HHsearch alignment of GI: 254780598 and MMDB domain: 3kvn_X_322-632

>3kvn_X (X:322-632) Esterase ESTA; beta barrel, alpha-beta-alpha motif, cell membrane, cell outer membrane, hydrolase, membrane, transmembrane; HET: C8E; 2.50A {Pseudomonas aeruginosa}
Probab=95.81  E-value=0.078  Score=26.86  Aligned_cols=30  Identities=13%  Similarity=0.037  Sum_probs=17.7

Q ss_pred             CCCEEEEEEEEEEECC-CEEEEEEEEEEECC
Q ss_conf             7602689985464048-37998451013215
Q gi|254780598|r   74 HNAGGSIFAGYNVEDS-CIMYGVEGDVRYTV  103 (205)
Q Consensus        74 ~~~~~G~~~GYn~q~~-~~V~G~e~d~~~~~  103 (205)
                      +....++.+|++.+.. ++.+|+-..+...+
T Consensus        59 ~~~~~g~~~G~d~~~~~~~~~G~~~~~~~~~   89 (311)
T 3kvn_X           59 DGNGYNLTLGGSYRIDEAWRAGVAAGFYRQK   89 (311)
T ss_dssp             EEEEEEEEEEEEEECSSSEEEEEEEEEEEEE
T ss_pred             CCCCCEEEEEEEEEECCCEEEEEEEEEEEEE
T ss_conf             5315359999887877987999999974001