HHsearch results for GI: 254780598 and protein with PDBid: 3aeh_A

>3aeh_A Hemoglobin-binding protease HBP autotransporter; beta-barrel, auto-proteolytic, reaction intermediate, mutant membrane, cell outer membrane; 2.00A {Escherichia coli}
Probab=98.57  E-value=7.1e-06  Score=46.84  Aligned_cols=129  Identities=13%  Similarity=0.097  Sum_probs=71.1

Q ss_pred             CCEEEEEEEEEEECC-CEEEEEEEEEEECCCCCCCC--------CCCC----CCEEEEEEEEEEEEEC-CCEEEEEEEEE
Q ss_conf             602689985464048-37998451013215556666--------2122----3214899989754312-76778988544
Q gi|254780598|r   75 NAGGSIFAGYNVEDS-CIMYGVEGDVRYTVPVLADN--------IHSL----HGIGGSLRIRGGYEVS-DSLLLYATVGP  140 (205)
Q Consensus        75 ~~~~G~~~GYn~q~~-~~V~G~e~d~~~~~~~~~~~--------~~~~----~~~~~~~~~r~Gy~~~-~~~l~Y~~~G~  140 (205)
                      .+...+.+||+++.. +|.+-..+.+.|.....+.-        ....    ......+..|+.+.+. .+..++..+++
T Consensus       154 ~~~~~~e~gy~~~~~~~~~l~P~~~l~y~~~~~~~~~e~~~~~~l~~~~~~~~~~~~~~G~~~~~~~~~~~~~~~~~~~~  233 (308)
T 3aeh_A          154 SLYAGAEVGYRYHLTDTTFVEPQAELVWGRLQGQTFNWNDSGMDVSMRRNSVNPLVGRTGVVSGKTFSGKDWSLTARAGL  233 (308)
T ss_dssp             EEEEEEEEEECEESSSSEEEEEEEEEEEEEEEEC---------------CEECCEEEEEEEEEEEEEECSSEEEEEEEEE
T ss_pred             EEEEEEEEEEEEECCCCCEEEEEEEEEEEEEECCCEEECCCCCEEEEECCCCCHHHHHHHEEEEEEEECCCEEEEEEEEE
T ss_conf             89999996345533887177168899999985375010475210574046532122131004558985487159999999


Q ss_pred             EEEEEEECC----------CCCCCCCCCEEEEEEEEEEEECCCCCEEEEEEEEEEECCCCCCCCEEEEEEEEEEC
Q ss_conf             776444313----------45556775204799734661004886799999999750565566226999998539
Q gi|254780598|r  141 DVAQKYETG----------KAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFYNTISLGVGMKF  205 (205)
Q Consensus       141 a~~~~~~~~----------~~~~~~~~~~g~~~G~Gvey~~it~~~~~r~EY~y~df~~~~~~~~~~~~G~~ykF  205 (205)
                      .+.......          .....+.......+++|+++ .+++++++.++|.+...++... .+.+.+|+.|+|
T Consensus       234 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~lG~~~-~~~~~~~l~~~~~~~~g~~~~~-~~~~~~g~ry~F  306 (308)
T 3aeh_A          234 HYEFDLTDSADVHLKDAAGEHQINGRKDSRMLYGVGLNA-RFGDNTRLGLEVERSAFGKYNT-DDAINANIRYSF  306 (308)
T ss_dssp             EEEEEESCC----------------CEEEEEEEEEEEEE-EETTTEEEEEEEEEEESCSSEE-EEEEEEEEEEEE
T ss_pred             EEEEECCCCCEEEEECCCCEEEECCCCCCEEEEEEEEEE-EECCCEEEEEEEEEEECCCCCE-EEEEEEEEEEEE
T ss_conf             999851887159940455404604778868999999999-9889999999999998798744-179999999996