78 GSIFAGYNVEDS-CIMYGVEGDVRYTVPVLADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITP  156 (205)
Q Consensus        78 ~G~~~GYn~q~~-~~V~G~e~d~~~~~~~~~~~~~~~~~~~~~~~~r~Gy~~~~~~l~Y~~~G~a~~~~~~~~~~~~~~~  156 (205)
                      -.+.+.|.|++. ++.+-.-..+......          ....-..|++|.|.+.+.+-++--+-+.+...... ..+.+
T Consensus        54 ~E~~~~y~~kl~d~~~l~PG~~~~~~~~~----------~~ykPylk~~Y~f~~~~~~~~RYRy~~~~~~~~~~-~~~~~  122 (214)
T 2wjr_A           54 VQVEVNYAIKLDDQWTVRPGMLTHFSSNG----------TRYGPYVKLSWDATKDLNFGIRYRYDWKAYRQQDL-SGDMS  122 (214)
T ss_dssp             EEEEEEECEESSSSEEEEEEEEEEEETTE----------EEEEEEEEEEEEEETTEEEEEEEEEEEESSCEECT-TSCEE
T ss_pred             EEEEEEEEEECCCCEEEECCEEEEECCCC----------CEEEEEEEEEEEECCCEEEEEEECCCCCCCCCCCC-CCCCC
T ss_conf             69999999863888699345399966998----------57802799969976985799883132013655567-78766


Q ss_pred             CCEEEEEEEEEEEECCCCCEEEEEEEEEEEC
Q ss_conf             5204799734661004886799999999750
Q gi|254780598|r  157 IAIGGTAGVGVEVGGLSESLVARLEYRASKY  187 (205)
Q Consensus       157 ~~~g~~~G~Gvey~~it~~~~~r~EY~y~df  187 (205)
                      ......+-+.+-| .++++|.+..|+.|..-
T Consensus       123 ~~~~~r~d~~~~Y-~~~~~~~~~y~~~y~~~  152 (214)
T 2wjr_A          123 RDNVHRWDGYVTY-HINSDFTFAWQTTLYSK  152 (214)
T ss_dssp             CCCEEEEEEEEEE-ECSSSEEEEEEEEEEEE
T ss_pred             CCCCEEEEEEEEE-EECCCEEEEEEEEEEEC
T ss_conf             6751789789988-85456079987788852