BLAST/PSIBLAST alignment of GI: 254780598 and GI: 3914820 at iteration 1
>gi|3914820|sp|Q52866|ROPB_RHILV RecName: Full=22 kDa outer membrane protein; Flags: Precursor Length = 211
>gi|525267|emb|CAA56751.1| outer membrane protein [Rhizobium leguminosarum bv. viciae 248] Length = 211
 Score = 82.4 bits (202), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 68/221 (30%), Positives = 108/221 (48%), Gaps = 26/221 (11%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRH--DFNGPYA 58
           M+ L   +  S  A+A   +AQAAD V +        VP     +  P++    + G Y 
Sbjct: 1   MRVLIAGLMASVFAIAGVSAAQAADRVDQ--------VPEAPVAQEAPVKPAGSWEGFYL 52

Query: 59  GLSALYN-GSFGEEAH-HNAGGSIFAGYNVEDSCIMYGVEGDVRYT-VPVLADNIHSLHG 115
           G +  YN G FG + H +  GG +F GYN +   I+YGVE D+ Y+   V +  + + +G
Sbjct: 53  GGAGTYNMGDFGSDRHTYGFGGQVFTGYNWQQGQIVYGVESDLGYSGDDVSSGGVENKYG 112

Query: 116 IGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSES 175
             GS+R R GY++ +  LLY T G  +     +    + +    G T G GVE   ++ +
Sbjct: 113 WNGSVRGRVGYDM-NPFLLYGTAGLAIGDVKVSDDTSDESKTNFGYTVGAGVEA-FVTNN 170

Query: 176 LVARLEYRASKYSKVE----------GF-YNTISLGVGMKF 205
           +  RLEYR + Y   +          G+  N++ LG+G+KF
Sbjct: 171 ITTRLEYRYTDYQSKDYDLDSGSFSRGYDENSVKLGIGVKF 211