HHSEARCH alignment of GI: 254780598 and SCOP domain: d1qjpa_

Alignment
>d1qjpa_ f.4.1.1 (A:) Outer membrane protein A (OMPA) transmembrane domain {Escherichia coli [TaxId: 562]}
Probab=99.91  E-value=5.2e-23  Score=133.67  Aligned_cols=148  Identities=22%  Similarity=0.318  Sum_probs=111.3

Q ss_pred             CCCCCCCCCCCCCCC--------CCCCCCCCEEEEEEEEEEECCCEEEEEEEEEEECCCCCCCCC---CCCCCEEEEEEE
Q ss_conf             210001223333446--------677777602689985464048379984510132155566662---122321489998
Q gi|254780598|r   54 NGPYAGLSALYNGSF--------GEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNI---HSLHGIGGSLRI  122 (205)
Q Consensus        54 ~G~y~g~~~g~~~~~--------~~~~~~~~~~G~~~GYn~q~~~~V~G~e~d~~~~~~~~~~~~---~~~~~~~~~~~~  122 (205)
                      ..+|+|+++|+....        ...+.++..+++++||+|+..   +++|+.+.+.+.......   ........++.+
T Consensus         5 ~~wYvG~~~G~~~~~~~~~~~~~~~~~~~~~~~g~~~GY~fn~~---~~vE~~y~~~g~~~~~~~~~~~~~~~~~~~l~~   81 (171)
T d1qjpa_           5 NTWYTGAKLGWSQYHDTGLINNNGPTHENKLGAGAFGGYQVNPY---VGFEMGYDWLGRMPYKGSVENGAYKAQGVQLTA   81 (171)
T ss_dssp             TEEEEEEEEEEEC-------------CCCEEEEEEEEEEEEETT---EEEEEEEEEEEECCC-------CEEEEEEEEEE
T ss_pred             CCEEEEEEEEEEEEECCCCCCCCCCCCCCCCEEEEEEEEECCCC---EEEEEEEEECCCCCCCCCCCCCEEEEEEEEEEE
T ss_conf             97999999825996244433788633578706889998870775---899999974587421266655406888889999


Q ss_pred             EEEEEECCCEEEEEEEEEEEEEEEECCC-CCCCCCCCEEEEEEEEEEEECCCCCEEEEEEEEEEECCC------CCCCCE
Q ss_conf             9754312767789885447764443134-555677520479973466100488679999999975056------556622
Q gi|254780598|r  123 RGGYEVSDSLLLYATVGPDVAQKYETGK-AGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSK------VEGFYN  195 (205)
Q Consensus       123 r~Gy~~~~~~l~Y~~~G~a~~~~~~~~~-~~~~~~~~~g~~~G~Gvey~~it~~~~~r~EY~y~df~~------~~~~~~  195 (205)
                      |..|++++++.+|+++|++.++.+.+.. ..+.+++..++.+|+|+|| +|+++|++|+||||.+..+      .+.+.|
T Consensus        82 ~~~~~~~~~~~~y~~~G~~~~~~~~~~~~~~~~~~~~~~~~~G~G~~y-~i~~~~~l~~ey~~~~~~~~~~~~~~~~~~~  160 (171)
T d1qjpa_          82 KLGYPITDDLDIYTRLGGMVWRADTYSNVYGKNHDTGVSPVFAGGVEY-AITPEIATRLEYQWTNNIGDAHTIGTRPDNG  160 (171)
T ss_dssp             EEEEESSSSEEEEEEEEEEEEEEEEECSSSCEEEEEEEEEEEEEEEEE-EEETTEEEEEEEEEEC--------------C
T ss_pred             EEEEECCCCEEEEEEEEEEEEEEEEECCCCCCCCCCCCCEEEEEEEEE-EECCCEEEEEEEEEEECCCCCCCCCCCCCCC
T ss_conf             999853886069898616999988411445620468515679827999-9279979999999996258655545432244


Q ss_pred             EEEEEEEEEC
Q ss_conf             6999998539
Q gi|254780598|r  196 TISLGVGMKF  205 (205)
Q Consensus       196 ~~~~G~~ykF  205 (205)
                      .+++|++|||
T Consensus       161 ~~~~G~~Y~F  170 (171)
T d1qjpa_         161 MLSLGVSYRF  170 (171)
T ss_dssp             EEEEEEEEEC
T ss_pred             EEEEEEEEEC
T ss_conf             8999999988


SCOP domain information

class: Membrane and cell surface proteins and peptides
fold: Transmembrane beta-barrels
superfamily: OMPA-like
family: Outer membrane protein
domain: Outer membrane protein A (OMPA) transmembrane domain
species: Escherichia coli [TaxId: 562]