HHsearch results for GI: 254780598 and protein with PDBid: 3prn_A

>3prn_A Porin; integral membrane protein, pore eyelet mutant; HET: C8E; 1.90A {Rhodobacter blasticus} SCOP: f.4.3.1 PDB: 1bh3_A* 1prn_A* 7prn_A* 6prn_A* 5prn_A* 2prn_A* 8prn_A* 1h6s_1
Probab=96.84  E-value=0.013  Score=30.05  Aligned_cols=38  Identities=16%  Similarity=0.256  Sum_probs=30.9

Q ss_pred             EEEEEEEEECCCCCEEEEEEEEEEECCCCCCCCEEEEEEEEEEC
Q ss_conf             99734661004886799999999750565566226999998539
Q gi|254780598|r  162 TAGVGVEVGGLSESLVARLEYRASKYSKVEGFYNTISLGVGMKF  205 (205)
Q Consensus       162 ~~G~Gvey~~it~~~~~r~EY~y~df~~~~~~~~~~~~G~~ykF  205 (205)
                      .+++|++| .|++++++.++|.+.+.     +.....+||.|.|
T Consensus       252 ~~~~g~~Y-~l~~~~~l~a~~~~~~~-----d~t~~~~Gv~~~F  289 (289)
T 3prn_A          252 AYGIGADY-QFAEGVKVSGSVQSGFA-----NETVADVGVRFDF  289 (289)
T ss_dssp             EEEEEEEE-EEETTEEEEEEEEECTT-----CCEEEEEEEEEEC
T ss_pred             EEEEEEEE-ECCCCEEEEEEEEEECC-----CCCCEEEEEEEEC
T ss_conf             89999999-76999799999999538-----9853603778889