BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780598|ref|YP_003065011.1| outer membrane protein
[Candidatus Liberibacter asiaticus str. psy62]
         (205 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780598|ref|YP_003065011.1| outer membrane protein [Candidatus Liberibacter asiaticus str.
           psy62]
 gi|254040275|gb|ACT57071.1| outer membrane protein [Candidatus Liberibacter asiaticus str.
           psy62]
          Length = 205

 Score =  412 bits (1059), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 205/205 (100%), Positives = 205/205 (100%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL
Sbjct: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGSL 120
           SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGSL
Sbjct: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGSL 120

Query: 121 RIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARL 180
           RIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARL
Sbjct: 121 RIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARL 180

Query: 181 EYRASKYSKVEGFYNTISLGVGMKF 205
           EYRASKYSKVEGFYNTISLGVGMKF
Sbjct: 181 EYRASKYSKVEGFYNTISLGVGMKF 205


>gi|315121798|ref|YP_004062287.1| outer membrane protein [Candidatus Liberibacter solanacearum
           CLso-ZC1]
 gi|313495200|gb|ADR51799.1| outer membrane protein [Candidatus Liberibacter solanacearum
           CLso-ZC1]
          Length = 231

 Score =  145 bits (367), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 95/232 (40%), Positives = 132/232 (56%), Gaps = 28/232 (12%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAAD----PVRRAHHG-GRGVVPTIAT-NRYVPIRHDFN 54
           M+K FLAVGVS+L L SF + QAAD    P RR H    RGVVPT+ + NRYV  +    
Sbjct: 1   MKKFFLAVGVSTLTLVSFSAVQAADAVQRPQRRQHASVSRGVVPTVVSANRYVYSQQGIE 60

Query: 55  GPYAGLSALYNGSF-GEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLAD----- 108
           GPYAG+S  +  +F G++ + + GGS+FAGYNV++    YG E D RY+  + +      
Sbjct: 61  GPYAGMSIFHERNFSGKDHNKDIGGSLFAGYNVQEGDFFYGAEADARYSHDIASKEHKAA 120

Query: 109 -----------NIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPI 157
                       ++      GSLR RGGYE++  +++Y TVG     K     A      
Sbjct: 121 RLDQKDDAAVSKMYHAADFSGSLRFRGGYEIAAPVVVYGTVGVAAVHKASKAPADAAASP 180

Query: 158 A----IGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFYNTISLGVGMKF 205
           A    IGGTAG+GVE   L ++++ R+EYRA+KYS V    N +SLG+G++F
Sbjct: 181 AKAFYIGGTAGLGVE-SVLVDNIIGRVEYRATKYSGVSHLQNVVSLGLGIRF 231


>gi|190891163|ref|YP_001977705.1| outer membrane protein [Rhizobium etli CIAT 652]
 gi|190696442|gb|ACE90527.1| outer membrane protein [Rhizobium etli CIAT 652]
          Length = 211

 Score = 82.8 bits (203), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 69/221 (31%), Positives = 110/221 (49%), Gaps = 26/221 (11%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRH--DFNGPYA 58
           M+ L   +  S+ A+A    AQAAD V +        VP     +  P++   ++ G Y 
Sbjct: 1   MRVLIAGLMASAFAIAGVSVAQAADAVDQ--------VPEAPVAQDAPVKPAGNWEGFYL 52

Query: 59  GLSALYN-GSFGEEAH-HNAGGSIFAGYNVEDSCIMYGVEGDVRYT-VPVLADNIHSLHG 115
           G +  YN G FG + H +  GG +F GYN +   I+YGVE D+ Y+   V +  + + +G
Sbjct: 53  GGAGTYNMGDFGSDRHTYGFGGQVFTGYNWQQGQIVYGVESDLGYSGDDVSSGGVKNKYG 112

Query: 116 IGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSES 175
             GS+R R GY++ +  LLY T G  +     +    + +  A G T G GVE   ++ +
Sbjct: 113 WNGSVRGRVGYDM-NPFLLYGTAGLALGNIKVSDGTSDESKTAYGYTVGAGVEA-FVTNN 170

Query: 176 LVARLEYRASKYSKVE----------GF-YNTISLGVGMKF 205
           +  RLEYR + Y   +          G+  N++ LG+G+KF
Sbjct: 171 ITTRLEYRYTDYQSKDYDLDSGSFSRGYDENSVKLGIGVKF 211


>gi|3914820|sp|Q52866|ROPB_RHILV RecName: Full=22 kDa outer membrane protein; Flags: Precursor
 gi|525267|emb|CAA56751.1| outer membrane protein [Rhizobium leguminosarum bv. viciae 248]
          Length = 211

 Score = 82.4 bits (202), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 68/221 (30%), Positives = 108/221 (48%), Gaps = 26/221 (11%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRH--DFNGPYA 58
           M+ L   +  S  A+A   +AQAAD V +        VP     +  P++    + G Y 
Sbjct: 1   MRVLIAGLMASVFAIAGVSAAQAADRVDQ--------VPEAPVAQEAPVKPAGSWEGFYL 52

Query: 59  GLSALYN-GSFGEEAH-HNAGGSIFAGYNVEDSCIMYGVEGDVRYT-VPVLADNIHSLHG 115
           G +  YN G FG + H +  GG +F GYN +   I+YGVE D+ Y+   V +  + + +G
Sbjct: 53  GGAGTYNMGDFGSDRHTYGFGGQVFTGYNWQQGQIVYGVESDLGYSGDDVSSGGVENKYG 112

Query: 116 IGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSES 175
             GS+R R GY++ +  LLY T G  +     +    + +    G T G GVE   ++ +
Sbjct: 113 WNGSVRGRVGYDM-NPFLLYGTAGLAIGDVKVSDDTSDESKTNFGYTVGAGVEA-FVTNN 170

Query: 176 LVARLEYRASKYSKVE----------GF-YNTISLGVGMKF 205
           +  RLEYR + Y   +          G+  N++ LG+G+KF
Sbjct: 171 ITTRLEYRYTDYQSKDYDLDSGSFSRGYDENSVKLGIGVKF 211


>gi|327193361|gb|EGE60264.1| outer membrane protein [Rhizobium etli CNPAF512]
          Length = 211

 Score = 80.9 bits (198), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 68/221 (30%), Positives = 109/221 (49%), Gaps = 26/221 (11%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRH--DFNGPYA 58
           M+ L   +  S+ A+A    AQAAD V +        VP     +  P++   ++ G Y 
Sbjct: 1   MRVLIAGLMASAFAIAGVSVAQAADAVDQ--------VPEAPVAQDAPVKPAGNWEGFYL 52

Query: 59  GLSALYN-GSFGEEAH-HNAGGSIFAGYNVEDSCIMYGVEGDVRYT-VPVLADNIHSLHG 115
           G +  YN G FG + H +  GG +F GYN +   I+YGVE D+ Y+   V +  + + +G
Sbjct: 53  GGAGTYNMGDFGSDRHTYGFGGQVFTGYNWQQGQIVYGVESDLGYSGDDVSSGGVKNKYG 112

Query: 116 IGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSES 175
             GS+R R GY++ +  LLY T G  +     +    + +    G T G GVE   ++ +
Sbjct: 113 WNGSVRGRVGYDM-NPFLLYGTAGLALGNIKVSDGTSDESKTNYGYTVGAGVEA-FVTNN 170

Query: 176 LVARLEYRASKYSKVE----------GF-YNTISLGVGMKF 205
           +  RLEYR + Y   +          G+  N++ LG+G+KF
Sbjct: 171 ITTRLEYRYTDYQSKDYDLDSGSFSRGYDENSVKLGIGVKF 211


>gi|110634323|ref|YP_674531.1| OmpA-like transmembrane region [Mesorhizobium sp. BNC1]
 gi|110285307|gb|ABG63366.1| OmpA-like transmembrane region [Chelativorans sp. BNC1]
          Length = 216

 Score = 79.7 bits (195), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 60/168 (35%), Positives = 88/168 (52%), Gaps = 16/168 (9%)

Query: 53  FNGPYAGLSALY--------NGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYT-V 103
           + GPYAG++  Y        +G+ GE       G++F G+  +    +YGVEGD+ Y  +
Sbjct: 50  WAGPYAGIALGYGFSGEVSADGAPGEVETDGFVGNVFGGWQGQSGQFVYGVEGDIGYNGM 109

Query: 104 PVLADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTA 163
                 +   HG+ GSLR R GY  +D++LLYAT G   ++   +G     +  A+G TA
Sbjct: 110 EGSEGGVDVEHGVDGSLRARLGYAATDNVLLYATGGGAASRLEASGGGLTESETAVGWTA 169

Query: 164 GVGVEVGGLSESLVARLEYRASKYS------KVEGFYNTISLGVGMKF 205
           G GV+V  L+    ARLEYR +  S       V+   N + LGVGM+F
Sbjct: 170 GAGVDV-KLTPKSFARLEYRYTDLSAEFDSVDVDTTSNKVMLGVGMQF 216


>gi|222085476|ref|YP_002544006.1| outer membrane protein [Agrobacterium radiobacter K84]
 gi|221722924|gb|ACM26080.1| outer membrane protein [Agrobacterium radiobacter K84]
          Length = 210

 Score = 78.2 bits (191), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 64/219 (29%), Positives = 107/219 (48%), Gaps = 23/219 (10%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+ L   + VS+ A+  F +A AAD V +         P +A     P  ++++G Y G 
Sbjct: 1   MRTLIKTLMVSAFAIGGFNAAYAADAVEQIPQ------PPVA-QEAAPAINNWSGFYIGG 53

Query: 61  SALYN-GSFGEEAH-HNAGGSIFAGYNVEDSCIMYGVEGDVRYT-VPVLADNIHSLHGIG 117
           +  +N G F    + +  GG  F GYN +   I+YGVE D+ Y  +    + + + +G+ 
Sbjct: 54  AGDWNKGHFSRNGNGYGFGGEAFTGYNWQQGQIVYGVEADLGYAGIDSTRNGLTAKNGVN 113

Query: 118 GSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLV 177
           GS+R R GY+  +  +LY T G  + Q   +      +  A+G T G G E   ++ ++ 
Sbjct: 114 GSVRGRLGYDF-NPFMLYGTAGLAIGQNKLSDDTSSDSKTAVGYTVGAGAET-FITNNVT 171

Query: 178 ARLEYRASKYSK----------VEGF-YNTISLGVGMKF 205
           ARLEYR + Y K            G+   ++ +G+G+KF
Sbjct: 172 ARLEYRYTDYGKKNFDLDSGNFSRGYDEQSVKVGIGVKF 210


>gi|260469600|ref|ZP_05813765.1| OmpA domain protein transmembrane region-containing protein
           [Mesorhizobium opportunistum WSM2075]
 gi|259028626|gb|EEW29937.1| OmpA domain protein transmembrane region-containing protein
           [Mesorhizobium opportunistum WSM2075]
          Length = 217

 Score = 75.1 bits (183), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 71/219 (32%), Positives = 104/219 (47%), Gaps = 31/219 (14%)

Query: 6   LAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYN 65
           LAV +   AL    +A AAD V+          P  A    +P+   + GPYAG++  Y 
Sbjct: 11  LAVALGLFALGG--TAYAADVVQEEP-------PAPAPVAELPVAS-WAGPYAGINLGY- 59

Query: 66  GSFGEEAHHNAG---------GSIFAGYNVEDSCIMYGVEGDVRYTVPVLADN-IHSLHG 115
           G  G     + G         GS+F GY  +    +YG E ++ Y      DN +HS  G
Sbjct: 60  GFSGRTKEKDLGFETDTKGFVGSVFGGYQWQQENFVYGGEAELGYNGVKGDDNGVHSKGG 119

Query: 116 IGGSLRIRGGYEVSDSLLLYATVG-PDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSE 174
             GSLR R GY V+  +LLY T G    + K E    G  T   +G TAG+G ++  L++
Sbjct: 120 FEGSLRARLGYAVTPEILLYGTGGLAGRSLKVEDDTFGSDTATMLGWTAGLGTDI-KLTD 178

Query: 175 SLVARLEYRASKY--------SKVEGFYNTISLGVGMKF 205
           ++  R+EYR + +         KV+   N ++ G+GMKF
Sbjct: 179 NVFGRVEYRYTDFGSKSFDNIGKVKATDNRVTFGLGMKF 217


>gi|218675314|ref|ZP_03524983.1| outer membrane protein [Rhizobium etli GR56]
          Length = 211

 Score = 72.8 bits (177), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 58/179 (32%), Positives = 92/179 (51%), Gaps = 16/179 (8%)

Query: 41  IATNRYVPIRHDFNGPYAGLSALYN-GSFGEEAH-HNAGGSIFAGYNVEDSCIMYGVEGD 98
           IA +  V    ++ G Y G +  YN G FG + H +  GG +F GYN +   I+YGVE D
Sbjct: 35  IAQDAPVKPAGNWEGFYLGGAGTYNMGDFGSDRHTYGFGGQVFTGYNWQQGQIVYGVESD 94

Query: 99  VRYT-VPVLADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPI 157
           + Y+   V +  + + +G  GS+R R GY++ +  LLY T G  +     +    + +  
Sbjct: 95  LGYSGDDVSSGGVKNKYGWNGSVRGRVGYDM-NPFLLYGTAGLALGNIKVSDDTSDESKT 153

Query: 158 AIGGTAGVGVEVGGLSESLVARLEYRASKYSKVE----------GF-YNTISLGVGMKF 205
           A G T G GVE   ++ ++  RLEYR + Y   +          G+  N++ LG+G+KF
Sbjct: 154 AYGYTVGAGVEA-FVTNNITTRLEYRYTDYQSKDYDLDSGSFSRGYDENSVKLGIGVKF 211


>gi|241203970|ref|YP_002975066.1| porin [Rhizobium leguminosarum bv. trifolii WSM1325]
 gi|240857860|gb|ACS55527.1| porin [Rhizobium leguminosarum bv. trifolii WSM1325]
          Length = 211

 Score = 72.4 bits (176), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 56/184 (30%), Positives = 93/184 (50%), Gaps = 18/184 (9%)

Query: 38  VPTIATNRYVPIRH--DFNGPYAGLSALYN-GSFGEEAH-HNAGGSIFAGYNVEDSCIMY 93
           +P     +  P++   ++ G Y G +  YN G FG + H +  GG +F GYN +   I+Y
Sbjct: 30  IPEAPVAQDAPVKPAGNWEGFYLGGAGTYNMGDFGSDRHTYGFGGQVFTGYNWQQGQIVY 89

Query: 94  GVEGDVRYT-VPVLADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAG 152
           GVE D+ Y+   V +  + + +G  GS+R R GY++ +  LLY T G  +     +    
Sbjct: 90  GVESDLGYSGDDVSSGGVKNKYGWNGSVRGRVGYDM-NPFLLYGTAGLAIGDVKVSDDTS 148

Query: 153 EITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVE----------GF-YNTISLGV 201
           + +    G T G GVE   ++ ++  RLEYR + Y   +          G+  N++ LG+
Sbjct: 149 DESKTNFGYTVGAGVEA-FVTNNITTRLEYRYTDYQSKDYDLDSGSFSRGYDENSVKLGI 207

Query: 202 GMKF 205
           G+KF
Sbjct: 208 GVKF 211


>gi|116251355|ref|YP_767193.1| ropB outer membrane protein [Rhizobium leguminosarum bv. viciae
           3841]
 gi|115256003|emb|CAK07084.1| putative ropB outer membrane protein [Rhizobium leguminosarum bv.
           viciae 3841]
 gi|220979413|gb|ACL97988.1| outer membrane protein B [Rhizobium leguminosarum bv. viciae]
          Length = 211

 Score = 71.6 bits (174), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 56/183 (30%), Positives = 92/183 (50%), Gaps = 18/183 (9%)

Query: 39  PTIATNRYVPIRH--DFNGPYAGLSALYN-GSFGEEAH-HNAGGSIFAGYNVEDSCIMYG 94
           P     +  P++   ++ G Y G +  YN G FG + H +  GG +F GYN +   I+YG
Sbjct: 31  PEAPVAQEAPVKPAGNWEGFYLGGAGTYNMGDFGSDRHTYGFGGQVFTGYNWQQGQIVYG 90

Query: 95  VEGDVRYT-VPVLADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGE 153
           VE D+ Y+   V +  + + +G  GS+R R GY++ +  LLY T G  +     +    +
Sbjct: 91  VESDLGYSGDDVSSGGVKNKYGWNGSVRGRVGYDM-NPFLLYGTAGLAIGDVKVSDDTSD 149

Query: 154 ITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVE----------GF-YNTISLGVG 202
            +    G T G GVE   ++ ++  RLEYR + Y   +          G+  N++ LG+G
Sbjct: 150 ESKTNFGYTVGAGVEA-FVTNNITTRLEYRYTDYQSKDYDLDSGSFSRGYDENSVKLGIG 208

Query: 203 MKF 205
           +KF
Sbjct: 209 VKF 211


>gi|218663696|ref|ZP_03519626.1| outer membrane protein [Rhizobium etli IE4771]
          Length = 203

 Score = 71.2 bits (173), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 57/179 (31%), Positives = 92/179 (51%), Gaps = 16/179 (8%)

Query: 41  IATNRYVPIRHDFNGPYAGLSALYN-GSFGEEAH-HNAGGSIFAGYNVEDSCIMYGVEGD 98
           +A +  V    ++ G Y G +  YN G FG + H +  GG +F GYN +   I+YGVE D
Sbjct: 27  VAQDAPVKPAGNWEGFYLGGAGTYNMGDFGSDRHTYGFGGQVFTGYNWQAGQIVYGVESD 86

Query: 99  VRYT-VPVLADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPI 157
           + Y+   V +  + + +G  GS+R R GY++ +  LLY T G  +     +    + +  
Sbjct: 87  LGYSGDDVSSGGVENKYGWNGSVRGRVGYDM-NPFLLYGTAGLALGNIKVSDDTSDESKT 145

Query: 158 AIGGTAGVGVEVGGLSESLVARLEYRASKYSKVE----------GF-YNTISLGVGMKF 205
           A G T G GVE   ++ ++  RLEYR + Y   +          G+  N++ LG+G+KF
Sbjct: 146 AYGYTVGAGVEA-FVTNNITTRLEYRYTDYQSKDYDLDSGSFSRGYDENSVKLGIGVKF 203


>gi|209548691|ref|YP_002280608.1| porin [Rhizobium leguminosarum bv. trifolii WSM2304]
 gi|209534447|gb|ACI54382.1| porin [Rhizobium leguminosarum bv. trifolii WSM2304]
          Length = 211

 Score = 69.7 bits (169), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 56/184 (30%), Positives = 92/184 (50%), Gaps = 18/184 (9%)

Query: 38  VPTIATNRYVPIRH--DFNGPYAGLSALYN-GSFGEEAH-HNAGGSIFAGYNVEDSCIMY 93
           +P     +  P++    + G Y G +  YN G FG + H +  GG +F GYN +   I+Y
Sbjct: 30  IPEAPVAQEAPVKPAGSWEGFYLGGAGTYNMGDFGSDRHTYGFGGQVFTGYNWQQGQIVY 89

Query: 94  GVEGDVRYT-VPVLADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAG 152
           GVE D+ Y+   V +  + + +G  GS+R R GY++ +  LLY T G  +     +    
Sbjct: 90  GVESDLGYSGDDVSSGGVKNKYGWNGSVRGRVGYDM-NPFLLYGTAGLALGNVKVSDGTS 148

Query: 153 EITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVE----------GF-YNTISLGV 201
           + +    G T G GVE   ++ ++  RLEYR + Y   +          G+  N++ LG+
Sbjct: 149 DESKTNYGYTVGAGVEA-FVTNNITTRLEYRYTDYQSKDYDLDSGSFSRGYDENSVKLGI 207

Query: 202 GMKF 205
           G+KF
Sbjct: 208 GVKF 211


>gi|319784400|ref|YP_004143876.1| porin [Mesorhizobium ciceri biovar biserrulae WSM1271]
 gi|317170288|gb|ADV13826.1| porin [Mesorhizobium ciceri biovar biserrulae WSM1271]
          Length = 220

 Score = 69.3 bits (168), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 71/223 (31%), Positives = 104/223 (46%), Gaps = 36/223 (16%)

Query: 6   LAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYN 65
           LAV +   AL+   +A AAD V           P  A    +P+   + GPYAGL+  Y 
Sbjct: 11  LAVALGLFALSG--TAYAADVVSEEP-------PAPAPIAELPVAS-WAGPYAGLNVGY- 59

Query: 66  GSFGEEAHHNAG------------GSIFAGYNVEDSCIMYGVEGDVRYTVPVLADN--IH 111
           G  G     + G            GS+F GY  +    +YG E ++ Y   V  D+  ++
Sbjct: 60  GFSGHTKEKDLGVDNVDVGTKGFVGSVFGGYQWQQENFVYGAEAELGYN-GVKGDDSGVN 118

Query: 112 SLHGIGGSLRIRGGYEVSDSLLLYATVG-PDVAQKYETGKAGEITPIAIGGTAGVGVEVG 170
           S  G  GSLR R GY V+  +LLY T G    + K E    G      +G TAG+G ++ 
Sbjct: 119 SKAGFEGSLRARLGYAVTPEILLYGTGGLAGRSLKVEDDVYGSDRATLLGWTAGLGTDI- 177

Query: 171 GLSESLVARLEYRASKY--------SKVEGFYNTISLGVGMKF 205
            L++++  R+EYR + +         KV+   N ++ GVGMKF
Sbjct: 178 KLTDNVFGRVEYRYTDFGSKSFDGIGKVKATDNRVTFGVGMKF 220


>gi|86357119|ref|YP_469011.1| outer membrane protein [Rhizobium etli CFN 42]
 gi|86281221|gb|ABC90284.1| outer membrane protein [Rhizobium etli CFN 42]
          Length = 211

 Score = 68.2 bits (165), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 56/179 (31%), Positives = 91/179 (50%), Gaps = 16/179 (8%)

Query: 41  IATNRYVPIRHDFNGPYAGLSALYN-GSFGEEAH-HNAGGSIFAGYNVEDSCIMYGVEGD 98
           +A +  V    ++ G Y G +  YN G FG + H +  GG +F GYN +   I+YGVE D
Sbjct: 35  VAQDAPVKPAGNWEGFYLGGAGTYNMGDFGSDRHTYGFGGQVFTGYNWQAGQIVYGVESD 94

Query: 99  VRYT-VPVLADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPI 157
           + Y+   V +  + + +G  GS+R R GY++ +  LLY T G  +     +    + +  
Sbjct: 95  LGYSGDDVSSGGVKNKYGWNGSVRGRVGYDM-NPFLLYGTAGLALGNVKVSDGTSDESKT 153

Query: 158 AIGGTAGVGVEVGGLSESLVARLEYRASKYSKVE----------GF-YNTISLGVGMKF 205
             G T G GVE   ++ ++  RLEYR + Y   +          G+  N++ LG+G+KF
Sbjct: 154 NYGYTVGAGVEA-FVTNNITTRLEYRYTDYQSKDYDLDSGSFSRGYDENSVKLGIGVKF 211


>gi|3914201|sp|Q45110|OM25_BRUCA RecName: Full=25 kDa outer-membrane immunogenic protein; Flags:
           Precursor
 gi|1457931|gb|AAB36692.1| 25 kDa outer membrane protein [Brucella canis]
          Length = 213

 Score = 67.0 bits (162), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 71/227 (31%), Positives = 108/227 (47%), Gaps = 36/227 (15%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+ L   V VS+  L    +A AAD ++          P +     V  ++ + G Y GL
Sbjct: 1   MRTLKSLVIVSAALLPFSATAFAADAIQEQ--------PPVPAPVEVAPQYSWAGGYTGL 52

Query: 61  SALYNGSFGEEAHHNAGGSI---------FAGYNVEDSCIMYGVEGDVRYTVPVLA-DNI 110
              Y G    +A  +  GSI         FAG+N +   I+YGVEGD  Y+    + D +
Sbjct: 53  ---YLGYGWNKAKTSTVGSIKPDDWKAGAFAGWNFQKDQIVYGVEGDAGYSWAKKSKDGL 109

Query: 111 HSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQ-KYETGKAGEITPIAIGGTAGVGVEV 169
               G  GSLR R GY++ + ++ Y T G   +Q K   G  GE +   +G TAG G+E 
Sbjct: 110 EVKQGFEGSLRARVGYDL-NPVMPYLTAGIAGSQIKLNNGLDGE-SKFRVGWTAGAGLEA 167

Query: 170 GGLSESLVARLEYRASKYSK---------VEGFYNT--ISLGVGMKF 205
             L+++++ R+EYR ++YS          V    +T  I +G+G KF
Sbjct: 168 -KLTDNILGRVEYRYTQYSNKNYDLAGTTVRNKLDTQDIRVGIGYKF 213


>gi|13476553|ref|NP_108123.1| outer membrane protein [Mesorhizobium loti MAFF303099]
 gi|14027314|dbj|BAB54268.1| outer membrane protein [Mesorhizobium loti MAFF303099]
          Length = 218

 Score = 66.6 bits (161), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 72/219 (32%), Positives = 104/219 (47%), Gaps = 30/219 (13%)

Query: 6   LAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALY- 64
           LAV +   AL    +A AAD V+          P  A    +P+   + GPYAGL+  Y 
Sbjct: 11  LAVALGLFALGG--TAYAADVVQEEP-------PAPAPVAELPVAS-WAGPYAGLNVGYG 60

Query: 65  -NGSFGEEAHHNAG------GSIFAGYNVEDSCIMYGVEGDVRYTVPVLADN-IHSLHGI 116
            +G   E+    +       GS+F GY  +    +YG E ++ Y      DN I+S  G 
Sbjct: 61  FSGRTKEKDFDVSTDTKGFVGSVFGGYQWQQENFVYGGEAELGYNGVKGDDNGINSKAGF 120

Query: 117 GGSLRIRGGYEVSDSLLLYATVG-PDVAQKYETGKAG-EITPIAIGGTAGVGVEVGGLSE 174
            GSLR R GY V+  +LLY T G    + K E    G       +G TAGVG ++  L++
Sbjct: 121 EGSLRARLGYAVTPEILLYGTGGLAGRSLKVEDTVLGVSDRATMLGWTAGVGTDI-KLTD 179

Query: 175 SLVARLEYRASKY--------SKVEGFYNTISLGVGMKF 205
           ++  R+EYR + +         KV+   N ++ GVGMKF
Sbjct: 180 NVFGRVEYRYTDFGSKSFDGIGKVKATDNRVTFGVGMKF 218


>gi|222148166|ref|YP_002549123.1| outer membrane protein [Agrobacterium vitis S4]
 gi|221735154|gb|ACM36117.1| outer membrane protein [Agrobacterium vitis S4]
          Length = 212

 Score = 66.2 bits (160), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 65/223 (29%), Positives = 106/223 (47%), Gaps = 29/223 (13%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTI--ATNRYVPIRHDFNGPYA 58
           M+ L + +  SS  L+    A AAD V          VP    A +   P+  ++ G Y 
Sbjct: 1   MRTLVMILLASSAGLSLVTGAHAADAVMS--------VPEAPAAVDMPAPV-SNWAGAYV 51

Query: 59  GLSALYNGSFGEEAHHNA---GGSIFAGYNVEDSCIMYGVEGDVRY--TVPVLADNIHSL 113
           G +  Y       +  +A   GG ++ GYN+++  I+YG E D+ Y          ++  
Sbjct: 52  GGAGTYTMGRSHGSKFSARAFGGQVYGGYNMQNDKIVYGGEADIGYDGNGSRSGAGLNGK 111

Query: 114 HGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLS 173
            G+ GS+R R GY++ +  ++Y T G   A    +G  G  +  A+G T G GVE   ++
Sbjct: 112 QGVNGSIRGRVGYDL-NPFMVYGTAGVAAADTKISGAGGSDSKAALGYTVGAGVEA-MVT 169

Query: 174 ESLVARLEYRASKY---------SKV-EGFYN-TISLGVGMKF 205
            ++  R+EYR + Y         SKV  GF + ++ +G+GMKF
Sbjct: 170 NNITTRVEYRYTDYQNKDYNIGGSKVSRGFDDQSVKVGIGMKF 212


>gi|218508536|ref|ZP_03506414.1| outer membrane protein [Rhizobium etli Brasil 5]
          Length = 144

 Score = 65.1 bits (157), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 49/144 (34%), Positives = 75/144 (52%), Gaps = 14/144 (9%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRH--DFNGPYA 58
           M+ L   +  S+ A+A    AQAAD V +        VP     +  P++   ++ G Y 
Sbjct: 1   MRVLIAGLMASAFAIAGVSVAQAADAVDQ--------VPEAPVAQDAPVKPAGNWEGFYL 52

Query: 59  GLSALYN-GSFGEEAH-HNAGGSIFAGYNVEDSCIMYGVEGDVRYT-VPVLADNIHSLHG 115
           G +  YN G FG + H +  GG +F GYN +   I+YGVE D+ Y+   V +  + + +G
Sbjct: 53  GGAGTYNMGDFGSDRHTYGFGGQVFTGYNWQQGQIVYGVESDLGYSGDDVSSGGVKNKYG 112

Query: 116 IGGSLRIRGGYEVSDSLLLYATVG 139
             GS+R R GY++ +  LLY T G
Sbjct: 113 WNGSVRGRVGYDM-NPFLLYGTAG 135


>gi|148560659|ref|YP_001258682.1| outer-membrane protein Omp25 [Brucella ovis ATCC 25840]
 gi|3914204|sp|Q45335|OM25_BRUO2 RecName: Full=25 kDa outer-membrane immunogenic protein; Flags:
           Precursor
 gi|1457929|gb|AAB06702.1| 25 kDa outer membrane protein [Brucella ovis]
 gi|148371916|gb|ABQ61895.1| outer-membrane protein Omp25 [Brucella ovis ATCC 25840]
          Length = 201

 Score = 65.1 bits (157), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 64/216 (29%), Positives = 105/216 (48%), Gaps = 26/216 (12%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+ L   V VS+  L    +A AAD ++          P +     V  ++ + G Y GL
Sbjct: 1   MRTLKSLVIVSAALLPFSATAFAADAIQEQ--------PPVPAPVEVAPQYSWAGGYTGL 52

Query: 61  SALYNGSFGEEAHHNAGGSI---------FAGYNVEDSCIMYGVEGDVRYTVPVLA-DNI 110
              Y G    +A  +  GSI         FAG+N +   I+YGVEG+  Y+    + D +
Sbjct: 53  ---YLGYGWNKAKTSTVGSIKPDDWKAGAFAGWNFQQDQIVYGVEGNAGYSWAKKSKDGL 109

Query: 111 HSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVG 170
               G  GSLR R GY++ + ++ Y T G   +Q        + +   +G TAG G+E  
Sbjct: 110 EVKQGFEGSLRARVGYDL-NPVMPYLTAGIAGSQIKLNNGLDDESKFRVGWTAGAGLEA- 167

Query: 171 GLSESLVARLEYRASKY-SKVEGFYNTISLGVGMKF 205
            L+++++ R+EYR ++Y +K++     I +G+G KF
Sbjct: 168 KLTDNILGRVEYRYTQYGNKLDT--QDIRVGIGYKF 201


>gi|254718838|ref|ZP_05180649.1| OmpA-like transmembrane domain protein [Brucella sp. 83/13]
 gi|265983822|ref|ZP_06096557.1| outer-membrane immunogenic protein [Brucella sp. 83/13]
 gi|306838760|ref|ZP_07471594.1| OmpA-like transmembrane domain protein [Brucella sp. NF 2653]
 gi|306843662|ref|ZP_07476262.1| OmpA-like transmembrane domain protein [Brucella sp. BO1]
 gi|206596726|emb|CAQ68393.1| outer membrane protein 25 [Brucella sp. BO1]
 gi|264662414|gb|EEZ32675.1| outer-membrane immunogenic protein [Brucella sp. 83/13]
 gi|306275972|gb|EFM57681.1| OmpA-like transmembrane domain protein [Brucella sp. BO1]
 gi|306406162|gb|EFM62407.1| OmpA-like transmembrane domain protein [Brucella sp. NF 2653]
          Length = 213

 Score = 63.9 bits (154), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 66/226 (29%), Positives = 105/226 (46%), Gaps = 34/226 (15%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+ L   V VS+  L    +A AAD ++          P +     V  ++ + G Y GL
Sbjct: 1   MRTLKSLVIVSAALLPFSATAFAADAIQEQ--------PPVPAPVEVAPQYSWAGGYTGL 52

Query: 61  SALYNGSFGEEAHHNAGGSI---------FAGYNVEDSCIMYGVEGDVRYTVPVLA-DNI 110
              Y G    +A  +  GSI         FAG+N +   I+YGVEGD  Y+    + D +
Sbjct: 53  ---YLGYGWNKAKTSTVGSIKPDDWKAGAFAGWNFQQDQIVYGVEGDAGYSWAKKSKDGL 109

Query: 111 HSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVG 170
               G  GSLR R GY++ + ++ Y T G   +Q        + +   +G TAG G+E  
Sbjct: 110 EVKQGFEGSLRARVGYDL-NPVMPYLTAGIAGSQIKLNNGLDDESKFRVGWTAGAGLEA- 167

Query: 171 GLSESLVARLEYRASKY---------SKVEGFYNT--ISLGVGMKF 205
            L+++++ R+EYR ++Y         + V    +T  I +G+G KF
Sbjct: 168 KLTDNILGRVEYRYTQYGNKNYDLAGTNVRNKLDTQDIRVGIGYKF 213


>gi|23501588|ref|NP_697715.1| outer-membrane protein Omp25 [Brucella suis 1330]
 gi|62289663|ref|YP_221456.1| outer-membrane protein, 25 kDa [Brucella abortus bv. 1 str. 9-941]
 gi|82699590|ref|YP_414164.1| OmpA-like transmembrane domain-containing protein [Brucella
           melitensis biovar Abortus 2308]
 gi|163842972|ref|YP_001627376.1| 25 kDa outer-membrane immunogenic protein precursor [Brucella suis
           ATCC 23445]
 gi|254688973|ref|ZP_05152227.1| OmpA-like transmembrane domain protein [Brucella abortus bv. 6 str.
           870]
 gi|254697107|ref|ZP_05158935.1| OmpA-like transmembrane domain protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|254701484|ref|ZP_05163312.1| OmpA-like transmembrane domain protein [Brucella suis bv. 5 str.
           513]
 gi|254704031|ref|ZP_05165859.1| OmpA-like transmembrane domain protein [Brucella suis bv. 3 str.
           686]
 gi|254707067|ref|ZP_05168895.1| OmpA-like transmembrane domain protein [Brucella pinnipedialis
           M163/99/10]
 gi|254709823|ref|ZP_05171634.1| OmpA-like transmembrane domain protein [Brucella pinnipedialis
           B2/94]
 gi|254713826|ref|ZP_05175637.1| OmpA-like transmembrane domain protein [Brucella ceti M644/93/1]
 gi|254717116|ref|ZP_05178927.1| OmpA-like transmembrane domain protein [Brucella ceti M13/05/1]
 gi|254730003|ref|ZP_05188581.1| OmpA-like transmembrane domain protein [Brucella abortus bv. 4 str.
           292]
 gi|256031313|ref|ZP_05444927.1| OmpA-like transmembrane domain protein [Brucella pinnipedialis
           M292/94/1]
 gi|256159433|ref|ZP_05457205.1| OmpA-like transmembrane domain protein [Brucella ceti M490/95/1]
 gi|256254721|ref|ZP_05460257.1| OmpA-like transmembrane domain protein [Brucella ceti B1/94]
 gi|256257221|ref|ZP_05462757.1| OmpA-like transmembrane domain protein [Brucella abortus bv. 9 str.
           C68]
 gi|256369135|ref|YP_003106643.1| outer-membrane protein Omp25 [Brucella microti CCM 4915]
 gi|260168451|ref|ZP_05755262.1| OmpA-like transmembrane domain protein [Brucella sp. F5/99]
 gi|260545586|ref|ZP_05821327.1| outer-membrane immunogenic protein [Brucella abortus NCTC 8038]
 gi|260754463|ref|ZP_05866811.1| outer membrane protein [Brucella abortus bv. 6 str. 870]
 gi|260757682|ref|ZP_05870030.1| outer-membrane protein [Brucella abortus bv. 4 str. 292]
 gi|260761509|ref|ZP_05873852.1| outer-membrane immunogenic protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260883492|ref|ZP_05895106.1| outer-membrane immunogenic protein [Brucella abortus bv. 9 str.
           C68]
 gi|261218931|ref|ZP_05933212.1| outer membrane protein [Brucella ceti M13/05/1]
 gi|261221901|ref|ZP_05936182.1| outer-membrane immunogenic protein [Brucella ceti B1/94]
 gi|261314536|ref|ZP_05953733.1| outer membrane protein [Brucella pinnipedialis M163/99/10]
 gi|261317361|ref|ZP_05956558.1| outer-membrane immunogenic protein [Brucella pinnipedialis B2/94]
 gi|261321570|ref|ZP_05960767.1| outer membrane protein Omp25 [Brucella ceti M644/93/1]
 gi|261752028|ref|ZP_05995737.1| outer-membrane immunogenic protein [Brucella suis bv. 5 str. 513]
 gi|261754686|ref|ZP_05998395.1| outer-membrane immunogenic protein [Brucella suis bv. 3 str. 686]
 gi|261757914|ref|ZP_06001623.1| outer-membrane immunogenic protein [Brucella sp. F5/99]
 gi|265988399|ref|ZP_06100956.1| outer-membrane immunogenic protein [Brucella pinnipedialis
           M292/94/1]
 gi|265997865|ref|ZP_06110422.1| outer-membrane protein [Brucella ceti M490/95/1]
 gi|3914205|sp|Q45689|OM25_BRUSU RecName: Full=25 kDa outer-membrane immunogenic protein; Flags:
           Precursor
 gi|68067868|sp|Q44664|OM25_BRUAB RecName: Full=25 kDa outer-membrane immunogenic protein; Flags:
           Precursor
 gi|1457937|gb|AAB36695.1| 25 kDa outer membrane protein [Brucella suis 1330]
 gi|23347502|gb|AAN29630.1| outer-membrane protein Omp25 [Brucella suis 1330]
 gi|46251178|gb|AAS84560.1| Omp25 [Brucella ceti]
 gi|46251180|gb|AAS84561.1| Omp25 [Brucella ceti]
 gi|46251182|gb|AAS84562.1| Omp25 [Brucella pinnipedialis]
 gi|46251184|gb|AAS84563.1| Omp25 [Brucella ceti]
 gi|62195795|gb|AAX74095.1| outer-membrane protein, 25 kDa [Brucella abortus bv. 1 str. 9-941]
 gi|82615691|emb|CAJ10678.1| OmpA-like transmembrane domain [Brucella melitensis biovar Abortus
           2308]
 gi|157310307|emb|CAN43865.1| outer membrane protein 25 [Brucella microti CCM 4915]
 gi|157310309|emb|CAN43866.1| outer membrane protein 25 [Brucella microti]
 gi|163673695|gb|ABY37806.1| 25 kDa outer-membrane immunogenic protein precursor [Brucella suis
           ATCC 23445]
 gi|255999295|gb|ACU47694.1| outer-membrane protein Omp25 [Brucella microti CCM 4915]
 gi|260096993|gb|EEW80868.1| outer-membrane immunogenic protein [Brucella abortus NCTC 8038]
 gi|260668000|gb|EEX54940.1| outer-membrane protein [Brucella abortus bv. 4 str. 292]
 gi|260671941|gb|EEX58762.1| outer-membrane immunogenic protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260674571|gb|EEX61392.1| outer membrane protein [Brucella abortus bv. 6 str. 870]
 gi|260873020|gb|EEX80089.1| outer-membrane immunogenic protein [Brucella abortus bv. 9 str.
           C68]
 gi|260920485|gb|EEX87138.1| outer-membrane immunogenic protein [Brucella ceti B1/94]
 gi|260924020|gb|EEX90588.1| outer membrane protein [Brucella ceti M13/05/1]
 gi|261294260|gb|EEX97756.1| outer membrane protein Omp25 [Brucella ceti M644/93/1]
 gi|261296584|gb|EEY00081.1| outer-membrane immunogenic protein [Brucella pinnipedialis B2/94]
 gi|261303562|gb|EEY07059.1| outer membrane protein [Brucella pinnipedialis M163/99/10]
 gi|261737898|gb|EEY25894.1| outer-membrane immunogenic protein [Brucella sp. F5/99]
 gi|261741781|gb|EEY29707.1| outer-membrane immunogenic protein [Brucella suis bv. 5 str. 513]
 gi|261744439|gb|EEY32365.1| outer-membrane immunogenic protein [Brucella suis bv. 3 str. 686]
 gi|262552333|gb|EEZ08323.1| outer-membrane protein [Brucella ceti M490/95/1]
 gi|264660596|gb|EEZ30857.1| outer-membrane immunogenic protein [Brucella pinnipedialis
           M292/94/1]
          Length = 213

 Score = 63.5 bits (153), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 66/226 (29%), Positives = 105/226 (46%), Gaps = 34/226 (15%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+ L   V VS+  L    +A AAD ++          P +     V  ++ + G Y GL
Sbjct: 1   MRTLKSLVIVSAALLPFSATAFAADAIQEQ--------PPVPAPVEVAPQYSWAGGYTGL 52

Query: 61  SALYNGSFGEEAHHNAGGSI---------FAGYNVEDSCIMYGVEGDVRYTVPVLA-DNI 110
              Y G    +A  +  GSI         FAG+N +   I+YGVEGD  Y+    + D +
Sbjct: 53  ---YLGYGWNKAKTSTVGSIKPDDWKAGAFAGWNFQQDQIVYGVEGDAGYSWAKKSKDGL 109

Query: 111 HSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVG 170
               G  GSLR R GY++ + ++ Y T G   +Q        + +   +G TAG G+E  
Sbjct: 110 EVKQGFEGSLRARVGYDL-NPVMPYLTAGIAGSQIKLNNGLDDESKFRVGWTAGAGLEA- 167

Query: 171 GLSESLVARLEYRASKY---------SKVEGFYNT--ISLGVGMKF 205
            L+++++ R+EYR ++Y         + V    +T  I +G+G KF
Sbjct: 168 KLTDNILGRVEYRYTQYGNKNYDLAGTTVRNKLDTQDIRVGIGYKF 213


>gi|161618670|ref|YP_001592557.1| 25 kDa outer-membrane immunogenic protein precursor [Brucella canis
           ATCC 23365]
 gi|161335481|gb|ABX61786.1| 25 kDa outer-membrane immunogenic protein precursor [Brucella canis
           ATCC 23365]
          Length = 213

 Score = 63.5 bits (153), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 66/226 (29%), Positives = 105/226 (46%), Gaps = 34/226 (15%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+ L   V VS+  L    +A AAD ++          P +     V  ++ + G Y GL
Sbjct: 1   MRTLKSLVIVSAALLPFSATAFAADAIQEQ--------PPVPAPVEVAPQYSWAGGYTGL 52

Query: 61  SALYNGSFGEEAHHNAGGSI---------FAGYNVEDSCIMYGVEGDVRYTVPVLA-DNI 110
              Y G    +A  +  GSI         FAG+N +   I+YGVEGD  Y+    + D +
Sbjct: 53  ---YLGYGWNKAKTSTVGSIKPDDWKAGAFAGWNFQKDQIVYGVEGDAGYSWAKKSKDGL 109

Query: 111 HSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVG 170
               G  GSLR R GY++ + ++ Y T G   +Q        + +   +G TAG G+E  
Sbjct: 110 EVKQGFEGSLRARVGYDL-NPVMPYLTAGIAGSQIKLNNGLDDESKFRVGWTAGAGLEA- 167

Query: 171 GLSESLVARLEYRASKY---------SKVEGFYNT--ISLGVGMKF 205
            L+++++ R+EYR ++Y         + V    +T  I +G+G KF
Sbjct: 168 KLTDNILGRVEYRYTQYGNKNYDLAGTTVRNKLDTQDIRVGIGYKF 213


>gi|254693454|ref|ZP_05155282.1| OmpA-like transmembrane domain protein [Brucella abortus bv. 3 str.
           Tulya]
 gi|261213709|ref|ZP_05927990.1| outer membrane protein [Brucella abortus bv. 3 str. Tulya]
 gi|260915316|gb|EEX82177.1| outer membrane protein [Brucella abortus bv. 3 str. Tulya]
          Length = 213

 Score = 63.2 bits (152), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 66/226 (29%), Positives = 105/226 (46%), Gaps = 34/226 (15%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+ L   V VS+  L    +A AAD ++          P +     V  ++ + G Y GL
Sbjct: 1   MRTLKSLVIVSAALLPFSATAFAADAIQEQ--------PPVPAPVEVAPQYSWAGGYTGL 52

Query: 61  SALYNGSFGEEAHHNAGGSI---------FAGYNVEDSCIMYGVEGDVRYTVPVLA-DNI 110
              Y G    +A  +  GSI         FAG+N +   I+YGVEGD  Y+    + D +
Sbjct: 53  ---YLGYGWNKAKTSTVGSIKPDDWKAGAFAGWNFQQDQIVYGVEGDAGYSWAKKSKDGL 109

Query: 111 HSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVG 170
               G  GSLR R GY++ + ++ Y T G   +Q        + +   +G TAG G+E  
Sbjct: 110 EVKQGFEGSLRARVGYDL-NPVMPYLTAGIAGSQIKLNNGLDDESKFRVGWTAGAGLEA- 167

Query: 171 GLSESLVARLEYRASKY---------SKVEGFYNT--ISLGVGMKF 205
            L+++++ R+EYR ++Y         + V    +T  I +G+G KF
Sbjct: 168 KLTDNILGRVEYRYTQYGNKNYDLAGTTVRTKLDTQDIRVGIGYKF 213


>gi|306842032|ref|ZP_07474705.1| OmpA-like transmembrane domain protein [Brucella sp. BO2]
 gi|306287873|gb|EFM59293.1| OmpA-like transmembrane domain protein [Brucella sp. BO2]
          Length = 213

 Score = 63.2 bits (152), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 66/226 (29%), Positives = 105/226 (46%), Gaps = 34/226 (15%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+ L   V VS+  L    +A AAD ++          P +     V  ++ + G Y GL
Sbjct: 1   MRTLKSLVIVSAALLPFSATAFAADAIQEQ--------PPVPAPVEVAPQYSWAGGYTGL 52

Query: 61  SALYNGSFGEEAHHNAGGSI---------FAGYNVEDSCIMYGVEGDVRYTVPVLA-DNI 110
              Y G    +A  +  GSI         FAG+N +   I+YGVEGD  Y+    + D +
Sbjct: 53  ---YLGYGWNKAKTSTVGSIKPDDWKAGAFAGWNFQQDQIVYGVEGDAGYSWAKKSKDGL 109

Query: 111 HSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVG 170
               G  GSLR R GY++ + ++ Y T G   +Q        + +   +G TAG G+E  
Sbjct: 110 EVKQGFEGSLRARVGYDL-NPVMPYLTAGIAGSQIKLNNGLDDESKFRVGWTAGAGLEA- 167

Query: 171 GLSESLVARLEYRASKY---------SKVEGFYNT--ISLGVGMKF 205
            L+++++ R+EYR ++Y         + V    +T  I +G+G KF
Sbjct: 168 KLTDNILGRVEYRYTQYGNKNYDLAGTTVRNKLDTQDIRVGLGYKF 213


>gi|256060827|ref|ZP_05450987.1| OmpA-like transmembrane domain protein [Brucella neotomae 5K33]
 gi|261324818|ref|ZP_05964015.1| outer-membrane protein Omp25 [Brucella neotomae 5K33]
 gi|3914203|sp|Q45326|OM25_BRUNE RecName: Full=25 kDa outer-membrane immunogenic protein; Flags:
           Precursor
 gi|1457935|gb|AAB36694.1| 25 kDa outer membrane protein [Brucella neotomae]
 gi|261300798|gb|EEY04295.1| outer-membrane protein Omp25 [Brucella neotomae 5K33]
          Length = 213

 Score = 63.2 bits (152), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 66/226 (29%), Positives = 105/226 (46%), Gaps = 34/226 (15%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+ L   V VS+  L    +A AAD ++          P +     V  ++ + G Y GL
Sbjct: 1   MRTLKSLVIVSAALLPFSATAFAADAIQEQ--------PPVPAPVEVAPQYSWAGGYTGL 52

Query: 61  SALYNGSFGEEAHHNAGGSI---------FAGYNVEDSCIMYGVEGDVRYTVPVLA-DNI 110
              Y G    +A  +  GSI         FAG+N +   I+YGVEGD  Y+    + D +
Sbjct: 53  ---YLGYGWNKAKTSTVGSIKPDDWKAGAFAGWNFQQDQIVYGVEGDAGYSWAKKSKDGL 109

Query: 111 HSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVG 170
               G  GSLR R GY++ + ++ Y T G   +Q        + +   +G TAG G+E  
Sbjct: 110 EVKQGFEGSLRARVGYDL-NLVMPYLTAGIAGSQIKLNNGLDDESKFRVGWTAGAGLEA- 167

Query: 171 GLSESLVARLEYRASKY---------SKVEGFYNT--ISLGVGMKF 205
            L+++++ R+EYR ++Y         + V    +T  I +G+G KF
Sbjct: 168 KLTDNILGRVEYRYTQYGNKNYDLAGTTVRNKLDTQDIRVGIGYKF 213


>gi|17987532|ref|NP_540166.1| 25 kDa outer-membrane immunogenic protein precursor [Brucella
           melitensis bv. 1 str. 16M]
 gi|225852222|ref|YP_002732455.1| OmpA-like transmembrane domain-containing protein [Brucella
           melitensis ATCC 23457]
 gi|256044394|ref|ZP_05447298.1| OmpA-like transmembrane domain protein [Brucella melitensis bv. 1
           str. Rev.1]
 gi|256264270|ref|ZP_05466802.1| outer-membrane protein Omp25 [Brucella melitensis bv. 2 str. 63/9]
 gi|260563745|ref|ZP_05834231.1| outer-membrane immunogenic protein [Brucella melitensis bv. 1 str.
           16M]
 gi|265990813|ref|ZP_06103370.1| outer-membrane immunogenic protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|3914202|sp|Q45321|OM25_BRUME RecName: Full=25 kDa outer-membrane immunogenic protein; Flags:
           Precursor
 gi|1457927|gb|AAB06701.1| 25 kDa outer membrane protein [Brucella melitensis]
 gi|17983234|gb|AAL52430.1| 25 kDa outer-membrane immunogenic protein precursor [Brucella
           melitensis bv. 1 str. 16M]
 gi|225640587|gb|ACO00501.1| OmpA-like transmembrane domain protein [Brucella melitensis ATCC
           23457]
 gi|260153761|gb|EEW88853.1| outer-membrane immunogenic protein [Brucella melitensis bv. 1 str.
           16M]
 gi|263001597|gb|EEZ14172.1| outer-membrane immunogenic protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|263094531|gb|EEZ18340.1| outer-membrane protein Omp25 [Brucella melitensis bv. 2 str. 63/9]
 gi|326408721|gb|ADZ65786.1| OmpA-like transmembrane domain protein [Brucella melitensis M28]
 gi|326538444|gb|ADZ86659.1| OmpA-like transmembrane domain protein [Brucella melitensis M5-90]
          Length = 213

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 59/197 (29%), Positives = 94/197 (47%), Gaps = 23/197 (11%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+ L   V VS+  L    +A AAD ++          P +     V  ++ + G Y GL
Sbjct: 1   MRTLKSLVIVSAALLPFSATAFAADAIQEQ--------PPVPAPVEVAPQYSWAGGYTGL 52

Query: 61  SALYNGSFGEEAHHNAGGSI---------FAGYNVEDSCIMYGVEGDVRYTVPVLA-DNI 110
              Y G    +A  +  GSI         FAG+N +   I+YGVEGD  Y+    + D +
Sbjct: 53  ---YLGYGWNKAKTSTVGSIKPDDWKAGAFAGWNFQQDQIVYGVEGDAGYSWAKKSKDGL 109

Query: 111 HSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVG 170
               G  GSLR R GY++ + ++ Y T G   +Q        + +   +G TAG G+E  
Sbjct: 110 EVKQGFEGSLRARVGYDL-NPVMPYLTAGIAGSQIKLNNGLDDESKFRVGWTAGAGLEA- 167

Query: 171 GLSESLVARLEYRASKY 187
            L+++++ R+EYR ++Y
Sbjct: 168 KLTDNILGRVEYRYTQY 184


>gi|189023912|ref|YP_001934680.1| OmpA-like transmembrane domain protein [Brucella abortus S19]
 gi|225627199|ref|ZP_03785237.1| Porin subfamily protein [Brucella ceti str. Cudo]
 gi|237815152|ref|ZP_04594150.1| Porin subfamily protein [Brucella abortus str. 2308 A]
 gi|260566721|ref|ZP_05837191.1| outer membrane protein [Brucella suis bv. 4 str. 40]
 gi|189019484|gb|ACD72206.1| OmpA-like transmembrane domain protein [Brucella abortus S19]
 gi|225618034|gb|EEH15078.1| Porin subfamily protein [Brucella ceti str. Cudo]
 gi|237789989|gb|EEP64199.1| Porin subfamily protein [Brucella abortus str. 2308 A]
 gi|260156239|gb|EEW91319.1| outer membrane protein [Brucella suis bv. 4 str. 40]
          Length = 305

 Score = 62.8 bits (151), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 66/226 (29%), Positives = 105/226 (46%), Gaps = 34/226 (15%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+ L   V VS+  L    +A AAD ++          P +     V  ++ + G Y GL
Sbjct: 93  MRTLKSLVIVSAALLPFSATAFAADAIQEQ--------PPVPAPVEVAPQYSWAGGYTGL 144

Query: 61  SALYNGSFGEEAHHNAGGSI---------FAGYNVEDSCIMYGVEGDVRYTVPVLA-DNI 110
              Y G    +A  +  GSI         FAG+N +   I+YGVEGD  Y+    + D +
Sbjct: 145 ---YLGYGWNKAKTSTVGSIKPDDWKAGAFAGWNFQQDQIVYGVEGDAGYSWAKKSKDGL 201

Query: 111 HSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVG 170
               G  GSLR R GY++ + ++ Y T G   +Q        + +   +G TAG G+E  
Sbjct: 202 EVKQGFEGSLRARVGYDL-NPVMPYLTAGIAGSQIKLNNGLDDESKFRVGWTAGAGLE-A 259

Query: 171 GLSESLVARLEYRASKY---------SKVEGFYNT--ISLGVGMKF 205
            L+++++ R+EYR ++Y         + V    +T  I +G+G KF
Sbjct: 260 KLTDNILGRVEYRYTQYGNKNYDLAGTTVRNKLDTQDIRVGIGYKF 305


>gi|297248070|ref|ZP_06931788.1| 25 kDa outer-membrane immunogenic protein [Brucella abortus bv. 5
           str. B3196]
 gi|297175239|gb|EFH34586.1| 25 kDa outer-membrane immunogenic protein [Brucella abortus bv. 5
           str. B3196]
          Length = 305

 Score = 62.8 bits (151), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 66/226 (29%), Positives = 105/226 (46%), Gaps = 34/226 (15%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+ L   V VS+  L    +A AAD ++          P +     V  ++ + G Y GL
Sbjct: 93  MRTLKSLVIVSAALLPFSATAFAADAIQEQ--------PPVPAPVEVAPQYSWAGGYTGL 144

Query: 61  SALYNGSFGEEAHHNAGGSI---------FAGYNVEDSCIMYGVEGDVRYTVPVLA-DNI 110
              Y G    +A  +  GSI         FAG+N +   I+YGVEGD  Y+    + D +
Sbjct: 145 ---YLGYGWNKAKTSTVGSIKPDDWKAGAFAGWNFQQDQIVYGVEGDAGYSWAKKSKDGL 201

Query: 111 HSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVG 170
               G  GSLR R GY++ + ++ Y T G   +Q        + +   +G TAG G+E  
Sbjct: 202 EVKQGFEGSLRARVGYDL-NPVMPYLTAGIAGSQIKLNNGLDDESKFRVGWTAGAGLE-A 259

Query: 171 GLSESLVARLEYRASKY---------SKVEGFYNT--ISLGVGMKF 205
            L+++++ R+EYR ++Y         + V    +T  I +G+G KF
Sbjct: 260 KLTDNILGRVEYRYTQYGNKNYDLAGTTVRNKLDTQDIRVGIGYKF 305


>gi|294852064|ref|ZP_06792737.1| outer-membrane immunogenic protein [Brucella sp. NVSL 07-0026]
 gi|294820653|gb|EFG37652.1| outer-membrane immunogenic protein [Brucella sp. NVSL 07-0026]
          Length = 305

 Score = 62.8 bits (151), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 66/226 (29%), Positives = 105/226 (46%), Gaps = 34/226 (15%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+ L   V VS+  L    +A AAD ++          P +     V  ++ + G Y GL
Sbjct: 93  MRTLKSLVIVSAALLPFSATAFAADAIQEQ--------PPVPAPVEVAPQYSWAGGYTGL 144

Query: 61  SALYNGSFGEEAHHNAGGSI---------FAGYNVEDSCIMYGVEGDVRYTVPVLA-DNI 110
              Y G    +A  +  GSI         FAG+N +   I+YGVEGD  Y+    + D +
Sbjct: 145 ---YLGYGWNKAKTSTVGSIKPDDWKAGAFAGWNFQQDQIVYGVEGDAGYSWAKKSKDGL 201

Query: 111 HSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVG 170
               G  GSLR R GY++ + ++ Y T G   +Q        + +   +G TAG G+E  
Sbjct: 202 EVKQGFEGSLRARVGYDL-NPVMPYLTAGIAGSQIKLNNGLDDESKFRVGWTAGAGLE-A 259

Query: 171 GLSESLVARLEYRASKY---------SKVEGFYNT--ISLGVGMKF 205
            L+++++ R+EYR ++Y         + V    +T  I +G+G KF
Sbjct: 260 KLTDNILGRVEYRYTQYGNKNYDLAGTTVRNKLDTQDIRVGIGYKF 305


>gi|163759157|ref|ZP_02166243.1| outer membrane protein [Hoeflea phototrophica DFL-43]
 gi|162283561|gb|EDQ33846.1| outer membrane protein [Hoeflea phototrophica DFL-43]
          Length = 212

 Score = 62.8 bits (151), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 48/133 (36%), Positives = 67/133 (50%), Gaps = 14/133 (10%)

Query: 85  NVEDSCIMYGVEGDVRYT-VPVLADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVA 143
           N +   I+YGVEGD+ Y+        +    G  GSLR R GY++ +  LLYAT G    
Sbjct: 82  NWQSDNIVYGVEGDLGYSGADASLGGVTGEQGFNGSLRARLGYDI-NPFLLYATGGLAAT 140

Query: 144 QKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSK----------VEGF 193
           +   T  AG  T   +G TAG G E   ++E++  RLEYR + Y              GF
Sbjct: 141 RAEVTSAAGSDTNTHLGWTAGAGAEA-FVTENITTRLEYRYTDYGSETYNLGGTNVSSGF 199

Query: 194 YN-TISLGVGMKF 205
            + ++ LG+GMKF
Sbjct: 200 DDHSVRLGIGMKF 212


>gi|227821495|ref|YP_002825465.1| putative outer membrane protein [Sinorhizobium fredii NGR234]
 gi|227340494|gb|ACP24712.1| putative outer membrane protein [Sinorhizobium fredii NGR234]
          Length = 212

 Score = 62.8 bits (151), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 58/187 (31%), Positives = 92/187 (49%), Gaps = 23/187 (12%)

Query: 38  VPTIATNRYV-PIRHDFNGPYAGLSALYNGSFGE-EAHHNA-----GGSIFAGYNVEDSC 90
           +P      Y  P   +++G Y G +A  N  +GE +A  N      GG ++ GYNV+D  
Sbjct: 30  IPAAPAAEYTEPAVKNWSGAYVGGTA--NWHYGEADATGNNKSVAFGGGLYGGYNVQDGQ 87

Query: 91  IMYGVEGDVRYT-VPVLADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETG 149
           ++YG E DV Y      +       G+ GSLR R G ++ + +L+Y T G  +     + 
Sbjct: 88  MVYGGEADVNYAGNDSTSSGRKVKQGVNGSLRGRVGVDM-NPVLVYGTAGLALGNAKLST 146

Query: 150 KAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKY---------SKVEGFYN--TIS 198
            AG      +G TAG G E   +++++ AR+EYR + Y         S V   Y+  ++ 
Sbjct: 147 PAGSDDKTLVGWTAGAGAET-FVTDNVTARVEYRYTDYASKDFRAGGSTVSSGYDEHSVR 205

Query: 199 LGVGMKF 205
           LG+G+KF
Sbjct: 206 LGMGVKF 212


>gi|256113236|ref|ZP_05454104.1| OmpA-like transmembrane domain protein [Brucella melitensis bv. 3
           str. Ether]
 gi|265994648|ref|ZP_06107205.1| outer-membrane immunogenic protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|262765761|gb|EEZ11550.1| outer-membrane immunogenic protein [Brucella melitensis bv. 3 str.
           Ether]
          Length = 213

 Score = 62.4 bits (150), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 59/197 (29%), Positives = 94/197 (47%), Gaps = 23/197 (11%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+ L   V VS+  L    +A AAD ++          P +     V  ++ + G Y GL
Sbjct: 1   MRTLKSLVIVSAALLPFSATAFAADAIQEQ--------PPVPAPVEVAPQYSWAGGYTGL 52

Query: 61  SALYNGSFGEEAHHNAGGSI---------FAGYNVEDSCIMYGVEGDVRYTVPVLA-DNI 110
              Y G    +A  +  GSI         FAG+N +   I+YGVEGD  Y+    + D +
Sbjct: 53  ---YLGYGWNKAKTSTVGSIKPDDWKAGAFAGWNFQQDQIVYGVEGDAGYSWAKKSKDGL 109

Query: 111 HSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVG 170
               G  GSLR R GY++ + ++ Y T G   +Q        + +   +G TAG G+E  
Sbjct: 110 EVKQGFEGSLRARVGYDL-NPVMPYLTAGIVGSQIKLNNGLDDESKFRVGWTAGAGLEA- 167

Query: 171 GLSESLVARLEYRASKY 187
            L+++++ R+EYR ++Y
Sbjct: 168 KLTDNILGRVEYRYTQY 184


>gi|159185080|ref|NP_355120.2| outer membrane protein [Agrobacterium tumefaciens str. C58]
 gi|159140353|gb|AAK87905.2| outer membrane protein [Agrobacterium tumefaciens str. C58]
          Length = 209

 Score = 62.4 bits (150), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 68/217 (31%), Positives = 102/217 (47%), Gaps = 34/217 (15%)

Query: 10  VSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL---SALYNG 66
           V+SL   S  +A AAD V           P +A    +P+   ++GPY G+   +   NG
Sbjct: 6   VTSLLALSASTAMAADAVYETP------APPVAQET-LPV-FTWSGPYLGIQGGAGWANG 57

Query: 67  SF---GEEAHHNAGGSI---FAGYNVE-DSCIMYGVEGDVRYTVPVLADNIHSLHGIG-- 117
            F   G     +  G I   FAGYN + D+ ++ G+EGDV Y      DN +S   +G  
Sbjct: 58  DFSAGGPVVSDDFNGGILGAFAGYNYQFDNNMVLGIEGDVDYN---WNDNDYSGIKVGTD 114

Query: 118 --GSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSES 175
             GS+R R GY   D  L+YAT G    + +     G+      G T G GV+    +++
Sbjct: 115 WQGSVRGRVGYAF-DHALIYATAGWTATRGFIETPVGDDKATFNGYTVGAGVDY-AFTDN 172

Query: 176 LVARLEYRASKYSKVEGF-------YNTISLGVGMKF 205
           +  RLEYR + Y   + F        +T+ +G+G+KF
Sbjct: 173 VFGRLEYRYNDYGDKDIFGINTDFDQHTVKVGLGVKF 209


>gi|150396648|ref|YP_001327115.1| porin [Sinorhizobium medicae WSM419]
 gi|150028163|gb|ABR60280.1| porin [Sinorhizobium medicae WSM419]
          Length = 215

 Score = 62.4 bits (150), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 50/138 (36%), Positives = 70/138 (50%), Gaps = 14/138 (10%)

Query: 81  FAGYNVEDSCIMYGVEGDVRY-----TVPVLADNIHSLHGIGGSLRIRGGYEVSDSLLLY 135
           FAGYN +    + GVEGDV Y     TV V   N      + GS+R R GY V+D  LLY
Sbjct: 79  FAGYNYQHGDWVVGVEGDVSYNWNDETVTVFGTNTDVGTDVSGSVRARLGYTVNDRTLLY 138

Query: 136 ATVGPDVAQKY-ETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYS------ 188
           AT G  V + + +   A +      G T G GV+  G ++S+  R EYR + +S      
Sbjct: 139 ATGGWAVTRGFVDVAGAPKEKETFNGWTIGGGVDY-GFTDSVFGRAEYRYNDFSDKDVGG 197

Query: 189 -KVEGFYNTISLGVGMKF 205
             V+   +  ++GVG+KF
Sbjct: 198 VDVDLDQHQFTIGVGVKF 215


>gi|150396008|ref|YP_001326475.1| porin [Sinorhizobium medicae WSM419]
 gi|150027523|gb|ABR59640.1| porin [Sinorhizobium medicae WSM419]
          Length = 212

 Score = 62.0 bits (149), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 64/226 (28%), Positives = 107/226 (47%), Gaps = 35/226 (15%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYV-PIRHDFNGPYAG 59
           M+ L   +  S++AL +F +A AAD V          +P      Y  P   +++G Y G
Sbjct: 1   MRMLTTTLMASAMALVAFQAAHAADVVDE--------IPAAPAAEYTEPAVRNWSGAYVG 52

Query: 60  LSALYNGSFGEEAHHNAG----GSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHS--- 112
            +  ++    +   +N      G ++ GYNV+D  ++YG E D+ YT     ++ HS   
Sbjct: 53  GTIDWHHGEADATGNNKSVGTGGGLYGGYNVQDGQMVYGGEADINYT----GNDSHSSGR 108

Query: 113 --LHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVG 170
               G+ GS+R R G +V + +L+Y T G  +        AG      +G TAGVG E  
Sbjct: 109 RVQQGLNGSVRARVGVDV-NPVLVYGTAGVALGNAELKTPAGSDDKTLVGWTAGVGAET- 166

Query: 171 GLSESLVARLEYRASKY---------SKVEGFYN--TISLGVGMKF 205
            +++++ AR EYR + Y         + +   Y+   + LG+G+KF
Sbjct: 167 FVTDNITARAEYRYTDYGSKDFRTGGTTISSGYDEHAVKLGMGVKF 212


>gi|15964926|ref|NP_385279.1| outer membrane protein [Sinorhizobium meliloti 1021]
 gi|307300997|ref|ZP_07580766.1| porin [Sinorhizobium meliloti BL225C]
 gi|15074105|emb|CAC45752.1| Probable outer membrane protein [Sinorhizobium meliloti 1021]
 gi|306903952|gb|EFN34538.1| porin [Sinorhizobium meliloti BL225C]
          Length = 212

 Score = 61.2 bits (147), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 64/222 (28%), Positives = 106/222 (47%), Gaps = 27/222 (12%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYV-PIRHDFNGPYAG 59
           M+ L   +  S++AL +F +A AAD V          VP      Y  P   +++G Y G
Sbjct: 1   MRTLTTTLMASAMALVAFQAAHAADVVDE--------VPAAPAAEYTEPAVRNWSGAYVG 52

Query: 60  LSALYNGSFGEEAHHNAG----GSIFAGYNVEDSCIMYGVEGDVRYT-VPVLADNIHSLH 114
            +  ++    +   +N      G ++ GYNV+D  ++YG E DV YT     +       
Sbjct: 53  GTIDWHHGEADATGNNKSVGFGGGLYGGYNVQDGQMVYGGEADVNYTGNDSRSSGRRVKQ 112

Query: 115 GIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSE 174
           G+ GS+R R G ++ + +L+Y T G  +     +  AG      +G TAGVG E   +++
Sbjct: 113 GVNGSVRGRVGVDL-NPVLVYGTAGVALGNAKLSTPAGSDDKTLVGWTAGVGAET-FVTD 170

Query: 175 SLVARLEYRASKY---------SKVEGFYN--TISLGVGMKF 205
           ++ AR EYR + Y         S +   Y+  ++ LG+G+KF
Sbjct: 171 NITARAEYRYTDYGSKDFRAGGSTISSGYDEHSVKLGMGVKF 212


>gi|769745|emb|CAA55872.1| immunogenic protein [Brucella abortus]
 gi|89741444|gb|ABD77595.1| 25 kDa outer membrane protein [Brucella abortus]
          Length = 213

 Score = 60.1 bits (144), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 65/226 (28%), Positives = 104/226 (46%), Gaps = 34/226 (15%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+ L   V VS+  L    +A AAD ++          P +     V  ++ + G Y GL
Sbjct: 1   MRTLKSLVIVSAALLPFSATAFAADAIQEQ--------PPVPAPVEVAPQYSWAGGYTGL 52

Query: 61  SALYNGSFGEEAHHNAGGSI---------FAGYNVEDSCIMYGVEGDVRYTVPVLA-DNI 110
              Y G    +A  +  GSI         FAG+N +   I+YGVEGD  Y+    + D +
Sbjct: 53  ---YLGYGWNKAKTSTVGSIKPDDWKAGAFAGWNFQQDQIVYGVEGDAGYSWAKKSKDGL 109

Query: 111 HSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVG 170
               G  GSL  R GY++ + ++ Y T G   +Q        + +   +G TAG G+E  
Sbjct: 110 EVKQGFEGSLGARVGYDL-NPVMPYLTAGIAGSQIKLNNGLDDESKFRVGWTAGAGLEA- 167

Query: 171 GLSESLVARLEYRASKY---------SKVEGFYNT--ISLGVGMKF 205
            L+++++ R+EYR ++Y         + V    +T  I +G+G KF
Sbjct: 168 KLTDNILGRVEYRYTQYGNKNYDLAGTTVRNKLDTQDIRVGIGYKF 213


>gi|307317731|ref|ZP_07597169.1| porin [Sinorhizobium meliloti AK83]
 gi|306896493|gb|EFN27241.1| porin [Sinorhizobium meliloti AK83]
          Length = 212

 Score = 59.3 bits (142), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 63/222 (28%), Positives = 106/222 (47%), Gaps = 27/222 (12%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYV-PIRHDFNGPYAG 59
           M+ L   +  S++AL +F +A AAD V          VP      Y  P   +++G Y G
Sbjct: 1   MRTLTTTLMASAMALVAFQAAHAADVVDE--------VPAAPAAEYTEPAVRNWSGAYVG 52

Query: 60  LSALYNGSFGEEAHHNAG----GSIFAGYNVEDSCIMYGVEGDVRYT-VPVLADNIHSLH 114
            +  ++    +   +N      G ++ GY+V+D  ++YG E DV YT     +       
Sbjct: 53  GTIDWHHGEADATGNNKSVGFGGGLYGGYDVQDGQMVYGGEADVNYTGNDSRSSGRRVKQ 112

Query: 115 GIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSE 174
           G+ GS+R R G ++ + +L+Y T G  +     +  AG      +G TAGVG E   +++
Sbjct: 113 GVNGSVRGRVGVDL-NPVLVYGTAGVALGNAKLSTPAGSDDKTLVGWTAGVGAET-FVTD 170

Query: 175 SLVARLEYRASKY---------SKVEGFYN--TISLGVGMKF 205
           ++ AR EYR + Y         S +   Y+  ++ LG+G+KF
Sbjct: 171 NITARAEYRYTDYGSKDFRAGGSTISSGYDEHSVKLGMGVKF 212


>gi|15965438|ref|NP_385791.1| outer-membrane protein [Sinorhizobium meliloti 1021]
 gi|307310613|ref|ZP_07590260.1| porin [Sinorhizobium meliloti BL225C]
 gi|15074619|emb|CAC46264.1| Probable outer-membrane protein [Sinorhizobium meliloti 1021]
 gi|306899723|gb|EFN30349.1| porin [Sinorhizobium meliloti BL225C]
          Length = 215

 Score = 58.5 bits (140), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 47/138 (34%), Positives = 70/138 (50%), Gaps = 14/138 (10%)

Query: 81  FAGYNVEDSCIMYGVEGDVRY-----TVPVLADNIHSLHGIGGSLRIRGGYEVSDSLLLY 135
           FAGYN +    + GVEGDV Y     TV V   +  +   + GS+R R GY V+D  L+Y
Sbjct: 79  FAGYNYQHGDWVVGVEGDVSYNWNDETVTVFGSDTEAGTDVSGSVRARLGYTVNDRTLIY 138

Query: 136 ATVGPDVAQKY-ETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYS------ 188
           AT G  V + + +   A +      G T G GV+  G ++S+  R EYR + +       
Sbjct: 139 ATGGWAVTRGFVDVAGAPKEKETFNGWTIGGGVDY-GFTDSVFGRAEYRYNDFGDKDVGG 197

Query: 189 -KVEGFYNTISLGVGMKF 205
             V+   +  ++GVG+KF
Sbjct: 198 VNVDLDQHQFTVGVGVKF 215


>gi|239831535|ref|ZP_04679864.1| Porin subfamily protein [Ochrobactrum intermedium LMG 3301]
 gi|239823802|gb|EEQ95370.1| Porin subfamily protein [Ochrobactrum intermedium LMG 3301]
          Length = 266

 Score = 57.4 bits (137), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 64/219 (29%), Positives = 101/219 (46%), Gaps = 37/219 (16%)

Query: 10  VSSLALASF-CSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSF 68
           ++S AL  F  +A AAD ++          P +     +  ++ + G Y GL   Y G  
Sbjct: 62  IASAALLPFSATAFAADAIQEQ--------PPVPAPVEMAPQYSWAGGYTGL---YLGYG 110

Query: 69  GEEAHHNAGGSI---------FAGYNVEDSCIMYGVEGDVRYTVPVLADN-IHSLHGIGG 118
             +   N  GSI         +AG+N +    +YGVEGD  Y+    + N +    G  G
Sbjct: 111 WNKVKTNTDGSIKPDDMKAGAYAGWNFQQDQFVYGVEGDAGYSWAKKSKNGLEVKEGFEG 170

Query: 119 SLRIRGGYEVSDSLLLYATVGPDVAQ-KYETGKAGEITPIAIGGTAGVGVEVGGLSESLV 177
           SLR R GY++ + ++ Y T G    Q K + G   E +   +G TAG G+E   L+++++
Sbjct: 171 SLRGRLGYDL-NPVMPYITAGVAGKQVKLDNGFDDE-SKFRVGWTAGAGLEA-KLTDNIL 227

Query: 178 ARLEYRASKYSK------VEGFYNT-----ISLGVGMKF 205
            R+EYR +++         E   N      I +GVG KF
Sbjct: 228 GRVEYRYTQFGNKTYDLGTESVRNKLDTHDIRVGVGYKF 266


>gi|153009914|ref|YP_001371129.1| porin [Ochrobactrum anthropi ATCC 49188]
 gi|151561802|gb|ABS15300.1| porin [Ochrobactrum anthropi ATCC 49188]
          Length = 213

 Score = 57.4 bits (137), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 62/219 (28%), Positives = 103/219 (47%), Gaps = 37/219 (16%)

Query: 10  VSSLALASF-CSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSF 68
           ++S AL  F  +A AAD ++          P +     +  ++ + G Y GL   Y G  
Sbjct: 9   IASAALLPFSATAFAADAIQEQ--------PPVPAPVEMAPQYSWAGGYTGL---YLGYG 57

Query: 69  GEEAHHNAGGSI---------FAGYNVEDSCIMYGVEGDVRYT-VPVLADNIHSLHGIGG 118
             +A  +  G++         +AG+N +    +YGVEGD  Y+      D +    G  G
Sbjct: 58  WNKAKTDTVGTVKPDDMKAGAYAGWNFQQDQFVYGVEGDAGYSWAKKTKDGLEVKQGFEG 117

Query: 119 SLRIRGGYEVSDSLLLYATVGPDVAQ-KYETGKAGEITPIAIGGTAGVGVEVGGLSESLV 177
           SLR R GY++ + ++ Y T G   +Q K + G   E +   +G TAG G+E   L+++++
Sbjct: 118 SLRARLGYDL-NPVMPYITAGVAGSQVKLDNGFDDE-SKFRVGWTAGAGLEA-KLTDNIL 174

Query: 178 ARLEYRASKY---------SKVEGFYNT--ISLGVGMKF 205
            R+EYR +++           V    +T  I +GVG KF
Sbjct: 175 GRVEYRYTQFGNKTYDLGNESVRNKLDTHDIRVGVGYKF 213


>gi|307320995|ref|ZP_07600402.1| porin [Sinorhizobium meliloti AK83]
 gi|306893369|gb|EFN24148.1| porin [Sinorhizobium meliloti AK83]
          Length = 213

 Score = 55.5 bits (132), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 45/136 (33%), Positives = 68/136 (50%), Gaps = 12/136 (8%)

Query: 81  FAGYNVEDSCIMYGVEGDVRYTV---PVLADNIHSLHGIGGSLRIRGGYEVSDSLLLYAT 137
           FAGYN +    + GVEGDV Y      V   +  +   + GS+R R GY V+D  L+YAT
Sbjct: 79  FAGYNYQHGDWVVGVEGDVSYNWNDETVFGSDTEAGTDVSGSVRARLGYTVNDRTLIYAT 138

Query: 138 VGPDVAQKY-ETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYS-------K 189
            G  V + + +   A +      G T G GV+  G ++S+  R EYR + +         
Sbjct: 139 GGWAVTRGFVDVAGAPKEKETFNGWTIGGGVDY-GFTDSVFGRAEYRYNDFGDKDVGGVN 197

Query: 190 VEGFYNTISLGVGMKF 205
           V+   +  ++GVG+KF
Sbjct: 198 VDLDQHQFTVGVGVKF 213


>gi|218513075|ref|ZP_03509915.1| outer membrane protein [Rhizobium etli 8C-3]
          Length = 134

 Score = 55.1 bits (131), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 43/136 (31%), Positives = 70/136 (51%), Gaps = 14/136 (10%)

Query: 82  AGYNVEDSCIMYGVEGDVRYT-VPVLADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGP 140
            GYN +   I+YGVE D+ Y+   V +  + + +G  GS+R R GY++ +  LLY T G 
Sbjct: 1   TGYNWQQGQIVYGVESDLGYSGDDVSSGGVKNKYGWNGSVRGRVGYDM-NPFLLYGTAGL 59

Query: 141 DVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVE--------- 191
            +     +    + +  A G T G GVE   ++ ++  RLEYR + Y   +         
Sbjct: 60  ALGNIKVSDGTSDESKTAYGYTVGAGVEA-FVTNNITTRLEYRYTDYQSKDYDLDSGSFS 118

Query: 192 -GF-YNTISLGVGMKF 205
            G+  N++ LG+G+KF
Sbjct: 119 RGYDENSVKLGIGVKF 134


>gi|332717162|ref|YP_004444628.1| 25 kDa outer-membrane immunogenic protein [Agrobacterium sp. H13-3]
 gi|325063847|gb|ADY67537.1| 25 kDa outer-membrane immunogenic protein [Agrobacterium sp. H13-3]
          Length = 223

 Score = 54.3 bits (129), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 57/196 (29%), Positives = 86/196 (43%), Gaps = 32/196 (16%)

Query: 36  GVVPTIATNRYVPIRHDFNGPYAGLSALY------NGSFGEEAHHNAGG---SIFAGYNV 86
           G +P       V     ++G Y G SA Y      + +FG    H   G   S FAGYN 
Sbjct: 34  GDIPAAPVVNDVAPAFSWDGVYVGASAGYGWNRVKSTTFGVTTKHEFDGGRFSGFAGYNA 93

Query: 87  EDS-CIMYGVEGDVRYTV---PVLADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDV 142
           E +  I+ GVEGD+ Y      ++   + +  G+ GS R+R GY + D  L+Y   G   
Sbjct: 94  EVAPSIILGVEGDLGYAWGDKTIVTSEVSA--GLNGSARLRAGYAI-DRALIYTAAGYTA 150

Query: 143 AQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFYNT------ 196
                    GE + +  G T G GV+    + +L  R+EYR + + K    Y+T      
Sbjct: 151 TDSEVKAPFGEDSKVLHGWTVGAGVDY-AFTNNLFGRVEYRYNDFGKAT--YHTGPITST 207

Query: 197 -------ISLGVGMKF 205
                  + +G+G+KF
Sbjct: 208 GDVSEHVVKVGLGVKF 223


>gi|325292505|ref|YP_004278369.1| outer membrane protein [Agrobacterium sp. H13-3]
 gi|325060358|gb|ADY64049.1| outer membrane protein [Agrobacterium sp. H13-3]
          Length = 218

 Score = 53.9 bits (128), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 71/230 (30%), Positives = 115/230 (50%), Gaps = 40/230 (17%)

Query: 3   KLFLAV-GVSSLALASFCSAQAADPVRRAHHGGRGVVPT--IATNRYVPIRHDFNGPYAG 59
           ++F+A    S++A A F +A AAD V          VP   +A ++  P+++ + G Y G
Sbjct: 2   RIFVATIMASTIAAAGFSAAHAADAVND--------VPQAPVAYDQPAPVKN-WTGAYLG 52

Query: 60  LSALYNGSFGEEAHHNAG-------GSIFAGYNVEDSCIMYGVEGDV-----RYTVPVLA 107
            +A Y+  +G  +  N G       G I+ GYN+++  I+YG E DV     R +   + 
Sbjct: 53  GTANYD--WGRFSSSNDGRDAKGAGGGIYGGYNMQNGQIVYGAEADVNLGRERGSAGTVG 110

Query: 108 DN-IHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVG 166
            N +    G+ GSLR R GY++ +  LLY T G   +         + +  A+G T G G
Sbjct: 111 GNAVEGKQGVNGSLRARVGYDM-NPFLLYGTAGLAASDNKVRDATSKDSATALGYTVGAG 169

Query: 167 VEVGGLSESLVARLEYRASKYSKVE----------GFYN-TISLGVGMKF 205
           VE   +++++ ARLEYR S Y K +          GF + ++  G+G+KF
Sbjct: 170 VEA-MVTDNITARLEYRYSDYQKKDYSLDSGAFSRGFDDHSVKAGIGVKF 218


>gi|114705635|ref|ZP_01438538.1| outer membrane protein [Fulvimarina pelagi HTCC2506]
 gi|114538481|gb|EAU41602.1| outer membrane protein [Fulvimarina pelagi HTCC2506]
          Length = 228

 Score = 53.9 bits (128), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 55/190 (28%), Positives = 83/190 (43%), Gaps = 19/190 (10%)

Query: 13  LALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSFGEEA 72
           LA  +     AA P     +      P        P    ++GPYAG    YN S  +  
Sbjct: 14  LATIALALPLAAMPAHAQDNASETAFPDSRIPESAPPVAIWSGPYAGTFVGYNVSRFDNL 73

Query: 73  H------HNAGGSIFAGYNVEDSCIMYGVEGDV---------RYTVPVLADNIHSLHGIG 117
                      G  +AG+N++D  ++YGVEGDV         R  +  L  ++     + 
Sbjct: 74  RGASISGDGVAGGAYAGFNLQDGSLVYGVEGDVGGAGFDATRRNALGNL--DLSGESNVF 131

Query: 118 GSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLV 177
           GSLR R G +V D  L+Y T G  +A+   +      +  ++G T G GVE   +++S+ 
Sbjct: 132 GSLRGRVGVDV-DPFLVYGTGGLAIAETELSLGGVSDSEASVGYTIGAGVEA-QVTDSIR 189

Query: 178 ARLEYRASKY 187
            RLEYR S +
Sbjct: 190 TRLEYRYSDF 199


>gi|222087507|ref|YP_002546044.1| outer membrane protein [Agrobacterium radiobacter K84]
 gi|221724955|gb|ACM28111.1| outer membrane protein [Agrobacterium radiobacter K84]
          Length = 204

 Score = 53.9 bits (128), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 52/174 (29%), Positives = 89/174 (51%), Gaps = 25/174 (14%)

Query: 53  FNGPYAGL---SALYNGSF----GEEAHHNAGGSI--FAGYNVEDSCIMYGVEGDVRYTV 103
           ++GPY G+    A+  G+F    G+++    GG +  F GYN +   ++ GV+G++ Y  
Sbjct: 35  WSGPYLGVHGGGAITKGNFKFGSGDQSEDFKGGFLGNFFGYNYQFDKVVVGVDGNIDYNW 94

Query: 104 PVLADNIHSLHGIG----GSLRIRGGYEVSDSLLLYATVGPDVAQKY-ETGKAGEITPIA 158
              A  + +   +G    G++R R GY   D+LL+Y   G   A+ + +   +G+   + 
Sbjct: 95  NNKA--VANASSVGTDWSGAVRGRVGYAF-DNLLIYGAAGWTAARGFADVSGSGDGKVVF 151

Query: 159 IGGTAGVGVEVGGLSESLVARLEYRASKYS-------KVEGFYNTISLGVGMKF 205
            G TAG GV+    + ++ AR EYR S +        K +    +I+LGVG+KF
Sbjct: 152 SGWTAGTGVDY-AFTNNIFARAEYRYSDFGSKELQGVKSDLTEQSINLGVGLKF 204


>gi|218461155|ref|ZP_03501246.1| outer membrane protein [Rhizobium etli Kim 5]
          Length = 168

 Score = 52.8 bits (125), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 37/102 (36%), Positives = 57/102 (55%), Gaps = 4/102 (3%)

Query: 41  IATNRYVPIRHDFNGPYAGLSALYN-GSFGEEAH-HNAGGSIFAGYNVEDSCIMYGVEGD 98
           +A +  V    ++ G Y G +  YN G FG + H +  GG +F GYN +   I+YGVE D
Sbjct: 35  VAQDAPVKPAGNWEGFYLGGAGTYNMGDFGSDRHTYGFGGQVFTGYNWQAGQIVYGVESD 94

Query: 99  VRYT-VPVLADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVG 139
           + Y+   V +  + + +G  GS+R R GY++ +  LLY T G
Sbjct: 95  LGYSGDDVSSGGVENKYGWNGSVRGRVGYDM-NPFLLYGTAG 135


>gi|31322670|gb|AAP22071.1| outer membrane protein [Sinorhizobium fredii]
          Length = 212

 Score = 50.8 bits (120), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 58/197 (29%), Positives = 91/197 (46%), Gaps = 43/197 (21%)

Query: 38  VPTIATNRYV-PIRHDFNGPYAGLSALYNGSFGEEAHHN----AGGSIFA--------GY 84
           VP      Y  P   +++G Y G +A +        HH      GG+  A        GY
Sbjct: 30  VPAAPAAEYTDPAVKNWSGAYVGGTANW--------HHGEADATGGNTSAGFGGGLYGGY 81

Query: 85  NVEDSCIMYGVEGDVRYTVPVLADNIHS-----LHGIGGSLRIRGGYEVSDSLLLYATVG 139
           NV+D  ++YG E DV Y      ++ HS       G+ GS+R R G ++ + +L+Y T G
Sbjct: 82  NVQDGQMVYGGEADVNYA----GNDSHSSGRRVKQGVNGSVRGRVGVDL-NPVLVYGTAG 136

Query: 140 PDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKY---------SKV 190
             +     +  AG      +G TAG G E   +++++ AR+EYR + Y         S V
Sbjct: 137 LALGNAKLSTPAGSDDKTLVGWTAGAGAET-FVTDNVTARVEYRYTDYASKDFRTGGSTV 195

Query: 191 EGFYN--TISLGVGMKF 205
              Y+  ++ LG+G+KF
Sbjct: 196 SSGYDEHSVKLGMGVKF 212


>gi|315498453|ref|YP_004087257.1| porin [Asticcacaulis excentricus CB 48]
 gi|315416465|gb|ADU13106.1| porin [Asticcacaulis excentricus CB 48]
          Length = 199

 Score = 50.1 bits (118), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 48/179 (26%), Positives = 79/179 (44%), Gaps = 27/179 (15%)

Query: 52  DFNGPY---------AGLSALYN-GSFGEEAHHNAG---GSIFAGYNVEDSCIMYGVEGD 98
           DF+GPY           L   Y+ G+  E A  + G     +  G+N + +  ++GVE D
Sbjct: 23  DFSGPYIAGQGGYAKTKLEVTYSAGTTTESASDDTGNGAAGVILGFNAQSNGAVFGVETD 82

Query: 99  VRYT-----VPVLADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGE 153
           + +        VL + + +     G++R R G+ VS + L Y   G    + Y      +
Sbjct: 83  LNWNNAKDRYRVLGEEVETGIDYSGAVRARLGF-VSGNTLFYGAAGVAGTRAYVEYDGEK 141

Query: 154 ITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEG-------FYNTISLGVGMKF 205
            T    G TAG+G +    S+ +  R+EYR + +  VE           ++ LG+GMKF
Sbjct: 142 ETETVAGWTAGIGADH-AFSDRVFGRIEYRYTDFGDVEDDGVKAELMQQSVWLGLGMKF 199


>gi|146425515|emb|CAM89327.2| 25 kDa outer membrane protein [Brucella melitensis]
 gi|146425525|emb|CAM89318.2| 25 kDa outer membrane protein [Brucella melitensis]
 gi|146425535|emb|CAM89309.2| 25 kDa outer membrane protein [Brucella melitensis]
 gi|146425545|emb|CAM89300.2| 25 kDa outer membrane protein [Brucella melitensis]
 gi|146425565|emb|CAM89282.2| 25 kDa outer membrane protein [Brucella melitensis]
 gi|146425575|emb|CAM89273.2| 25 kDa outer membrane protein [Brucella melitensis]
 gi|146425585|emb|CAM89264.2| 25 kDa outer membrane protein [Brucella melitensis]
 gi|146425595|emb|CAM89255.2| 25 kDa outer membrane protein [Brucella melitensis]
 gi|146425605|emb|CAM89246.2| 25 kDa outer membrane protein [Brucella melitensis]
 gi|146425615|emb|CAM89237.2| 25 kDa outer membrane protein [Brucella melitensis]
 gi|146425625|emb|CAM89228.2| 25 kDa outer membrane protein [Brucella melitensis]
 gi|146425635|emb|CAM89219.2| 25 kDa outer membrane protein [Brucella melitensis]
 gi|146425645|emb|CAM89210.2| 25 kDa outer membrane protein [Brucella melitensis]
 gi|146425655|emb|CAM89201.2| 25 kDa outer membrane protein [Brucella melitensis]
 gi|146425665|emb|CAM89192.2| 25 kDa outer membrane protein [Brucella melitensis]
 gi|146425675|emb|CAM89183.2| 25 kDa outer membrane protein [Brucella melitensis]
 gi|146425685|emb|CAM89174.2| 25 kDa outer membrane protein [Brucella melitensis]
 gi|146425695|emb|CAM89165.2| 25 kDa outer membrane protein [Brucella melitensis]
 gi|146425705|emb|CAM89156.2| 25 kDa outer membrane protein [Brucella abortus]
 gi|146425715|emb|CAM89147.2| 25 kDa outer membrane protein [Brucella abortus]
 gi|146425725|emb|CAM89138.2| 25 kDa outer membrane protein [Brucella abortus]
 gi|146425735|emb|CAM89129.2| 25 kDa outer membrane protein [Brucella abortus]
 gi|146425745|emb|CAM89120.2| 25 kDa outer membrane protein [Brucella abortus]
 gi|146425755|emb|CAM89111.2| 25 kDa outer membrane protein [Brucella abortus]
 gi|146425765|emb|CAM89102.2| 25 kDa outer membrane protein [Brucella abortus]
 gi|146425775|emb|CAM89093.2| 25 kDa outer membrane protein [Brucella abortus]
 gi|146425785|emb|CAM89084.2| 25 kDa outer membrane protein [Brucella abortus]
 gi|146425795|emb|CAM89075.2| 25 kDa outer membrane protein [Brucella abortus]
 gi|146425805|emb|CAM89066.2| 25 kDa outer membrane protein [Brucella abortus]
 gi|146425815|emb|CAM89057.2| 25 kDa outer membrane protein [Brucella abortus]
 gi|146425825|emb|CAM89048.2| 25 kDa outer membrane protein [Brucella abortus]
 gi|146425835|emb|CAM89039.2| 25 kDa outer membrane protein [Brucella abortus]
 gi|146425845|emb|CAM89030.2| 25 kDa outer membrane protein [Brucella abortus]
 gi|146425855|emb|CAM89021.2| 25 kDa outer membrane protein [Brucella abortus]
 gi|146425865|emb|CAM89012.2| 25 kDa outer membrane protein [Brucella abortus]
 gi|146425875|emb|CAM89003.2| 25 kDa outer membrane protein [Brucella abortus]
 gi|146425885|emb|CAM88994.2| 25 kDa outer membrane protein [Brucella abortus]
 gi|146425895|emb|CAM88985.2| 25 kDa outer membrane protein [Brucella abortus]
 gi|146425905|emb|CAM88976.2| 25 kDa outer membrane protein [Brucella abortus]
 gi|146426370|emb|CAM89822.2| 25 kDa outer membrane protein [Brucella suis]
 gi|146426380|emb|CAM89813.2| 25 kDa outer membrane protein [Brucella suis]
 gi|146426390|emb|CAM89804.2| 25 kDa outer membrane protein [Brucella suis]
 gi|146426400|emb|CAM89795.2| 25 kDa outer membrane protein [Brucella suis]
 gi|146426410|emb|CAM89786.2| 25 kDa outer membrane protein [Brucella suis]
 gi|146426420|emb|CAM89777.2| 25 kDa outer membrane protein [Brucella suis]
 gi|146426430|emb|CAM89768.2| 25 kDa outer membrane protein [Brucella suis]
 gi|146426440|emb|CAM89759.2| 25 kDa outer membrane protein [Brucella suis]
 gi|146426450|emb|CAM89750.2| 25 kDa outer membrane protein [Brucella suis]
 gi|146426460|emb|CAM89741.2| 25 kDa outer membrane protein [Brucella suis]
 gi|146426470|emb|CAM89732.2| 25 kDa outer membrane protein [Brucella suis]
 gi|146426480|emb|CAM89723.2| 25 kDa outer membrane protein [Brucella suis]
 gi|146426490|emb|CAM89714.2| 25 kDa outer membrane protein [Brucella suis]
 gi|146426500|emb|CAM89705.2| 25 kDa outer membrane protein [Brucella suis]
 gi|146426510|emb|CAM89696.2| 25 kDa outer membrane protein [Brucella suis]
 gi|146426520|emb|CAM89687.2| 25 kDa outer membrane protein [Brucella suis]
 gi|146426530|emb|CAM89678.2| 25 kDa outer membrane protein [Brucella suis]
 gi|146426540|emb|CAM89669.2| 25 kDa outer membrane protein [Brucella suis]
 gi|146426550|emb|CAM89660.2| 25 kDa outer membrane protein [Brucella suis]
 gi|146426560|emb|CAM89651.2| 25 kDa outer membrane protein [Brucella suis]
 gi|146426570|emb|CAM89642.2| 25 kDa outer membrane protein [Brucella suis]
 gi|146426580|emb|CAM89633.2| 25 kDa outer membrane protein [Brucella suis]
 gi|146426590|emb|CAM89624.2| 25 kDa outer membrane protein [Brucella suis]
 gi|146426600|emb|CAM89615.2| 25 kDa outer membrane protein [Brucella suis]
 gi|146426610|emb|CAM89606.2| 25 kDa outer membrane protein [Brucella suis]
 gi|146426620|emb|CAM89597.2| 25 kDa outer membrane protein [Brucella suis]
 gi|146426630|emb|CAM89588.2| 25 kDa outer membrane protein [Brucella suis]
 gi|146426640|emb|CAM89579.2| 25 kDa outer membrane protein [Brucella suis]
 gi|146426650|emb|CAM89570.2| 25 kDa outer membrane protein [Brucella suis]
 gi|146426660|emb|CAM89561.2| 25 kDa outer membrane protein [Brucella suis]
 gi|146426670|emb|CAM89552.2| 25 kDa outer membrane protein [Brucella suis ATCC 23445]
 gi|146426680|emb|CAM89543.2| 25 kDa outer membrane protein [Brucella suis]
 gi|146426690|emb|CAM89534.2| 25 kDa outer membrane protein [Brucella suis]
 gi|146426700|emb|CAM89525.2| 25 kDa outer membrane protein [Brucella suis]
 gi|146426710|emb|CAM89516.2| 25 kDa outer membrane protein [Brucella suis]
 gi|146426720|emb|CAM89507.2| 25 kDa outer membrane protein [Brucella suis]
 gi|146426730|emb|CAM89498.2| 25 kDa outer membrane protein [Brucella suis]
 gi|146426740|emb|CAM89489.2| 25 kDa outer membrane protein [Brucella suis]
 gi|146426750|emb|CAM89480.2| 25 kDa outer membrane protein [Brucella suis]
 gi|146426760|emb|CAM89471.2| 25 kDa outer membrane protein [Brucella suis]
 gi|146426770|emb|CAM89462.2| 25 kDa outer membrane protein [Brucella suis]
 gi|146426780|emb|CAM89453.2| 25 kDa outer membrane protein [Brucella suis 1330]
 gi|146426900|emb|CAM89345.2| 25 kDa outer membrane protein [Brucella melitensis]
 gi|146426910|emb|CAM89336.2| 25 kDa outer membrane protein [Brucella melitensis]
 gi|146427366|emb|CAM90326.2| 25 kDa outer membrane protein [Brucella sp. 5/95]
 gi|146427376|emb|CAM90317.2| 25 kDa outer membrane protein [Brucella sp. 59/94]
 gi|146427386|emb|CAM90308.2| 25 kDa outer membrane protein [Brucella sp. UK28/03-13840]
 gi|146427396|emb|CAM90299.2| 25 kDa outer membrane protein [Brucella sp. F7/99]
 gi|146427406|emb|CAM90290.2| 25 kDa outer membrane protein [Brucella sp. F10/99]
 gi|146427416|emb|CAM90281.2| 25 kDa outer membrane protein [Brucella sp. F9/99]
 gi|146427426|emb|CAM90272.2| 25 kDa outer membrane protein [Brucella sp. F8/99]
 gi|146427436|emb|CAM90263.2| 25 kDa outer membrane protein [Brucella sp. F6/99]
 gi|146427446|emb|CAM90254.2| 25 kDa outer membrane protein [Brucella sp. UK5/01]
 gi|146427456|emb|CAM90245.2| 25 kDa outer membrane protein [Brucella sp. UK40/99]
 gi|146427466|emb|CAM90236.2| 25 kDa outer membrane protein [Brucella sp. UK13/99]
 gi|146427476|emb|CAM90227.2| 25 kDa outer membrane protein [Brucella sp. 61/94]
 gi|146427486|emb|CAM90218.2| 25 kDa outer membrane protein [Brucella sp. 4/96]
 gi|146427496|emb|CAM90209.2| 25 kDa outer membrane protein [Brucella sp. 55/94]
 gi|146427506|emb|CAM90200.2| 25 kDa outer membrane protein [Brucella sp. UK24/00 (M192)]
 gi|146427516|emb|CAM90191.2| 25 kDa outer membrane protein [Brucella sp. 44/94]
 gi|146427526|emb|CAM90182.2| 25 kDa outer membrane protein [Brucella sp. 39/94]
 gi|146427536|emb|CAM90173.2| 25 kDa outer membrane protein [Brucella sp. UK31/04]
 gi|146427546|emb|CAM90164.2| 25 kDa outer membrane protein [Brucella sp. VLA04/06]
 gi|146427556|emb|CAM90155.2| 25 kDa outer membrane protein [Brucella sp. VLA04/105]
 gi|146427566|emb|CAM90146.2| 25 kDa outer membrane protein [Brucella sp. VLA04.72]
 gi|146427576|emb|CAM90137.2| 25 kDa outer membrane protein [Brucella sp. VLA04.67]
 gi|146427586|emb|CAM90128.2| 25 kDa outer membrane protein [Brucella sp. F96/2]
 gi|146427596|emb|CAM90119.2| 25 kDa outer membrane protein [Brucella sp. F23/97]
 gi|146427606|emb|CAM90110.2| 25 kDa outer membrane protein [Brucella sp. UK15/02]
 gi|146427616|emb|CAM90101.2| 25 kDa outer membrane protein [Brucella sp. UK10/01]
 gi|146427626|emb|CAM90092.2| 25 kDa outer membrane protein [Brucella sp. UK4/01]
 gi|146427636|emb|CAM90083.2| 25 kDa outer membrane protein [Brucella sp. UK10/00]
 gi|146427646|emb|CAM90074.2| 25 kDa outer membrane protein [Brucella sp. UK5/97]
 gi|146427656|emb|CAM90065.2| 25 kDa outer membrane protein [Brucella sp. UK3/97]
 gi|146427666|emb|CAM90056.2| 25 kDa outer membrane protein [Brucella sp. UK1/97]
 gi|146427676|emb|CAM90047.2| 25 kDa outer membrane protein [Brucella sp. 2/96]
 gi|146427686|emb|CAM90038.2| 25 kDa outer membrane protein [Brucella sp. 14/95]
 gi|146427696|emb|CAM90029.2| 25 kDa outer membrane protein [Brucella sp. UK35/99]
 gi|146427706|emb|CAM90020.2| 25 kDa outer membrane protein [Brucella sp. UK15/98]
 gi|146427716|emb|CAM90011.2| 25 kDa outer membrane protein [Brucella sp. 52/94]
 gi|146427726|emb|CAM90002.2| 25 kDa outer membrane protein [Brucella sp. 36/94]
 gi|146427846|emb|CAM89894.2| 25 kDa outer membrane protein [Brucella suis]
 gi|146427856|emb|CAM89885.2| 25 kDa outer membrane protein [Brucella suis]
 gi|146427866|emb|CAM89876.2| 25 kDa outer membrane protein [Brucella suis]
 gi|146427876|emb|CAM89867.2| 25 kDa outer membrane protein [Brucella suis]
 gi|146427886|emb|CAM89858.2| 25 kDa outer membrane protein [Brucella suis]
 gi|146427896|emb|CAM89849.2| 25 kDa outer membrane protein [Brucella suis]
 gi|146427906|emb|CAM89840.2| 25 kDa outer membrane protein [Brucella suis]
 gi|146427916|emb|CAM89831.2| 25 kDa outer membrane protein [Brucella suis]
 gi|146427988|emb|CAM90407.2| 25 kDa outer membrane protein [Brucella sp. F5/02]
 gi|146428001|emb|CAM90398.2| 25 kDa outer membrane protein [Brucella sp. F5/99]
 gi|146428011|emb|CAM90389.2| 25 kDa outer membrane protein [Brucella sp. VLA05/8]
 gi|146428021|emb|CAM90380.2| 25 kDa outer membrane protein [Brucella sp. VLA05/4]
 gi|146428031|emb|CAM90371.2| 25 kDa outer membrane protein [Brucella sp. UK3/05]
 gi|146428041|emb|CAM90362.2| 25 kDa outer membrane protein [Brucella sp. 14/94]
 gi|146428051|emb|CAM90353.2| 25 kDa outer membrane protein [Brucella sp. UK2/2000]
 gi|146428061|emb|CAM90344.2| 25 kDa outer membrane protein [Brucella sp. UK1/2000]
 gi|146428071|emb|CAM90335.2| 25 kDa outer membrane protein [Brucella sp. UK43/99]
 gi|170015689|emb|CAP05282.1| 25 kDa outer membrane protein [Brucella sp. BO1]
          Length = 163

 Score = 50.1 bits (118), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 50/169 (29%), Positives = 76/169 (44%), Gaps = 22/169 (13%)

Query: 10  VSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSFG 69
           VS+  L    +A AAD ++          P +     V  ++ + G Y GL   Y G   
Sbjct: 4   VSAALLPFSATAFAADAIQEQ--------PPVPAPVEVAPQYSWAGGYTGL---YLGYGW 52

Query: 70  EEAHHNAGGSI---------FAGYNVEDSCIMYGVEGDVRYTVPVLA-DNIHSLHGIGGS 119
            +A  +  GSI         FAG+N +   I+YGVEGD  Y+    + D +    G  GS
Sbjct: 53  NKAKTSTVGSIKPDDWKAGAFAGWNFQQDQIVYGVEGDAGYSWAKKSKDGLEVKQGFEGS 112

Query: 120 LRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVE 168
           LR R GY++ + ++ Y T G   +Q        + +   +G TAG G+E
Sbjct: 113 LRARVGYDL-NPVMPYLTAGIAGSQIKLNNGLDDESKFRVGWTAGAGLE 160


>gi|307944219|ref|ZP_07659560.1| 22 kDa outer membrane protein [Roseibium sp. TrichSKD4]
 gi|307772565|gb|EFO31785.1| 22 kDa outer membrane protein [Roseibium sp. TrichSKD4]
          Length = 242

 Score = 50.1 bits (118), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 61/202 (30%), Positives = 88/202 (43%), Gaps = 32/202 (15%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPI---RHDFNGPY 57
           M++L  A   +++++A    + AAD  + A        PT  T  Y P    R D++G Y
Sbjct: 19  MKRLACAAIAATVSVAGLAPSYAADLPQAA--------PTYDTT-YEPAPSGRFDWSGAY 69

Query: 58  AGLSALY-----------NGSFGEEAHHNAGGSIFAGYNVE-DSCIMYGVEGDVRYTVPV 105
           AG S  +            GSF  + +  +GG +  GYN      I+ GVE D + T   
Sbjct: 70  AGGSLGWVWSGFDTTSSPTGSFDHDTNGFSGG-VHGGYNFAITPNIVAGVELDFQMTDLY 128

Query: 106 LAD-----NIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIG 160
                   N+ +      S R R GY + D  L+Y T G  +A              A+G
Sbjct: 129 ENTVRNGVNVKTSSAWNSSARARLGYAM-DRFLVYGTAGLAIADLSINANGASEDTTALG 187

Query: 161 GTAGVGVEVGGLSESLVARLEY 182
            TAG GVE G +S +L AR+EY
Sbjct: 188 WTAGAGVE-GAISNNLTARVEY 208


>gi|146427796|emb|CAM89939.2| 25 kDa outer membrane protein [Brucella canis]
 gi|146427806|emb|CAM89930.2| 25 kDa outer membrane protein [Brucella canis]
 gi|146427816|emb|CAM89921.2| 25 kDa outer membrane protein [Brucella canis]
 gi|146427826|emb|CAM89912.2| 25 kDa outer membrane protein [Brucella canis]
 gi|146427836|emb|CAM89903.2| 25 kDa outer membrane protein [Brucella canis]
          Length = 163

 Score = 50.1 bits (118), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 50/169 (29%), Positives = 76/169 (44%), Gaps = 22/169 (13%)

Query: 10  VSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSFG 69
           VS+  L    +A AAD ++          P +     V  ++ + G Y GL   Y G   
Sbjct: 4   VSAALLPFSATAFAADAIQEQ--------PPVPAPVEVAPQYSWAGGYTGL---YLGYGW 52

Query: 70  EEAHHNAGGSI---------FAGYNVEDSCIMYGVEGDVRYTVPVLA-DNIHSLHGIGGS 119
            +A  +  GSI         FAG+N +   I+YGVEGD  Y+    + D +    G  GS
Sbjct: 53  NKAKTSTVGSIKPDDWKAGAFAGWNFQKDQIVYGVEGDAGYSWAKKSKDGLEVKQGFEGS 112

Query: 120 LRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVE 168
           LR R GY++ + ++ Y T G   +Q        + +   +G TAG G+E
Sbjct: 113 LRARVGYDL-NPVMPYLTAGIAGSQIKLNNGLDDESKFRVGWTAGAGLE 160


>gi|116251075|ref|YP_766913.1| outer membrane protein [Rhizobium leguminosarum bv. viciae 3841]
 gi|115255723|emb|CAK06804.1| putative outer membrane protein [Rhizobium leguminosarum bv. viciae
           3841]
 gi|220979415|gb|ACL97989.1| outer membrane protein B2 [Rhizobium leguminosarum bv. viciae]
          Length = 205

 Score = 50.1 bits (118), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 51/185 (27%), Positives = 79/185 (42%), Gaps = 17/185 (9%)

Query: 8   VGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGS 67
           V  ++L L+    A AAD             P   +   V   +D++G Y G    Y+ S
Sbjct: 6   VACAALTLSVAVPAVAADLTYE--------TPPAPSAGQVSSAYDWSGFYLGAQGGYSWS 57

Query: 68  ----FGEEAHHNAGGS-IFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGSLRI 122
                G +   ++G S + AGYN +   I+YG+E D  Y       N ++      S R 
Sbjct: 58  QATILGSDQDIDSGTSGLHAGYNFQSGNIVYGIENDFNYN---FEKNDNANLEWDASGRA 114

Query: 123 RGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEY 182
           R GY    +L            K +   AG+   I IG TAG G+E   ++++++ R EY
Sbjct: 115 RVGYAWDRTLFFATAGVAAGGGKVDIPAAGKKDGILIGWTAGGGIE-HAVTDNILVRAEY 173

Query: 183 RASKY 187
           R S +
Sbjct: 174 RHSDF 178


>gi|241203671|ref|YP_002974767.1| hypothetical protein Rleg_0932 [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240857561|gb|ACS55228.1| conserved hypothetical protein [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 205

 Score = 49.7 bits (117), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 52/185 (28%), Positives = 79/185 (42%), Gaps = 17/185 (9%)

Query: 8   VGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGS 67
           V  + LAL+    A AAD             P   +   V   +D++G Y G    Y+ S
Sbjct: 6   VACAVLALSVAVPAVAADLTYE--------TPPAPSAGEVSSAYDWSGFYLGAQGGYSWS 57

Query: 68  ----FGEEAHHNAGGS-IFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGSLRI 122
                G +   ++G S + AGYN +   I+YG+E D  Y       N ++      S R 
Sbjct: 58  QAKILGSDQDIDSGTSGLHAGYNFQSGNIVYGIENDFNYN---FEKNDNANLEWDASGRA 114

Query: 123 RGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEY 182
           R GY    +L            K +   AG+   I IG TAG G+E   ++++++ R EY
Sbjct: 115 RVGYAWDRTLFFATAGVAAGGGKVDISAAGKKDGILIGWTAGGGIE-HAVTDNILVRGEY 173

Query: 183 RASKY 187
           R S +
Sbjct: 174 RHSDF 178


>gi|15888468|ref|NP_354149.1| outer membrane protein [Agrobacterium tumefaciens str. C58]
 gi|18139945|gb|AAL60203.1|AF445083_1 outer membrane protein [Agrobacterium tumefaciens str. C58]
 gi|15156164|gb|AAK86934.1| outer membrane protein [Agrobacterium tumefaciens str. C58]
          Length = 218

 Score = 49.7 bits (117), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 69/230 (30%), Positives = 112/230 (48%), Gaps = 40/230 (17%)

Query: 3   KLFLAVGV-SSLALASFCSAQAADPVRRAHHGGRGVVPT--IATNRYVPIRHDFNGPYAG 59
           ++F+A  + S++A A F +A AAD V          VP   +A ++   ++ D++G Y G
Sbjct: 2   RIFVATLMASTMAAAGFSAAYAADAVNE--------VPQAPVAYDQPAAVK-DWSGAYLG 52

Query: 60  LSALYNGSFGEEAHHNAG-------GSIFAGYNVEDSCIMYGVEGDVRY------TVPVL 106
            +  Y+  +G  +  N G       G ++ GYN++   I+YG E DV           V 
Sbjct: 53  GTVNYD--WGRFSSSNDGRDAKGFGGGVYGGYNMQSGQIVYGAEADVNMGDEKGSAGTVA 110

Query: 107 ADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVG 166
              +    G+ GSLR R GY+++   LLY T G  V+         + +  A+G T G G
Sbjct: 111 GRAVEGKQGVNGSLRGRVGYDMN-PFLLYGTAGLAVSDNKVRDGVNKDSATALGYTVGAG 169

Query: 167 VEVGGLSESLVARLEYRASKYSKVE----------GFYN-TISLGVGMKF 205
           VE   +++++ ARLEYR S Y K +          GF + ++  G+G+KF
Sbjct: 170 VEA-MVTDNITARLEYRYSDYQKKDYTLGNDAFSRGFDDHSVKAGIGVKF 218


>gi|146425555|emb|CAM89291.2| 25 kDa outer membrane protein [Brucella melitensis]
          Length = 163

 Score = 49.7 bits (117), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 50/169 (29%), Positives = 76/169 (44%), Gaps = 22/169 (13%)

Query: 10  VSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSFG 69
           VS+  L    +A AAD ++          P +     V  ++ + G Y GL   Y G   
Sbjct: 4   VSAALLPFSATAFAADAIQEQ--------PPVPAPVEVAPQYSWAGGYTGL---YLGYGW 52

Query: 70  EEAHHNAGGSI---------FAGYNVEDSCIMYGVEGDVRYTVPVLA-DNIHSLHGIGGS 119
            +A  +  GSI         FAG+N +   I+YGVEGD  Y+    + D +    G  GS
Sbjct: 53  NKAKTSTVGSIKPDDWKAGAFAGWNFQQDQIVYGVEGDAGYSWAKKSKDGLEVKQGFEGS 112

Query: 120 LRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVE 168
           LR R GY++ + ++ Y T G   +Q        + +   +G TAG G+E
Sbjct: 113 LRARVGYDL-NPVMPYLTAGIVGSQIKLNNGLDDESKFRVGWTAGAGLE 160


>gi|146427736|emb|CAM89993.2| 25 kDa outer membrane protein [Brucella neotomae]
 gi|146427746|emb|CAM89984.2| 25 kDa outer membrane protein [Brucella neotomae]
 gi|146427756|emb|CAM89975.2| 25 kDa outer membrane protein [Brucella neotomae]
          Length = 163

 Score = 49.7 bits (117), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 50/169 (29%), Positives = 76/169 (44%), Gaps = 22/169 (13%)

Query: 10  VSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSFG 69
           VS+  L    +A AAD ++          P +     V  ++ + G Y GL   Y G   
Sbjct: 4   VSAALLPFSATAFAADAIQEQ--------PPVPAPVEVAPQYSWAGGYTGL---YLGYGW 52

Query: 70  EEAHHNAGGSI---------FAGYNVEDSCIMYGVEGDVRYTVPVLA-DNIHSLHGIGGS 119
            +A  +  GSI         FAG+N +   I+YGVEGD  Y+    + D +    G  GS
Sbjct: 53  NKAKTSTVGSIKPDDWKAGAFAGWNFQQDQIVYGVEGDAGYSWAKKSKDGLEVKQGFEGS 112

Query: 120 LRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVE 168
           LR R GY++ + ++ Y T G   +Q        + +   +G TAG G+E
Sbjct: 113 LRARVGYDL-NLVMPYLTAGIAGSQIKLNNGLDDESKFRVGWTAGAGLE 160


>gi|146427766|emb|CAM89966.2| 25 kDa outer membrane protein [Brucella canis]
 gi|146427776|emb|CAM89957.2| 25 kDa outer membrane protein [Brucella canis]
 gi|146427786|emb|CAM89948.2| 25 kDa outer membrane protein [Brucella canis]
          Length = 163

 Score = 48.1 bits (113), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 50/169 (29%), Positives = 75/169 (44%), Gaps = 22/169 (13%)

Query: 10  VSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSFG 69
           VS+  L    +A AAD ++          P +     V  ++ + G Y GL   Y G   
Sbjct: 4   VSAALLPFSATAFAADAIQEQ--------PPVPAPVEVAPQYSWAGGYTGL---YLGYGW 52

Query: 70  EEAHHNAGGSI---------FAGYNVEDSCIMYGVEGDVRYTVPVLA-DNIHSLHGIGGS 119
            +A  +  GSI         FAG+N +   I+YGVEGD  Y+    + D      G  GS
Sbjct: 53  NKAKTSTVGSIKPDDWKAGAFAGWNFQKDQIVYGVEGDAGYSWAKKSKDGPEVKQGFEGS 112

Query: 120 LRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVE 168
           LR R GY++ + ++ Y T G   +Q        + +   +G TAG G+E
Sbjct: 113 LRARVGYDL-NPVMPYLTAGIAGSQIKLNNGLDDESKFRVGWTAGAGLE 160


>gi|146426790|emb|CAM89444.2| 25 kDa outer membrane protein [Brucella ovis]
 gi|146426800|emb|CAM89435.2| 25 kDa outer membrane protein [Brucella ovis]
 gi|146426810|emb|CAM89426.2| 25 kDa outer membrane protein [Brucella ovis]
 gi|146426820|emb|CAM89417.2| 25 kDa outer membrane protein [Brucella ovis]
 gi|146426830|emb|CAM89408.2| 25 kDa outer membrane protein [Brucella ovis]
 gi|146426840|emb|CAM89399.2| 25 kDa outer membrane protein [Brucella ovis]
 gi|146426850|emb|CAM89390.2| 25 kDa outer membrane protein [Brucella ovis]
 gi|146426860|emb|CAM89381.2| 25 kDa outer membrane protein [Brucella ovis]
 gi|146426870|emb|CAM89372.2| 25 kDa outer membrane protein [Brucella ovis]
 gi|146426880|emb|CAM89363.2| 25 kDa outer membrane protein [Brucella ovis]
 gi|146426890|emb|CAM89354.2| 25 kDa outer membrane protein [Brucella ovis]
          Length = 163

 Score = 48.1 bits (113), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 49/169 (28%), Positives = 76/169 (44%), Gaps = 22/169 (13%)

Query: 10  VSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSFG 69
           VS+  L    +A AAD ++          P +     V  ++ + G Y GL   Y G   
Sbjct: 4   VSAALLPFSATAFAADAIQEQ--------PPVPAPVEVAPQYSWAGGYTGL---YLGYGW 52

Query: 70  EEAHHNAGGSI---------FAGYNVEDSCIMYGVEGDVRYTVPVLA-DNIHSLHGIGGS 119
            +A  +  GSI         FAG+N +   I+YGVEG+  Y+    + D +    G  GS
Sbjct: 53  NKAKTSTVGSIKPDDWKAGAFAGWNFQQDQIVYGVEGNAGYSWAKKSKDGLEVKQGFEGS 112

Query: 120 LRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVE 168
           LR R GY++ + ++ Y T G   +Q        + +   +G TAG G+E
Sbjct: 113 LRARVGYDL-NPVMPYLTAGIAGSQIKLNNGLDDESKFRVGWTAGAGLE 160


>gi|209548422|ref|YP_002280339.1| porin [Rhizobium leguminosarum bv. trifolii WSM2304]
 gi|209534178|gb|ACI54113.1| porin [Rhizobium leguminosarum bv. trifolii WSM2304]
          Length = 204

 Score = 47.8 bits (112), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 34/112 (30%), Positives = 51/112 (45%), Gaps = 4/112 (3%)

Query: 80  IFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVG 139
           + AGYN +   I+YG+E D  Y      D        G   R R GY ++ +L       
Sbjct: 74  LHAGYNFQSGNIVYGIENDFNYNFKKNDDANLEWDASG---RARVGYALNRTLFFATAGV 130

Query: 140 PDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVE 191
                K +   AG+   I IG TAG G+E   +++ ++ R EYR S +S  +
Sbjct: 131 AAGGGKVDIPTAGKKDGILIGWTAGGGIE-HAVTDHILVRGEYRHSDFSNKD 181


>gi|156739552|gb|ABU93436.1| Omp25 [Brucella abortus]
          Length = 123

 Score = 47.4 bits (111), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 31/89 (34%), Positives = 47/89 (52%), Gaps = 2/89 (2%)

Query: 81  FAGYNVEDSCIMYGVEGDVRYTVPVLA-DNIHSLHGIGGSLRIRGGYEVSDSLLLYATVG 139
           FAG+N +   I+YGVEGD  Y+    + D +    G  GSLR R GY++ + ++ Y T G
Sbjct: 28  FAGWNFQQDQIVYGVEGDAGYSWAKKSKDGLEVKQGFEGSLRARVGYDL-NPVMPYLTAG 86

Query: 140 PDVAQKYETGKAGEITPIAIGGTAGVGVE 168
              +Q        + +   +G TAG G+E
Sbjct: 87  IAGSQIKLNNGLDDESKFRVGWTAGAGLE 115


>gi|156739530|gb|ABU93425.1| Omp25 [Brucella suis]
 gi|156739540|gb|ABU93430.1| Omp25 [Brucella abortus]
 gi|156739558|gb|ABU93439.1| Omp25 [Brucella melitensis]
 gi|156739590|gb|ABU93455.1| Omp25 [Brucella suis]
 gi|156739594|gb|ABU93457.1| Omp25 [Brucella suis]
 gi|156739614|gb|ABU93467.1| Omp25 [Brucella melitensis]
 gi|156739630|gb|ABU93475.1| Omp25 [Brucella suis]
          Length = 128

 Score = 47.4 bits (111), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 39/120 (32%), Positives = 58/120 (48%), Gaps = 11/120 (9%)

Query: 59  GLSALYNGSFGEEAHHNAGGSI---------FAGYNVEDSCIMYGVEGDVRYTVPVLA-D 108
           G + LY G    +A  +  GSI         FAG+N +   I+YGVEGD  Y+    + D
Sbjct: 2   GYTGLYLGYGWNKAKTSTVGSIKPDDWKAGAFAGWNFQQDQIVYGVEGDAGYSWAKKSKD 61

Query: 109 NIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVE 168
            +    G  GSLR R GY++ + ++ Y T G   +Q        + +   +G TAG G+E
Sbjct: 62  GLEVKQGFEGSLRARVGYDL-NPVMPYLTAGIAGSQIKLNNGLDDESKFRVGWTAGAGLE 120


>gi|156739536|gb|ABU93428.1| Omp25 [Brucella abortus]
          Length = 105

 Score = 47.4 bits (111), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 31/89 (34%), Positives = 47/89 (52%), Gaps = 2/89 (2%)

Query: 81  FAGYNVEDSCIMYGVEGDVRYTVPVLA-DNIHSLHGIGGSLRIRGGYEVSDSLLLYATVG 139
           FAG+N +   I+YGVEGD  Y+    + D +    G  GSLR R GY+++  ++ Y T G
Sbjct: 11  FAGWNFQQDQIVYGVEGDAGYSWAKKSKDGLEVKQGFEGSLRARVGYDLN-PVMPYLTAG 69

Query: 140 PDVAQKYETGKAGEITPIAIGGTAGVGVE 168
              +Q        + +   +G TAG G+E
Sbjct: 70  IAGSQIKLNNGLDDESKFRVGWTAGAGLE 98


>gi|156739528|gb|ABU93424.1| Omp25 [Brucella melitensis]
          Length = 124

 Score = 47.4 bits (111), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 31/89 (34%), Positives = 47/89 (52%), Gaps = 2/89 (2%)

Query: 81  FAGYNVEDSCIMYGVEGDVRYTVPVLA-DNIHSLHGIGGSLRIRGGYEVSDSLLLYATVG 139
           FAG+N +   I+YGVEGD  Y+    + D +    G  GSLR R GY++ + ++ Y T G
Sbjct: 29  FAGWNFQQDQIVYGVEGDAGYSWAKKSKDGLEVKQGFEGSLRARVGYDL-NPVMPYLTAG 87

Query: 140 PDVAQKYETGKAGEITPIAIGGTAGVGVE 168
              +Q        + +   +G TAG G+E
Sbjct: 88  IAGSQIKLNNGLDDESKFRVGWTAGAGLE 116


>gi|156739534|gb|ABU93427.1| Omp25 [Brucella suis]
 gi|156739618|gb|ABU93469.1| Omp25 [Brucella melitensis]
          Length = 98

 Score = 47.4 bits (111), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 31/89 (34%), Positives = 47/89 (52%), Gaps = 2/89 (2%)

Query: 81  FAGYNVEDSCIMYGVEGDVRYTVPVLA-DNIHSLHGIGGSLRIRGGYEVSDSLLLYATVG 139
           FAG+N +   I+YGVEGD  Y+    + D +    G  GSLR R GY++ + ++ Y T G
Sbjct: 3   FAGWNFQQDQIVYGVEGDAGYSWAKKSKDGLEVKQGFEGSLRARVGYDL-NPVMPYLTAG 61

Query: 140 PDVAQKYETGKAGEITPIAIGGTAGVGVE 168
              +Q        + +   +G TAG G+E
Sbjct: 62  IAGSQIKLNNGLDDESKFRVGWTAGAGLE 90


>gi|156739532|gb|ABU93426.1| Omp25 [Brucella suis]
 gi|156739566|gb|ABU93443.1| Omp25 [Brucella melitensis]
 gi|156739572|gb|ABU93446.1| Omp25 [Brucella melitensis]
 gi|156739576|gb|ABU93448.1| Omp25 [Brucella melitensis]
          Length = 106

 Score = 47.4 bits (111), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 31/89 (34%), Positives = 47/89 (52%), Gaps = 2/89 (2%)

Query: 81  FAGYNVEDSCIMYGVEGDVRYTVPVLA-DNIHSLHGIGGSLRIRGGYEVSDSLLLYATVG 139
           FAG+N +   I+YGVEGD  Y+    + D +    G  GSLR R GY+++  ++ Y T G
Sbjct: 11  FAGWNFQQDQIVYGVEGDAGYSWAKKSKDGLEVKQGFEGSLRARVGYDLN-PVMPYLTAG 69

Query: 140 PDVAQKYETGKAGEITPIAIGGTAGVGVE 168
              +Q        + +   +G TAG G+E
Sbjct: 70  IAGSQIKLNNGLDDESKFRVGWTAGAGLE 98


>gi|156739580|gb|ABU93450.1| Omp25 [Brucella canis]
          Length = 105

 Score = 47.4 bits (111), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 31/89 (34%), Positives = 47/89 (52%), Gaps = 2/89 (2%)

Query: 81  FAGYNVEDSCIMYGVEGDVRYTVPVLA-DNIHSLHGIGGSLRIRGGYEVSDSLLLYATVG 139
           FAG+N +   I+YGVEGD  Y+    + D +    G  GSLR R GY+++  ++ Y T G
Sbjct: 10  FAGWNFQKDQIVYGVEGDAGYSWAKKSKDGLEVKQGFEGSLRARVGYDLN-PVMPYLTAG 68

Query: 140 PDVAQKYETGKAGEITPIAIGGTAGVGVE 168
              +Q        + +   +G TAG G+E
Sbjct: 69  IAGSQIKLNNGLDDESKFRVGWTAGAGLE 97


>gi|156739520|gb|ABU93420.1| Omp25 [Brucella canis]
 gi|156739522|gb|ABU93421.1| Omp25 [Brucella canis]
          Length = 128

 Score = 47.4 bits (111), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 39/120 (32%), Positives = 58/120 (48%), Gaps = 11/120 (9%)

Query: 59  GLSALYNGSFGEEAHHNAGGSI---------FAGYNVEDSCIMYGVEGDVRYTVPVLA-D 108
           G + LY G    +A  +  GSI         FAG+N +   I+YGVEGD  Y+    + D
Sbjct: 2   GYTGLYLGYGWNKAKTSTVGSIKPDDWKAGAFAGWNFQKDQIVYGVEGDAGYSWAKKSKD 61

Query: 109 NIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVE 168
            +    G  GSLR R GY++ + ++ Y T G   +Q        + +   +G TAG G+E
Sbjct: 62  GLEVKQGFEGSLRARVGYDL-NPVMPYLTAGIAGSQIKLNNGLDDESKFRVGWTAGAGLE 120


>gi|156739538|gb|ABU93429.1| Omp25 [Brucella abortus]
 gi|156739542|gb|ABU93431.1| Omp25 [Brucella abortus]
 gi|156739562|gb|ABU93441.1| Omp25 [Brucella melitensis]
 gi|156739574|gb|ABU93447.1| Omp25 [Brucella melitensis]
 gi|156739596|gb|ABU93458.1| Omp25 [Brucella suis]
 gi|156739600|gb|ABU93460.1| Omp25 [Brucella suis]
 gi|156739604|gb|ABU93462.1| Omp25 [Brucella suis]
 gi|156739616|gb|ABU93468.1| Omp25 [Brucella melitensis]
 gi|156739628|gb|ABU93474.1| Omp25 [Brucella abortus]
          Length = 108

 Score = 47.4 bits (111), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 31/89 (34%), Positives = 47/89 (52%), Gaps = 2/89 (2%)

Query: 81  FAGYNVEDSCIMYGVEGDVRYTVPVLA-DNIHSLHGIGGSLRIRGGYEVSDSLLLYATVG 139
           FAG+N +   I+YGVEGD  Y+    + D +    G  GSLR R GY+++  ++ Y T G
Sbjct: 13  FAGWNFQQDQIVYGVEGDAGYSWAKKSKDGLEVKQGFEGSLRARVGYDLN-PVMPYLTAG 71

Query: 140 PDVAQKYETGKAGEITPIAIGGTAGVGVE 168
              +Q        + +   +G TAG G+E
Sbjct: 72  IAGSQIKLNNGLDDESKFRVGWTAGAGLE 100


>gi|156739546|gb|ABU93433.1| Omp25 [Brucella abortus]
          Length = 109

 Score = 47.4 bits (111), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 31/89 (34%), Positives = 47/89 (52%), Gaps = 2/89 (2%)

Query: 81  FAGYNVEDSCIMYGVEGDVRYTVPVLA-DNIHSLHGIGGSLRIRGGYEVSDSLLLYATVG 139
           FAG+N +   I+YGVEGD  Y+    + D +    G  GSLR R GY+++  ++ Y T G
Sbjct: 14  FAGWNFQQDQIVYGVEGDAGYSWAKKSKDGLEVKQGFEGSLRARVGYDLN-PVMPYLTAG 72

Query: 140 PDVAQKYETGKAGEITPIAIGGTAGVGVE 168
              +Q        + +   +G TAG G+E
Sbjct: 73  IAGSQIKLNNGLDDESKFRVGWTAGAGLE 101


>gi|222149200|ref|YP_002550157.1| outer membrane protein [Agrobacterium vitis S4]
 gi|221736185|gb|ACM37148.1| outer membrane protein [Agrobacterium vitis S4]
          Length = 212

 Score = 47.4 bits (111), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 38/126 (30%), Positives = 59/126 (46%), Gaps = 16/126 (12%)

Query: 91  IMYGVEGDVRYTVPVLADNIHSLHGIG----GSLRIRGGYEVSDSLLLYATVGPDVAQKY 146
           ++ GVE DV Y      +N +S   +G    GS R R GY + D  L++   G    + Y
Sbjct: 92  VILGVEADVNYD---WNENNYSGVKVGMDVSGSARARAGYAI-DRALIFVAGGWTADRTY 147

Query: 147 ETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKY--SKVEGF-----YNTISL 199
               +G+      G T G GV+   ++  +  RLEYR + Y    + G       N ++L
Sbjct: 148 IKSSSGDFNKTLNGWTIGAGVDYA-ITNRIFTRLEYRYNDYGTKNISGIDFDSKQNVVNL 206

Query: 200 GVGMKF 205
           G+G+KF
Sbjct: 207 GIGIKF 212


>gi|156739612|gb|ABU93466.1| Omp25 [Brucella canis]
          Length = 104

 Score = 47.4 bits (111), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 31/89 (34%), Positives = 47/89 (52%), Gaps = 2/89 (2%)

Query: 81  FAGYNVEDSCIMYGVEGDVRYTVPVLA-DNIHSLHGIGGSLRIRGGYEVSDSLLLYATVG 139
           FAG+N +   I+YGVEGD  Y+    + D +    G  GSLR R GY+++  ++ Y T G
Sbjct: 9   FAGWNFQKDQIVYGVEGDAGYSWAKKSKDGLEVKQGFEGSLRARVGYDLN-PVMPYLTAG 67

Query: 140 PDVAQKYETGKAGEITPIAIGGTAGVGVE 168
              +Q        + +   +G TAG G+E
Sbjct: 68  IAGSQIKLNNGLDDESKFRVGWTAGAGLE 96


>gi|156739524|gb|ABU93422.1| Omp25 [Brucella neotomae]
          Length = 128

 Score = 47.0 bits (110), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 39/120 (32%), Positives = 58/120 (48%), Gaps = 11/120 (9%)

Query: 59  GLSALYNGSFGEEAHHNAGGSI---------FAGYNVEDSCIMYGVEGDVRYTVPVLA-D 108
           G + LY G    +A  +  GSI         FAG+N +   I+YGVEGD  Y+    + D
Sbjct: 2   GYTGLYLGYGWNKAKTSTVGSIKPDDWKAGAFAGWNFQQDQIVYGVEGDAGYSWAKKSKD 61

Query: 109 NIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVE 168
            +    G  GSLR R GY++ + ++ Y T G   +Q        + +   +G TAG G+E
Sbjct: 62  GLEVKQGFEGSLRARVGYDL-NLVMPYLTAGIAGSQIKLNNGLDDESKFRVGWTAGAGLE 120


>gi|90422419|ref|YP_530789.1| putative outer-membrane immunogenic protein precursor
           [Rhodopseudomonas palustris BisB18]
 gi|90104433|gb|ABD86470.1| putative outer-membrane immunogenic protein precursor
           [Rhodopseudomonas palustris BisB18]
          Length = 207

 Score = 47.0 bits (110), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 55/175 (31%), Positives = 83/175 (47%), Gaps = 27/175 (15%)

Query: 19  CSAQAADPVRRAHHGGRGVVPTIATNRYVPIR-HDFNGPYAGLSALYNGSFGEEAHHNA- 76
            SAQAAD      +GG     T+    Y P+  H + GPY G +  Y  ++G+  H++A 
Sbjct: 17  SSAQAAD----LPYGGSRAPYTV----YQPLNAHSWAGPYLGGNLGY--AWGD-VHNSAT 65

Query: 77  -----GGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIG----GSLRIRGGYE 127
                 G + AGYN +    +YG+EGD+  T    AD+  +         G++R R GY 
Sbjct: 66  EPSGVAGGVQAGYNWQSGQFVYGLEGDIAITG---ADDTFASWKFSNPWFGTVRGRAGYS 122

Query: 128 VSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEY 182
             D+LL+YAT G    +          +    G T G G E  GL+++  A++EY
Sbjct: 123 F-DNLLVYATGGLAFGELKGERFGQSNSSTNAGWTIGAGAEF-GLNQNWSAKVEY 175


>gi|227821981|ref|YP_002825952.1| outer membrane protein [Sinorhizobium fredii NGR234]
 gi|227340981|gb|ACP25199.1| outer membrane protein [Sinorhizobium fredii NGR234]
          Length = 216

 Score = 44.7 bits (104), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 41/138 (29%), Positives = 65/138 (47%), Gaps = 14/138 (10%)

Query: 81  FAGYNVEDSCIMYGVEGDVRY-----TVPVLADNIHSLHGIGGSLRIRGGYEVSDSLLLY 135
           FAGYN +    + GVEGDV Y     +  V   +      + GS+R R GY +++  LLY
Sbjct: 80  FAGYNYQMGDWVVGVEGDVSYNWNDKSFTVFGASTEVGTDVSGSVRGRVGYTLNEKALLY 139

Query: 136 ATVGPDVAQKY-ETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYS------ 188
            T G  V + + +   A +      G T G G++    + S+  R EYR + +       
Sbjct: 140 GTGGWAVTRGFVDVAGAPKEKETFNGWTIGGGIDY-AFTNSMFGRAEYRYNDFGDKDVGG 198

Query: 189 -KVEGFYNTISLGVGMKF 205
             V+   +  ++GVG+KF
Sbjct: 199 VDVDLDQHQFTVGVGVKF 216


>gi|87199324|ref|YP_496581.1| hypothetical protein Saro_1303 [Novosphingobium aromaticivorans DSM
           12444]
 gi|87135005|gb|ABD25747.1| hypothetical protein Saro_1303 [Novosphingobium aromaticivorans DSM
           12444]
          Length = 185

 Score = 44.3 bits (103), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 38/115 (33%), Positives = 57/115 (49%), Gaps = 7/115 (6%)

Query: 77  GGSIFAGYNVEDSCIMY-GVEGDVRYTVPVLADNIHSL---HGIGGSLRIRGGYEVSDSL 132
           GG++FAGYN + +  +Y GVE +       + D+  SL   +  GGS  +  G+  SDS 
Sbjct: 52  GGTVFAGYNFDLTSSVYAGVEANFDLATAKIGDDTDSLEADYAFGGSALL--GFRPSDST 109

Query: 133 LLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKY 187
            LY  VG    +   T    E +  A G   G+G++   L+E L  R+EY  + Y
Sbjct: 110 ALYGRVGYQRGRGTLTVDGTEYSDSADGLRLGLGLQA-DLTEKLGVRVEYNHTHY 163


>gi|146342874|ref|YP_001207922.1| putative outer membrane protein [Bradyrhizobium sp. ORS278]
 gi|146195680|emb|CAL79707.1| putative outer membrane protein precursor [Bradyrhizobium sp.
           ORS278]
          Length = 214

 Score = 44.3 bits (103), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 54/174 (31%), Positives = 80/174 (45%), Gaps = 25/174 (14%)

Query: 20  SAQAADPVRRAHHGGRGVVPTIATNRYVPIR-HDFNGPYAGLSALYN-GSFGEEAHHNAG 77
           SAQAAD     +  GRG   T+      P+  + + GPY G +  Y  G+ G  A   +G
Sbjct: 23  SAQAAD---LGYGYGRGAPYTVNQ----PLNAYSWAGPYLGGTLGYQWGTVGNSATKPSG 75

Query: 78  --GSIFAGYNVED-SCIMYGVEGDVRYT------VPVLADNIHSLHGIGGSLRIRGGYEV 128
             G + AGYN ++ S  + G+EGD+  +       P    N        G+LR R GY  
Sbjct: 76  LVGGVTAGYNWQNGSPWVLGIEGDINLSGANDTFAPWKFSNPWF-----GTLRGRVGYAF 130

Query: 129 SDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEY 182
           ++ L            + ET    E +  A+G T GVG E  GL+++  A++EY
Sbjct: 131 NNILFYGTGGLALGGLRAETFGLSE-SHTAVGWTLGVGTEF-GLAQNWTAKIEY 182


>gi|256809513|gb|ACV30857.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
          Length = 130

 Score = 43.9 bits (102), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 43/141 (30%), Positives = 66/141 (46%), Gaps = 23/141 (16%)

Query: 10  VSSLALASF-CSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSF 68
           ++S AL  F  +A AAD ++          P  A     P ++ + G Y GL   Y G  
Sbjct: 2   IASAALLPFSATAFAADAIQEQP-------PVPAPVEMAP-QYSWAGGYTGL---YLGYG 50

Query: 69  GEEAHHNAGGSI---------FAGYNVEDSCIMYGVEGDVRYTVPVLA-DNIHSLHGIGG 118
             +A  +A G+I         +AG+N +    +YGVEGD  Y+    + D +    G  G
Sbjct: 51  WNKAKTDAVGTIKPDDMKAGAYAGWNFQQDQFVYGVEGDAGYSWAKKSKDGLEVKQGFEG 110

Query: 119 SLRIRGGYEVSDSLLLYATVG 139
           SLR R GY++ + ++ Y T G
Sbjct: 111 SLRARLGYDL-NPVMPYITAG 130


>gi|190891678|ref|YP_001978220.1| outer membrane protein [Rhizobium etli CIAT 652]
 gi|218510868|ref|ZP_03508746.1| outer membrane protein [Rhizobium etli Brasil 5]
 gi|190696957|gb|ACE91042.1| outer membrane protein [Rhizobium etli CIAT 652]
          Length = 207

 Score = 43.9 bits (102), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 62/225 (27%), Positives = 100/225 (44%), Gaps = 45/225 (20%)

Query: 6   LAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL---SA 62
           L +  + LAL +  +A AAD V+         VPT A     P+   ++GPY G+   + 
Sbjct: 3   LTIATAFLALVA-TTAFAADVVQD--------VPT-APVAAAPV-FTWSGPYFGIDGGAG 51

Query: 63  LYNGSF---GEEAHHNAGGSIF---AGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGI 116
             NG F   G  A  +  G +F   AGYN +   I+ G+EG++ +       N +    +
Sbjct: 52  WLNGDFSAGGASADEDFNGGVFGAFAGYNFQFDNIVVGIEGNIEH-------NWNEEDAL 104

Query: 117 G--------GSLRIRGGYEVSDSLLLYATVGPDVAQKY-ETGKAGEITPIAIGGTAGVGV 167
           G        G++R R GY   D  L+Y   G    + Y +     + T    G T G GV
Sbjct: 105 GADVGTDWAGAVRGRVGYAF-DKALIYGAAGWAATRGYVDAPGFDKETETFNGYTVGAGV 163

Query: 168 EVGGLSESLVARLEYRASKYSK-------VEGFYNTISLGVGMKF 205
           +   ++ ++ AR EYR + Y +       V+   + +  G+G+KF
Sbjct: 164 DF-AITNNIFARGEYRYNDYGEKDILGVDVDLDQHELKFGIGVKF 207


>gi|222102056|ref|YP_002546646.1| hypothetical protein Arad_12130 [Agrobacterium radiobacter K84]
 gi|221728173|gb|ACM31182.1| conserved hypothetical protein [Agrobacterium radiobacter K84]
          Length = 205

 Score = 43.5 bits (101), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 36/109 (33%), Positives = 50/109 (45%), Gaps = 4/109 (3%)

Query: 83  GYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDV 142
           GYN +   I+YG+E D  Y       N   L     S R R GY +  +LL         
Sbjct: 78  GYNFQTGNIIYGIENDFNYNFD--KGNKADLQ-WDASGRARVGYALDRTLLFATAGLAAA 134

Query: 143 AQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVE 191
             K +    G+   I IG TAG GVE   L+++++ R EYR S + K +
Sbjct: 135 GGKVDAPAIGKKDDILIGWTAGAGVER-ALTDNILIRGEYRYSDFGKKD 182


>gi|27382580|ref|NP_774109.1| outer-membrane immunogenic protein [Bradyrhizobium japonicum USDA
           110]
 gi|27355752|dbj|BAC52734.1| bll7469 [Bradyrhizobium japonicum USDA 110]
          Length = 208

 Score = 43.5 bits (101), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 44/139 (31%), Positives = 65/139 (46%), Gaps = 12/139 (8%)

Query: 51  HDFNGPYAGLSALYN-GSFGEEAHHNAG--GSIFAGYNVEDSCIMYGVEGDVRYTVPVLA 107
           + + GPY G +  Y  GS        +G  G I AGYN ++   ++GVEGD++      A
Sbjct: 43  YSWAGPYLGGNIGYEWGSVDNNPSKPSGFVGGIQAGYNFQNGPWVFGVEGDIQ---AAGA 99

Query: 108 DNIHSLHGIG----GSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTA 163
           D+  +         G+LR R GY  S+ +L Y T G    +          +  + G T 
Sbjct: 100 DDTFAPWKFSNPWFGTLRGRVGYAFSN-VLFYGTAGLAFGELRAQTFGWTESHTSAGWTI 158

Query: 164 GVGVEVGGLSESLVARLEY 182
           G G EV GL+ +  A+LEY
Sbjct: 159 GAGAEV-GLAPNWSAKLEY 176


>gi|256809485|gb|ACV30843.1| 25 kDa outer membrane protein [Ochrobactrum cytisi]
          Length = 130

 Score = 42.7 bits (99), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 42/141 (29%), Positives = 64/141 (45%), Gaps = 23/141 (16%)

Query: 10  VSSLALASF-CSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSF 68
           ++S AL  F  +A AAD ++          P  A     P ++ + G Y GL   Y G  
Sbjct: 2   IASAALLPFSATAFAADAIQEQP-------PVPAPVEMAP-QYSWAGGYTGL---YLGYG 50

Query: 69  GEEAHHNAGGSI---------FAGYNVEDSCIMYGVEGDVRYT-VPVLADNIHSLHGIGG 118
             +A  +  G+I         +AG+N +    +YGVEGD  Y+      D +    G  G
Sbjct: 51  WNKAKTDTVGTIKPDDMKAGAYAGWNFQQDQFVYGVEGDAGYSWAKKTKDGLEVKQGFEG 110

Query: 119 SLRIRGGYEVSDSLLLYATVG 139
           SLR R GY++ + ++ Y T G
Sbjct: 111 SLRARLGYDL-NPVMPYITAG 130


>gi|254470094|ref|ZP_05083498.1| outer membrane protein [Pseudovibrio sp. JE062]
 gi|211960405|gb|EEA95601.1| outer membrane protein [Pseudovibrio sp. JE062]
          Length = 221

 Score = 42.4 bits (98), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 48/179 (26%), Positives = 77/179 (43%), Gaps = 27/179 (15%)

Query: 51  HDFNGPYAGLSALY-----NGSFG-----EEAHHNAGGSIFAGYN--VEDSCIMYGVEGD 98
           +D++G Y G +A +     +G  G     ++  +     + AGYN  V  S ++ G E D
Sbjct: 46  YDWSGAYIGANAGWGFLSADGKSGASGALDDDQNGVTAGVHAGYNFMVAPSVVL-GAEAD 104

Query: 99  VRYT-VPVLADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPI 157
           ++Y  +   +  +        ++R R GY + D  L+Y T G           AG+    
Sbjct: 105 IQYNDLEEKSAGVELQSDWNATVRARAGYAL-DRTLVYGTGGAAFKDLTAKSSAGKDEKT 163

Query: 158 AIGGTAGVGVEVGGLSESLVARLEYRASKY-----------SKVEGFYNTISLGVGMKF 205
           AIG   G GVE   ++++L ARLEY    +            K +   N +  GV MKF
Sbjct: 164 AIGYVVGAGVE-HAVTDTLTARLEYLYQDFGDQKFDFGGTTEKTKIDENLVRAGVSMKF 221


>gi|319783284|ref|YP_004142760.1| OmpA-like transmembrane domain-containing protein [Mesorhizobium
           ciceri biovar biserrulae WSM1271]
 gi|317169172|gb|ADV12710.1| OmpA-like transmembrane domain-containing protein [Mesorhizobium
           ciceri biovar biserrulae WSM1271]
          Length = 217

 Score = 42.4 bits (98), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 44/157 (28%), Positives = 73/157 (46%), Gaps = 22/157 (14%)

Query: 53  FNGPYAGLSA--------LYNGSFGEEAHHNAGGSI---FAGYNVEDSCIMYGVEGDV-- 99
           + GPYAG+          +Y       A HN G +    FAGYN++   I+YGVEG++  
Sbjct: 34  WQGPYAGVFGAGTLEHYKIYGPGAQAGATHNVGSATVGGFAGYNLQSGKIVYGVEGELGY 93

Query: 100 RYTVPVLAD-----NIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVA--QKYETGKAG 152
           R+      D      + +  G+ GS++ R G ++  + + + T G   A  + +  G   
Sbjct: 94  RFKKNTFDDIPGPGVLDASTGLFGSVKGRVGMDMG-AYMPFVTAGVTAAKLKTFYPGGNA 152

Query: 153 EITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSK 189
           E     +GG  G G++V  L+ ++  R EY  S + K
Sbjct: 153 ERDATLVGGVVGAGIDV-ALTHNVFLRGEYDFSFFGK 188


>gi|256809411|gb|ACV30806.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
          Length = 130

 Score = 42.4 bits (98), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 41/141 (29%), Positives = 64/141 (45%), Gaps = 23/141 (16%)

Query: 10  VSSLALASF-CSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSF 68
           ++S AL  F  +A AAD ++          P  A     P ++ + G Y GL   Y G  
Sbjct: 2   IASAALLPFSATAFAADAIQEQP-------PVPAPVEMAP-QYSWAGGYTGL---YLGYG 50

Query: 69  GEEAHHNAGGSI---------FAGYNVEDSCIMYGVEGDVRYT-VPVLADNIHSLHGIGG 118
             +A  +  G++         +AG+N +    +YGVEGD  Y+      D +    G  G
Sbjct: 51  WNKAKTDTVGTVKPDDMKAGAYAGWNFQQDQFVYGVEGDAGYSWAKKTKDGLEVKQGFEG 110

Query: 119 SLRIRGGYEVSDSLLLYATVG 139
           SLR R GY++ + ++ Y T G
Sbjct: 111 SLRARLGYDL-NPIMPYITAG 130


>gi|256809401|gb|ACV30801.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809403|gb|ACV30802.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809405|gb|ACV30803.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809407|gb|ACV30804.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809409|gb|ACV30805.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809413|gb|ACV30807.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809415|gb|ACV30808.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809417|gb|ACV30809.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809419|gb|ACV30810.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809421|gb|ACV30811.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809423|gb|ACV30812.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809425|gb|ACV30813.1| 25 kDa outer membrane protein [Ochrobactrum lupini]
 gi|256809427|gb|ACV30814.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809447|gb|ACV30824.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809449|gb|ACV30825.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809451|gb|ACV30826.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809453|gb|ACV30827.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809455|gb|ACV30828.1| 25 kDa outer membrane protein [Ochrobactrum anthropi ATCC 49188]
 gi|256809457|gb|ACV30829.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809459|gb|ACV30830.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809461|gb|ACV30831.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809463|gb|ACV30832.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809465|gb|ACV30833.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809467|gb|ACV30834.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809469|gb|ACV30835.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809471|gb|ACV30836.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809473|gb|ACV30837.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809475|gb|ACV30838.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809477|gb|ACV30839.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809479|gb|ACV30840.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809481|gb|ACV30841.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809483|gb|ACV30842.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809487|gb|ACV30844.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809489|gb|ACV30845.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809491|gb|ACV30846.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809493|gb|ACV30847.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809495|gb|ACV30848.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809497|gb|ACV30849.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809499|gb|ACV30850.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809501|gb|ACV30851.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809503|gb|ACV30852.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809505|gb|ACV30853.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809507|gb|ACV30854.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809509|gb|ACV30855.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809511|gb|ACV30856.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809515|gb|ACV30858.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809517|gb|ACV30859.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809523|gb|ACV30862.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809527|gb|ACV30864.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809529|gb|ACV30865.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809531|gb|ACV30866.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809533|gb|ACV30867.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809535|gb|ACV30868.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
          Length = 130

 Score = 42.0 bits (97), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 41/141 (29%), Positives = 64/141 (45%), Gaps = 23/141 (16%)

Query: 10  VSSLALASF-CSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSF 68
           ++S AL  F  +A AAD ++          P  A     P ++ + G Y GL   Y G  
Sbjct: 2   IASAALLPFSATAFAADAIQEQP-------PVPAPVEMAP-QYSWAGGYTGL---YLGYG 50

Query: 69  GEEAHHNAGGSI---------FAGYNVEDSCIMYGVEGDVRYT-VPVLADNIHSLHGIGG 118
             +A  +  G++         +AG+N +    +YGVEGD  Y+      D +    G  G
Sbjct: 51  WNKAKTDTVGTVKPDDMKAGAYAGWNFQQDQFVYGVEGDAGYSWAKKTKDGLEVKQGFEG 110

Query: 119 SLRIRGGYEVSDSLLLYATVG 139
           SLR R GY++ + ++ Y T G
Sbjct: 111 SLRARLGYDL-NPVMPYITAG 130


>gi|90419513|ref|ZP_01227423.1| OmpA-like transmembrane domain [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90336450|gb|EAS50191.1| OmpA-like transmembrane domain [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 223

 Score = 42.0 bits (97), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 50/177 (28%), Positives = 77/177 (43%), Gaps = 26/177 (14%)

Query: 53  FNGPYAGLSALYNGS-FGEEAHHNAGGS-----IFAGYNVEDSCIMYGVEGDV------- 99
           ++G YAG    YN S F +    +  G      ++ GYN +    ++G+E D+       
Sbjct: 49  WSGAYAGAFVGYNTSNFDQSTGASFDGDGFVGGVYTGYNWQADQFVFGLEADLGGSDVDA 108

Query: 100 RYTVPVLADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAI 159
             T       + +   I GS R R G  V D  L++AT G   A+   +      +  +I
Sbjct: 109 SGTNAATGAQLDADSNIFGSFRARVGVAV-DPFLVFATGGLAAARNELSLNGFSDSQTSI 167

Query: 160 GGTAGVGVEVGGLSESLVARLEYRASKY----------SKVEGF-YNTISLGVGMKF 205
           G T G GVE   +S+ +  RLEYR S +          S   GF  ++I  G+ +KF
Sbjct: 168 GYTLGAGVEA-RVSDDVTTRLEYRYSDFGSETYDLGNTSVSSGFDEHSIRAGIALKF 223


>gi|256809429|gb|ACV30815.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809431|gb|ACV30816.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809433|gb|ACV30817.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809435|gb|ACV30818.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809437|gb|ACV30819.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809439|gb|ACV30820.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809441|gb|ACV30821.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809443|gb|ACV30822.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809445|gb|ACV30823.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809519|gb|ACV30860.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809521|gb|ACV30861.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809525|gb|ACV30863.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809539|gb|ACV30870.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
          Length = 130

 Score = 41.6 bits (96), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 38/138 (27%), Positives = 61/138 (44%), Gaps = 17/138 (12%)

Query: 10  VSSLALASF-CSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL------SA 62
           ++S AL  F  +A AAD ++          P  A     P ++ + G Y GL      + 
Sbjct: 2   IASAALLPFSATAFAADAIQEQP-------PVPAPVEMAP-QYSWAGGYTGLYLGYGWNK 53

Query: 63  LYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYT-VPVLADNIHSLHGIGGSLR 121
           +   + G     +     +AG+N +    +YGVEGD  Y+      D +    G  GSLR
Sbjct: 54  VKTDTVGTVKPDDMKAGAYAGWNFQQDQFVYGVEGDAGYSWAKKTKDGLEVKQGFEGSLR 113

Query: 122 IRGGYEVSDSLLLYATVG 139
            R GY++ + ++ Y T G
Sbjct: 114 ARLGYDL-NPVMPYITAG 130


>gi|218678361|ref|ZP_03526258.1| outer membrane protein [Rhizobium etli CIAT 894]
          Length = 96

 Score = 41.6 bits (96), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 37/66 (56%), Gaps = 4/66 (6%)

Query: 38 VPTIATNRYVPIRH--DFNGPYAGLSALYN-GSFGEEAH-HNAGGSIFAGYNVEDSCIMY 93
          +P     +  P++   ++ G Y G +  YN GSFG + H +  GG +F GYN +   I+Y
Sbjct: 30 IPEAPVAQDAPVKPAGNWEGFYLGGAGTYNMGSFGSDRHTYGFGGQVFTGYNWQQGQIVY 89

Query: 94 GVEGDV 99
          GVE D+
Sbjct: 90 GVESDL 95


>gi|150395644|ref|YP_001326111.1| porin [Sinorhizobium medicae WSM419]
 gi|150027159|gb|ABR59276.1| porin [Sinorhizobium medicae WSM419]
          Length = 225

 Score = 41.6 bits (96), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 59/207 (28%), Positives = 83/207 (40%), Gaps = 42/207 (20%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAG- 59
           M++ FL+    + AL+   +A  A PV           P I+     P   D+NG Y G 
Sbjct: 1   MKRYFLSAAFLAGALSPVVAADLA-PVESP--------PAIS----APAAFDWNGFYLGG 47

Query: 60  --------LSALYNGSFGEEAHHNAG---GSIFAGYNVEDSCIMYGVEGDV-------RY 101
                   +   Y   FGE AHH+     G + AGYN +    + G E D          
Sbjct: 48  NVGGGRADVDWTYQ-PFGETAHHDGKGFLGGVQAGYNWQIDGFVIGAEADFLGSSIDGDT 106

Query: 102 TVPVLADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYE------TGKAGEIT 155
             P  A +  S      ++R R GY   D+LL+YAT G  +  ++E       G +G   
Sbjct: 107 PCPNPAYSCTSDTKWLSTVRARAGYSF-DNLLVYATGGLGIG-RFEIKTDDGAGTSGSTI 164

Query: 156 PIAIGGTAGVGVEVGGLSESLVARLEY 182
               G  AG GVE  G S +   + EY
Sbjct: 165 RNDTGWVAGAGVEY-GFSPNWSIKAEY 190


>gi|327189607|gb|EGE56759.1| outer membrane protein [Rhizobium etli CNPAF512]
          Length = 207

 Score = 41.2 bits (95), Expect = 0.085,   Method: Compositional matrix adjust.
 Identities = 47/173 (27%), Positives = 80/173 (46%), Gaps = 24/173 (13%)

Query: 53  FNGPYAGL---SALYNGSF---GEEAHHNAGGSIF---AGYNVEDSCIMYGVEGDVRYTV 103
           ++GPY G+   +   NG F   G  A  +  G +F   AGYN +   I+ G+EG++ +  
Sbjct: 39  WSGPYFGIDGGAGWLNGDFSAGGASADEDFNGGVFGAFAGYNFQFDNIVVGIEGNIEHNW 98

Query: 104 ---PVLADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKY-ETGKAGEITPIAI 159
                L  ++ +     G++R R GY   D  L+Y   G    + Y +     + T    
Sbjct: 99  NEEDALGADVGT--DWAGAVRGRVGYAF-DKALIYGAAGWAATRGYVDAPGFDKETETFN 155

Query: 160 GGTAGVGVEVGGLSESLVARLEYRASKYSK-------VEGFYNTISLGVGMKF 205
           G T G GV+   ++ ++ AR EYR + Y +       V+   + +  G+G+KF
Sbjct: 156 GYTVGAGVDF-AITNNIFARGEYRYNDYGEKDILGVDVDLDQHELKFGIGVKF 207


>gi|328542837|ref|YP_004302946.1| OmpA-like transmembrane domain [polymorphum gilvum SL003B-26A1]
 gi|326412583|gb|ADZ69646.1| OmpA-like transmembrane domain, putative [Polymorphum gilvum
           SL003B-26A1]
          Length = 223

 Score = 40.8 bits (94), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 58/201 (28%), Positives = 86/201 (42%), Gaps = 34/201 (16%)

Query: 3   KLFLAVGVSSLALA-SFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAG-- 59
           K   A GVS   LA +   A AAD  + A        P I  N+    R D++G Y G  
Sbjct: 2   KSLAAAGVSIAVLAGASLPAFAADLPQPAQ-------PVIYDNQVSSARFDWSGFYFGGN 54

Query: 60  ---------LSALYNGSFGEEAHHNAGGSIFAGYN-VEDSCIMYGVEGDVRYTVPVLADN 109
                     ++   G F  +A    GG + AGYN      I+ G+E D + +     + 
Sbjct: 55  LGWGWGQFTTNSALTGRFNSDASGVNGG-VHAGYNHAITPNIIAGLEADFQLSD---LEK 110

Query: 110 IHSLHGIG--------GSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGG 161
             S+ G+G         ++R R GY   D  ++Y T G  +A         +    AIG 
Sbjct: 111 RRSVAGVGVKTSSDWNSTIRGRLGYAF-DRFMIYGTGGLAIADLEVAAAGSKGNETAIGW 169

Query: 162 TAGVGVEVGGLSESLVARLEY 182
           T G G+E G +++++ ARLEY
Sbjct: 170 TLGAGIE-GAVTDNVTARLEY 189


>gi|148253259|ref|YP_001237844.1| putative outer membrane protein [Bradyrhizobium sp. BTAi1]
 gi|146405432|gb|ABQ33938.1| putative outer membrane protein precursor [Bradyrhizobium sp.
           BTAi1]
          Length = 206

 Score = 40.8 bits (94), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 53/175 (30%), Positives = 80/175 (45%), Gaps = 28/175 (16%)

Query: 19  CSAQAADPVRRAHHGGRGVVPTIATNRYVPIR-HDFNGPYAGLSALYN-GSFGEEAHHNA 76
            SAQAAD      + GR    T+      P+  + + GPY G +  Y  GS G      +
Sbjct: 17  VSAQAAD-----FNYGRQAPYTVNQ----PLNAYSWAGPYLGGTLGYEWGSVGNNPTKPS 67

Query: 77  G--GSIFAGYNVEDSCIMYGVEGDVRYT------VPVLADNIHSLHGIGGSLRIRGGYEV 128
           G  G + AGYN ++   ++G EGD+  T       P    N        G++R R GY  
Sbjct: 68  GLVGGLTAGYNWQNGPWVFGAEGDINLTGANDTFAPWKFSNPWF-----GTVRGRAGYAF 122

Query: 129 SDSLLLYATVGPDV-AQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEY 182
            +++L Y T G      + ET    E +  ++G T G G E  GL+++  A++EY
Sbjct: 123 -NNILFYGTGGLAFGGLRGETFGLSE-SHTSLGWTLGAGAEF-GLAQNWTAKIEY 174


>gi|256809537|gb|ACV30869.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
          Length = 130

 Score = 40.4 bits (93), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 28/91 (30%), Positives = 44/91 (48%), Gaps = 11/91 (12%)

Query: 59  GLSALYNGSFGEEAHHNAGGSI---------FAGYNVEDSCIMYGVEGDVRYT-VPVLAD 108
           G + LY G    +A  +  G++         +AG+N +    +YGVEGD  Y+      D
Sbjct: 41  GYTGLYLGYGWNKAKTDTVGTVKPDDMKAGAYAGWNFQQDQFVYGVEGDAGYSWAKKTKD 100

Query: 109 NIHSLHGIGGSLRIRGGYEVSDSLLLYATVG 139
            +    G  GSLR R GY++ + ++ Y T G
Sbjct: 101 GLEVKQGFEGSLRARLGYDL-NPVMPYITAG 130


>gi|91975762|ref|YP_568421.1| putative outer membrane protein [Rhodopseudomonas palustris BisB5]
 gi|91682218|gb|ABE38520.1| putative outer membrane protein [Rhodopseudomonas palustris BisB5]
          Length = 207

 Score = 40.4 bits (93), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 33/109 (30%), Positives = 54/109 (49%), Gaps = 9/109 (8%)

Query: 78  GSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIG----GSLRIRGGYEVSDSLL 133
           G +  GYN +   I++G+EGD++++    AD+  + +       G+ R R GY ++D LL
Sbjct: 72  GGVQGGYNWQSGNIVFGLEGDIQFST---ADDTFAPYKFSNPWFGTARGRVGYAMND-LL 127

Query: 134 LYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEY 182
           +YAT G    Q          +  + G T G G E    +  L A++EY
Sbjct: 128 IYATGGFAFGQLKGERLLSTESHSSAGWTVGAGAEF-AFAPKLSAKVEY 175


>gi|182677110|ref|YP_001831256.1| porin [Beijerinckia indica subsp. indica ATCC 9039]
 gi|182632993|gb|ACB93767.1| porin [Beijerinckia indica subsp. indica ATCC 9039]
          Length = 244

 Score = 40.0 bits (92), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 38/131 (29%), Positives = 59/131 (45%), Gaps = 16/131 (12%)

Query: 83  GYNVEDSCIMYGVEGDVRYTV-------PVLADNIHSLHGIGGSLRIRGGYEVSDSLLLY 135
           G+N + S  + G EGDV  +        PV    + S   + GSLR R G    D +L+Y
Sbjct: 84  GFNYQVSQFIVGFEGDVNGSSYSGSVFNPVFRTQLTSRIPVDGSLRGRIG-AAWDRVLVY 142

Query: 136 ATVGPDVAQKYE-------TGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYS 188
           AT G   A              +  +T   +G T G GVE   ++++   R++YR + Y 
Sbjct: 143 ATGGAAFASIKHGYIGSSLVPGSATLTNDRVGWTVGGGVEY-AMTDNWSVRVDYRYTDYG 201

Query: 189 KVEGFYNTISL 199
            +  F  TI++
Sbjct: 202 NISDFPGTITV 212


>gi|218461202|ref|ZP_03501293.1| outer membrane protein [Rhizobium etli Kim 5]
 gi|218658675|ref|ZP_03514605.1| outer membrane protein [Rhizobium etli IE4771]
          Length = 207

 Score = 40.0 bits (92), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 48/178 (26%), Positives = 80/178 (44%), Gaps = 34/178 (19%)

Query: 53  FNGPYAGL---SALYNGSF---GEEAHHNAGGSIF---AGYNVEDSCIMYGVEGDVRYTV 103
           ++GPY G+   +A  NG F   G  A  +  G +F   AGYN +    + G+EG++ +  
Sbjct: 39  WSGPYFGIDGGAAWLNGDFSAGGASASEDFNGGVFGGFAGYNFQFDNFVVGIEGNLEH-- 96

Query: 104 PVLADNIHSLHGIG--------GSLRIRGGYEVSDSLLLYATVGPDVAQKY-ETGKAGEI 154
                N +    +G        G++R R GY   D  L+Y   G    + Y +     + 
Sbjct: 97  -----NWNEEDALGAEVGTDWAGAVRGRVGYAF-DKALIYGAAGWAATRGYVDAPGFDKE 150

Query: 155 TPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSK-------VEGFYNTISLGVGMKF 205
           T    G T G GV+   ++ ++ AR EYR + Y +       V+   + +  G+G+KF
Sbjct: 151 TETFNGYTVGAGVDF-AITNNIFARGEYRYNDYGEQDILGVDVDLDQHELKFGIGVKF 207


>gi|316932716|ref|YP_004107698.1| putative outer-membrane immunogenic protein [Rhodopseudomonas
           palustris DX-1]
 gi|315600430|gb|ADU42965.1| putative outer-membrane immunogenic protein precursor
           [Rhodopseudomonas palustris DX-1]
          Length = 207

 Score = 39.7 bits (91), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 33/109 (30%), Positives = 55/109 (50%), Gaps = 9/109 (8%)

Query: 78  GSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIG----GSLRIRGGYEVSDSLL 133
           G +  GYN +   I++G+EGD++++    AD+  + +       G+ R R GY ++D +L
Sbjct: 72  GGLQGGYNWQSGNIVFGLEGDIQFST---ADDTFAPYKFSNPWFGTGRGRIGYAMND-VL 127

Query: 134 LYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEY 182
           +YAT G    Q      A   +  + G T G G E    +  L A++EY
Sbjct: 128 IYATGGLAFGQLKGQNLAVSESHSSAGWTVGAGAEF-AFAPKLSAKVEY 175


>gi|192289773|ref|YP_001990378.1| outer-membrane immunogenic protein precursor [Rhodopseudomonas
           palustris TIE-1]
 gi|192283522|gb|ACE99902.1| putative outer-membrane immunogenic protein precursor
           [Rhodopseudomonas palustris TIE-1]
          Length = 207

 Score = 39.7 bits (91), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 32/109 (29%), Positives = 54/109 (49%), Gaps = 9/109 (8%)

Query: 78  GSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIG----GSLRIRGGYEVSDSLL 133
           G +  GYN +   I++G+EGD++++    AD+  + +       G+ R R GY ++D +L
Sbjct: 72  GGVQGGYNWQSGNIVFGLEGDIQFST---ADDTFAQYKFSNPWFGTGRGRIGYAMND-VL 127

Query: 134 LYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEY 182
           +YAT G    Q          +  + G T G G E    +  L A++EY
Sbjct: 128 IYATGGLAFGQLKGQNVFASESHSSAGWTVGAGAEF-AFAPKLSAKVEY 175


>gi|86748303|ref|YP_484799.1| outer membrane protein [Rhodopseudomonas palustris HaA2]
 gi|86571331|gb|ABD05888.1| outer membrane protein [Rhodopseudomonas palustris HaA2]
          Length = 207

 Score = 39.3 bits (90), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 32/109 (29%), Positives = 54/109 (49%), Gaps = 9/109 (8%)

Query: 78  GSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIG----GSLRIRGGYEVSDSLL 133
           G +  GYN +   I++G+EGD++++    A++  + +       G+ R R GY ++D +L
Sbjct: 72  GGVQGGYNWQSGNIVFGLEGDIQFST---ANDTFASYKFSNPWFGTARGRVGYAMND-IL 127

Query: 134 LYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEY 182
           LYAT G    Q          +  + G T G G E    +  L A++EY
Sbjct: 128 LYATGGLAFGQLKGEYLLSSESHTSAGWTVGAGAEF-AFAPKLSAKVEY 175


>gi|153007478|ref|YP_001368693.1| porin [Ochrobactrum anthropi ATCC 49188]
 gi|151559366|gb|ABS12864.1| porin [Ochrobactrum anthropi ATCC 49188]
          Length = 229

 Score = 39.3 bits (90), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 46/166 (27%), Positives = 71/166 (42%), Gaps = 29/166 (17%)

Query: 67  SFGEEAHHNAGGSIFAGYNVE-DSCIMYGVEGDVRYT-----VPVLADNI-----HSLHG 115
           SFG        G I+AGYN +  + I+ G++GDV Y      + V + ++      +   
Sbjct: 66  SFGNVKPDGFLGGIYAGYNFDLGNSIVLGIDGDVTYNDVSKDIDVYSGDLAVGDFETKLR 125

Query: 116 IGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEI-----TPIAIGGTAGVGVEVG 170
             G++R R GY V D  + Y   G        +G    I     +    G TAG GV+  
Sbjct: 126 WSGAVRARVGYAV-DRFMPYLAGGVAFGNIKNSGSIDGIGSFSESKTLTGWTAGAGVDYA 184

Query: 171 GLSESLVARLEYRASKYSKVEGFY-----------NTISLGVGMKF 205
             +++L+ RLEYR + Y   +  +           N + LGV  KF
Sbjct: 185 A-TDNLIVRLEYRYTDYGDKDIEFGGLNVNQDFKTNEVRLGVAYKF 229


>gi|39934247|ref|NP_946523.1| outer membrane protein [Rhodopseudomonas palustris CGA009]
 gi|39648095|emb|CAE26615.1| possible outer membrane protein [Rhodopseudomonas palustris CGA009]
          Length = 226

 Score = 39.3 bits (90), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 32/109 (29%), Positives = 54/109 (49%), Gaps = 9/109 (8%)

Query: 78  GSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIG----GSLRIRGGYEVSDSLL 133
           G +  GYN +   I++G+EGD++++    AD+  + +       G+ R R GY ++D +L
Sbjct: 91  GGVQGGYNWQSGNIVFGLEGDIQFST---ADDTFAQYKFSNPWFGTGRGRIGYAMND-VL 146

Query: 134 LYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEY 182
           +YAT G    Q          +  + G T G G E    +  L A++EY
Sbjct: 147 IYATGGLAFGQLKGQNVFASESHSSAGWTVGAGAEF-AFAPKLSAKVEY 194


>gi|85716040|ref|ZP_01047017.1| putative outer-membrane immunogenic protein precursor [Nitrobacter
           sp. Nb-311A]
 gi|85697238|gb|EAQ35119.1| putative outer-membrane immunogenic protein precursor [Nitrobacter
           sp. Nb-311A]
          Length = 206

 Score = 38.9 bits (89), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 55/191 (28%), Positives = 88/191 (46%), Gaps = 26/191 (13%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIR-HDFNGPYAG 59
           M K  +A   +  + A   +AQAAD   RA +           N+  P+    + GPY G
Sbjct: 1   MSKTLIAALATMASTALIGTAQAADFSYRAPY---------TVNQ--PLNAFSWAGPYLG 49

Query: 60  LSALYN-GSFGEEAHHNAG--GSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGI 116
            +  Y  GS         G  G + AGYN +   +++G+EGD++      A++  +    
Sbjct: 50  GNLGYAWGSVQNSLTKPDGVFGGVQAGYNWQSGSMVFGLEGDIQANA---ANDTFAAWKF 106

Query: 117 G----GSLRIRGGYEVSDSLLLYATVGPDVAQ-KYETGKAGEITPIAIGGTAGVGVEVGG 171
                G++R R GY  S+ +L+Y T G    + + ET    E +    G T GVG EV G
Sbjct: 107 SNPWFGTVRGRLGYAFSN-VLVYGTGGLAFGKLRAETFALSE-SHTNAGWTVGVGAEV-G 163

Query: 172 LSESLVARLEY 182
           + ++  A++EY
Sbjct: 164 IYQNWTAKVEY 174


>gi|92118614|ref|YP_578343.1| putative outer-membrane immunogenic protein precursor [Nitrobacter
           hamburgensis X14]
 gi|91801508|gb|ABE63883.1| putative outer-membrane immunogenic protein precursor [Nitrobacter
           hamburgensis X14]
          Length = 206

 Score = 38.1 bits (87), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 52/172 (30%), Positives = 83/172 (48%), Gaps = 26/172 (15%)

Query: 20  SAQAADPVRRAHHGGRGVVPTIATNRYVPIR-HDFNGPYAGLSALY-NGSFGEEAHHNAG 77
           +AQAAD   R+ +           N+  P+  + + GPY G +  Y  GS    A    G
Sbjct: 20  TAQAADFSYRSPY---------TVNQ--PLNAYSWAGPYLGGNLGYAWGSVQNSATKPNG 68

Query: 78  --GSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIG----GSLRIRGGYEVSDS 131
             G + AGYN +   +++G+EGD++      AD+I +         G++R R GY   ++
Sbjct: 69  VFGGVQAGYNWQSGPLVFGLEGDIQANA---ADDIFARWKFSNPWFGTVRGRLGYAF-NN 124

Query: 132 LLLYATVGPDV-AQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEY 182
           +L+Y T G    A + ET    E +    G T GVG E  G+ ++  A++EY
Sbjct: 125 VLIYGTGGLAFGALRAETFGLSE-SHTNAGWTVGVGAEF-GIYQNWTAKVEY 174


>gi|241518381|ref|YP_002979009.1| porin [Rhizobium leguminosarum bv. trifolii WSM1325]
 gi|240862794|gb|ACS60458.1| porin [Rhizobium leguminosarum bv. trifolii WSM1325]
          Length = 207

 Score = 37.7 bits (86), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 46/178 (25%), Positives = 79/178 (44%), Gaps = 34/178 (19%)

Query: 53  FNGPYAGL---SALYNGSF---GEEAHHNAGGSIFAG---YNVEDSCIMYGVEGDVRYTV 103
           ++GPY G+   +   NG F   G  A  +  G IF G   YN +   I+ G+EG++ +  
Sbjct: 39  WSGPYLGIDGGAGWLNGDFSAGGASASEDFNGGIFGGFVGYNFQFDNIVVGIEGNLEH-- 96

Query: 104 PVLADNIHSLHGIG--------GSLRIRGGYEVSDSLLLYATVGPDVAQKY-ETGKAGEI 154
                N +    +G        G++R R GY   D  L+Y   G    + Y +     + 
Sbjct: 97  -----NWNEEEALGADVGTDWTGAVRGRVGYAF-DKALIYGAAGWTATRGYVDLPGLDKE 150

Query: 155 TPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSK-------VEGFYNTISLGVGMKF 205
           T    G T G G++   ++ ++ AR EYR + + +       V+   + +  G+G+KF
Sbjct: 151 TETFNGYTVGAGLDF-AITNNIFARGEYRYNDFGEKDVLGVDVDLDQHELKFGIGVKF 207


>gi|218517219|ref|ZP_03514059.1| outer membrane protein [Rhizobium etli 8C-3]
          Length = 153

 Score = 37.7 bits (86), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 38/136 (27%), Positives = 64/136 (47%), Gaps = 15/136 (11%)

Query: 81  FAGYNVEDSCIMYGVEGDVRYTV---PVLADNIHSLHGIGGSLRIRGGYEVSDSLLLYAT 137
           FAGYN +   I+ G+EG++ Y       L  ++ +     G++R R GY   D  L+Y  
Sbjct: 22  FAGYNFQFDNIVVGIEGNLEYNWNEEEALGADVGT--DWAGAVRGRVGYAF-DKALIYGA 78

Query: 138 VGPDVAQKY-ETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSK------- 189
            G    + Y +     + T    G T G GV+   ++ ++ AR EYR + Y +       
Sbjct: 79  AGWAATRGYVDAPGFDKETETFNGYTVGAGVDF-AITNNIFARGEYRYNDYGERDILGVD 137

Query: 190 VEGFYNTISLGVGMKF 205
           V+   + +  G+G+KF
Sbjct: 138 VDLDQHELKFGIGVKF 153


>gi|153011627|ref|YP_001372841.1| porin [Ochrobactrum anthropi ATCC 49188]
 gi|151563515|gb|ABS17012.1| porin [Ochrobactrum anthropi ATCC 49188]
          Length = 228

 Score = 37.0 bits (84), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 46/160 (28%), Positives = 69/160 (43%), Gaps = 36/160 (22%)

Query: 78  GSIFAGYNVE-DSCIMYGVEGDVRYTVPVLADNIHSLHG-----------IGGSLRIRGG 125
           G ++AGYN +  +  + GV+GD+ Y    L DN  +  G             G++R R G
Sbjct: 73  GGLYAGYNFDVGNNFILGVDGDITYNN--LKDNYSATDGDIAGDLESKLRWSGAVRARAG 130

Query: 126 YEVSDSLLLYATVGPDVAQKYETGKAGE-ITPIAI-------GGTAGVGVEVGGLSESLV 177
               D  + Y   G        T  A + +  I++       G TAG GV+    +++L+
Sbjct: 131 VAF-DRFMPYIAGGVAFGSVKNTLSATDGVDEISVSQSKTYTGWTAGAGVDYAA-TDNLI 188

Query: 178 ARLEYRASKYSK----------VEGFYNT--ISLGVGMKF 205
            RLEYR + Y K          VE  + T  + LGV  KF
Sbjct: 189 LRLEYRYTDYGKKDFDFGTDVSVEDKFKTHDVRLGVAYKF 228


>gi|217977075|ref|YP_002361222.1| porin [Methylocella silvestris BL2]
 gi|217502451|gb|ACK49860.1| porin [Methylocella silvestris BL2]
          Length = 255

 Score = 36.6 bits (83), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 46/142 (32%), Positives = 64/142 (45%), Gaps = 27/142 (19%)

Query: 67  SFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYT-----------VP---VLADNIHS 112
           +FG   +   GG+   GYN++ +  + G+EG V  T           VP   V   N+H+
Sbjct: 71  NFGNSGNGVIGGA-HVGYNLQLNQFVVGLEGSVDGTSLSKTYSGTAFVPGFGVAGINLHT 129

Query: 113 LHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAI--GGTAGVGVEVG 170
              I GS+R R GY   D +L+YAT G   A      KA   TP +     T  VG  VG
Sbjct: 130 SADIQGSIRGRVGYAW-DRVLVYATGGVAFAGV----KASLSTPFSYDSSSTTKVGWTVG 184

Query: 171 G-----LSESLVARLEYRASKY 187
           G     ++ +   R EYR S +
Sbjct: 185 GGLEYAVTNNWSIRAEYRYSNF 206


>gi|90025228|gb|ABD85117.1| OmpA [Actinobacillus suis H91-0380]
          Length = 373

 Score = 36.6 bits (83), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 58/201 (28%), Positives = 84/201 (41%), Gaps = 30/201 (14%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K  +A+ VS LALAS   AQAA     A+ G +     +    +      FN  Y+  
Sbjct: 1   MKKTVIALAVSGLALASV--AQAAPQQNTAYAGAK-----VGWASFHEGVRQFNDKYSN- 52

Query: 61  SALYNG---SFGEEAHHNAGGSIFAGYNVEDSC-------IMYGVEGDVRYTVPVLADNI 110
            A YN    ++G   +    G +F GY + +         + Y   G VR  V    +  
Sbjct: 53  DARYNSDTTAYGINRNSVTYG-VFGGYQILNQNNFGLAAELGYDYYGRVRGNVGDFREFK 111

Query: 111 HSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQK----YETGKAGEIT----PIAIGGT 162
           HS HG+  +  ++  YEV  +L +Y  VG  V +     Y      E T     +     
Sbjct: 112 HSAHGL--NFALKPSYEVLPNLDVYGKVGVAVVRNDYKFYGAENTNEPTEKFHKLKASTI 169

Query: 163 AGVGVEVGGLSESLVARLEYR 183
            G GVE   L E L AR+EY+
Sbjct: 170 LGAGVEYAILPE-LAARIEYQ 189


>gi|194228056|ref|XP_001914937.1| PREDICTED: similar to Gene model 784, (NCBI) [Equus caballus]
          Length = 1407

 Score = 36.2 bits (82), Expect = 2.5,   Method: Composition-based stats.
 Identities = 35/123 (28%), Positives = 49/123 (39%), Gaps = 18/123 (14%)

Query: 14   ALASFCSAQAADPVRRAHHGGRGVVPTIAT-NRYVPIRHDFNG--PYAGLSALYNGSFGE 70
            A   FC  QA + V     GG G+V T AT    VP+ H+     P    S+     + E
Sbjct: 1028 ATTYFCRVQAVNTVGVGMFGGTGIVTTPATVPAVVPMLHEVENKVPAKLASSCIAIEWEE 1087

Query: 71   EAHHNAGGSIFAGYNVE------------DSCIMYGVEGDVRYTVPVLADNIHSLHGIGG 118
               H   GS   GYNVE              C++  ++ D  Y + + A N + L     
Sbjct: 1088 PDCH---GSPITGYNVEYGDRKLLTVDRVTECLLKNLQPDTTYKIRIQAINHYGLSPFSQ 1144

Query: 119  SLR 121
            S+R
Sbjct: 1145 SIR 1147


>gi|86749266|ref|YP_485762.1| outer membrane protein [Rhodopseudomonas palustris HaA2]
 gi|86572294|gb|ABD06851.1| outer membrane protein [Rhodopseudomonas palustris HaA2]
          Length = 274

 Score = 35.8 bits (81), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 41/138 (29%), Positives = 59/138 (42%), Gaps = 27/138 (19%)

Query: 68  FGEEAHHNAGGSIFAG----YNVEDSCIMYGVEGDVRYT------------VPVLADNIH 111
           FG + +  +GG  FAG    YN +   +++G+EGD  +              P L D   
Sbjct: 96  FGSQKYDTSGG--FAGGVVGYNWQSGAVVFGLEGDYHWADINGTSSVINVGPPNLGDTYS 153

Query: 112 S-LHGIGGSLRIRGGYEVSDSLLLY---ATVGPDVAQKYETGKAGEI--TPIAIGGTAGV 165
           + L G  G ++ R GY    +L      A VG D+  +Y+ G A          G T G 
Sbjct: 154 TKLRGF-GDIKGRLGYAAGPALWFVSGGAAVG-DLQHRYDGGAANTFVQNKTKWGYTVGA 211

Query: 166 GVEVGGLSESLVARLEYR 183
           GVE    + S  A+LEY 
Sbjct: 212 GVEY-MFAPSWSAKLEYN 228


>gi|119476867|ref|ZP_01617148.1| Anaerobic dehydrogenase, typically selenocysteine-containing
           [marine gamma proteobacterium HTCC2143]
 gi|119449674|gb|EAW30911.1| Anaerobic dehydrogenase, typically selenocysteine-containing
           [marine gamma proteobacterium HTCC2143]
          Length = 887

 Score = 35.4 bits (80), Expect = 4.4,   Method: Composition-based stats.
 Identities = 24/63 (38%), Positives = 35/63 (55%), Gaps = 6/63 (9%)

Query: 148 TGKAGEIT--PIAIGG--TAGVGVEVGGLSESLVARLEYRASKYSKVEGFYNT--ISLGV 201
           TGK G++   P +I G   A  G EVGGL+  L A ++Y     + V  F+N+  +S  V
Sbjct: 314 TGKLGKVGAGPFSITGQPNAMGGREVGGLANMLAAHMDYTPDNIATVSEFWNSTAVSQQV 373

Query: 202 GMK 204
           G+K
Sbjct: 374 GLK 376


>gi|46397578|gb|AAS91717.1| OmpA [Bibersteinia trehalosi]
 gi|46397583|gb|AAS91721.1| OmpA [Bibersteinia trehalosi]
          Length = 364

 Score = 35.4 bits (80), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 55/210 (26%), Positives = 78/210 (37%), Gaps = 36/210 (17%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRH---DFNGPY 57
           M+K  +A+ V+  A+AS  +A  A+        G           +    H    FN  Y
Sbjct: 1   MKKSLVALAVAGFAVASANAAPEANSFYVGAKAG-----------WATFHHGVNQFNSKY 49

Query: 58  AGLSALYNGSFGEEAHHNAGG-SIFAGYNVEDSCIM---YGVEGDVRYTV---PVLADNI 110
           A      +G      + N+    +F GY + D+  +   Y   G VR  V       D  
Sbjct: 50  ANDERYSDGPTAYGINRNSVTYGVFGGYQIIDNLAVELGYDYFGRVRGNVGDRRAFKDTK 109

Query: 111 HSLHGIGGSLRIRGGYEVSDSLLLYATVGP-----DVAQKYETGKAGEITPIAIGGTAGV 165
           H  H     + ++  YEV   L LY  VG      D    Y  G   +   +      G 
Sbjct: 110 HGAH-----ISLKPSYEVVSGLDLYGKVGAALVRNDYKDYYANGTKDKSHNLKTSLILGA 164

Query: 166 GVEVGGLSESLVARLEY----RASKYSKVE 191
           GVE   ++ +L ARLEY    RA  Y K E
Sbjct: 165 GVEY-AITPALAARLEYQWLSRAGNYGKAE 193


>gi|75676711|ref|YP_319132.1| putative outer-membrane immunogenic protein precursor [Nitrobacter
           winogradskyi Nb-255]
 gi|74421581|gb|ABA05780.1| putative outer-membrane immunogenic protein precursor [Nitrobacter
           winogradskyi Nb-255]
          Length = 206

 Score = 35.0 bits (79), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 32/110 (29%), Positives = 59/110 (53%), Gaps = 11/110 (10%)

Query: 78  GSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIG----GSLRIRGGYEVSDSLL 133
           G + AG+N +   +++G+EGD++      A++  +         G++R R GY   +++L
Sbjct: 71  GGVQAGFNWQSGPVVFGLEGDIQANA---ANDTFAAWKFSNPWFGTVRGRIGYAF-NNVL 126

Query: 134 LYATVGPDVAQ-KYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEY 182
           +Y T G    + + ET    E +  + G T GVG EV G+ ++  A++EY
Sbjct: 127 VYGTGGLAFGKLRAETFGLSE-SHTSAGWTVGVGAEV-GIYQNWTAKVEY 174


>gi|115522948|ref|YP_779859.1| putative outer-membrane immunogenic protein precursor
           [Rhodopseudomonas palustris BisA53]
 gi|115516895|gb|ABJ04879.1| putative outer-membrane immunogenic protein precursor
           [Rhodopseudomonas palustris BisA53]
          Length = 207

 Score = 34.7 bits (78), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 51/177 (28%), Positives = 83/177 (46%), Gaps = 31/177 (17%)

Query: 19  CSAQAADPVRRAHHGGRGVVPTIATNRYVPIR-HDFNGPYAGLSALYNGSFGEEAHHNAG 77
            SAQAAD        GR   P        P+  + + GPY G +  Y  ++G+  H+N+ 
Sbjct: 17  VSAQAADLSY-----GRSYAPYTVNQ---PLNAYSWAGPYLGGNLGY--AWGD-IHNNSA 65

Query: 78  ------GSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIG----GSLRIRGGYE 127
                 G I  GYN +   ++YG+EGD++ T    A++  + +       G++R R GY 
Sbjct: 66  KPSGLSGGIQGGYNWQSGQMVYGLEGDLQITG---ANDTFAQYKFSNPWFGTVRGRIGYA 122

Query: 128 VSDSLLLYATVGPDVAQKYETGKAGEITP--IAIGGTAGVGVEVGGLSESLVARLEY 182
             ++++ Y T G  +A    T + G ++      G T G G E  GL  +  A++EY
Sbjct: 123 F-NNVMFYGTGG--LAYGELTAEMGGLSQSHTNAGFTVGAGAEF-GLMPNWTAKIEY 175


>gi|296104524|ref|YP_003614670.1| putative outer membrane protein A [Enterobacter cloacae subsp.
           cloacae ATCC 13047]
 gi|295058983|gb|ADF63721.1| putative outer membrane protein A [Enterobacter cloacae subsp.
           cloacae ATCC 13047]
          Length = 204

 Score = 34.7 bits (78), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 34/124 (27%), Positives = 54/124 (43%), Gaps = 26/124 (20%)

Query: 73  HHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHS----LHGIGGSLRIRGGYEV 128
           H N GG ++AGY +        +EG   Y   +     HS    +   G  + ++  Y V
Sbjct: 62  HDNVGGGVYAGYQM---TPWLALEGGYDYLGNMQIKGKHSAGAQMKSQGLQMSLKASYAV 118

Query: 129 SDSLLLYATVG-------PDVA--QKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVAR 179
           +DS  +Y   G        DV+   ++ETG    + P+     A VG E    +++L  R
Sbjct: 119 TDSWDIYGRAGAMAYRAESDVSGHNRFETG----VRPL-----AAVGTEY-AFNKNLAGR 168

Query: 180 LEYR 183
           LEY+
Sbjct: 169 LEYQ 172


>gi|254470997|ref|ZP_05084400.1| outer membrane protein [Pseudovibrio sp. JE062]
 gi|211960139|gb|EEA95336.1| outer membrane protein [Pseudovibrio sp. JE062]
          Length = 201

 Score = 34.7 bits (78), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 49/182 (26%), Positives = 77/182 (42%), Gaps = 37/182 (20%)

Query: 53  FNGPYAGLSALYNGSFGEEAHHNAGGS----------IFAGYNVEDSCIMYGVEGDV--- 99
           ++G Y GL     G FG+    +  GS           F GYN     I+ GVE D+   
Sbjct: 28  WDGFYLGL----KGGFGQLTGKDTLGSKGTLDSGVVGAFGGYNHSFDRIVVGVEADLNAT 83

Query: 100 RYTVPVLADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQ----KYETGKAGEIT 155
            YT    +    S      S  +R GY+     L Y + G  +A+    ++  G+  E T
Sbjct: 84  NYTSVSDSGVSRSRSKWNTSATVRLGYDAG-MFLPYLSAGVGLAEYEVKRFADGQKSENT 142

Query: 156 PIAIGGTAGVGVEVGGLSESLVARLEYRASKYSK------------VEGFYNTISLGVGM 203
            I +    G G+E   ++E++ ARL+Y+  + SK            +EG  + ++LGV  
Sbjct: 143 HIGL--VVGAGLEA-MITENVSARLDYKHMEMSKEKYKFQGFNAFHIEGRQDLVTLGVAY 199

Query: 204 KF 205
            F
Sbjct: 200 NF 201


>gi|217977073|ref|YP_002361220.1| porin [Methylocella silvestris BL2]
 gi|217502449|gb|ACK49858.1| porin [Methylocella silvestris BL2]
          Length = 239

 Score = 34.7 bits (78), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 34/114 (29%), Positives = 53/114 (46%), Gaps = 11/114 (9%)

Query: 83  GYNVEDSCIMYGVEGDVRYT----VPVLADNIHSLH-GIGGSLRIRGGYEVSDSLLLYAT 137
           GYN++ + I+ G+EGDV  T           +++    + GS+R R G+ V D  L Y T
Sbjct: 85  GYNLQFNQIVLGLEGDVEATGVDKTYAFGPTVYTTQIPVQGSIRARFGFAV-DRALFYVT 143

Query: 138 VG---PDVAQKYETGKA-GEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKY 187
            G     V  +Y++      +     G T G G+E   L+ +   R EYR S +
Sbjct: 144 GGAAFASVTNQYQSYLGYNSLNRSFAGWTIGGGLEY-ALTNNWSVRAEYRYSDF 196


Searching..................................................done


Results from round 2




>gi|254780598|ref|YP_003065011.1| outer membrane protein [Candidatus Liberibacter asiaticus str.
           psy62]
 gi|254040275|gb|ACT57071.1| outer membrane protein [Candidatus Liberibacter asiaticus str.
           psy62]
          Length = 205

 Score =  235 bits (599), Expect = 3e-60,   Method: Composition-based stats.
 Identities = 205/205 (100%), Positives = 205/205 (100%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL
Sbjct: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGSL 120
           SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGSL
Sbjct: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGSL 120

Query: 121 RIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARL 180
           RIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARL
Sbjct: 121 RIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARL 180

Query: 181 EYRASKYSKVEGFYNTISLGVGMKF 205
           EYRASKYSKVEGFYNTISLGVGMKF
Sbjct: 181 EYRASKYSKVEGFYNTISLGVGMKF 205


>gi|294852064|ref|ZP_06792737.1| outer-membrane immunogenic protein [Brucella sp. NVSL 07-0026]
 gi|294820653|gb|EFG37652.1| outer-membrane immunogenic protein [Brucella sp. NVSL 07-0026]
          Length = 305

 Score =  229 bits (584), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 64/226 (28%), Positives = 102/226 (45%), Gaps = 34/226 (15%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+ L   V VS+  L    +A AAD ++          P +     V  ++ + G Y GL
Sbjct: 93  MRTLKSLVIVSAALLPFSATAFAADAIQEQ--------PPVPAPVEVAPQYSWAGGYTGL 144

Query: 61  SALYNGSFGEEAHHNAGGSI---------FAGYNVEDSCIMYGVEGDVRYTVPVLA-DNI 110
              Y G    +A  +  GSI         FAG+N +   I+YGVEGD  Y+    + D +
Sbjct: 145 ---YLGYGWNKAKTSTVGSIKPDDWKAGAFAGWNFQQDQIVYGVEGDAGYSWAKKSKDGL 201

Query: 111 HSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVG 170
               G  GSLR R GY++ + ++ Y T G   +Q        + +   +G TAG G+E  
Sbjct: 202 EVKQGFEGSLRARVGYDL-NPVMPYLTAGIAGSQIKLNNGLDDESKFRVGWTAGAGLEA- 259

Query: 171 GLSESLVARLEYRASKYSKV-----------EGFYNTISLGVGMKF 205
            L+++++ R+EYR ++Y              +     I +G+G KF
Sbjct: 260 KLTDNILGRVEYRYTQYGNKNYDLAGTTVRNKLDTQDIRVGIGYKF 305


>gi|297248070|ref|ZP_06931788.1| 25 kDa outer-membrane immunogenic protein [Brucella abortus bv. 5
           str. B3196]
 gi|297175239|gb|EFH34586.1| 25 kDa outer-membrane immunogenic protein [Brucella abortus bv. 5
           str. B3196]
          Length = 305

 Score =  229 bits (583), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 64/226 (28%), Positives = 102/226 (45%), Gaps = 34/226 (15%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+ L   V VS+  L    +A AAD ++          P +     V  ++ + G Y GL
Sbjct: 93  MRTLKSLVIVSAALLPFSATAFAADAIQEQ--------PPVPAPVEVAPQYSWAGGYTGL 144

Query: 61  SALYNGSFGEEAHHNAGGSI---------FAGYNVEDSCIMYGVEGDVRYTVPVLA-DNI 110
              Y G    +A  +  GSI         FAG+N +   I+YGVEGD  Y+    + D +
Sbjct: 145 ---YLGYGWNKAKTSTVGSIKPDDWKAGAFAGWNFQQDQIVYGVEGDAGYSWAKKSKDGL 201

Query: 111 HSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVG 170
               G  GSLR R GY++ + ++ Y T G   +Q        + +   +G TAG G+E  
Sbjct: 202 EVKQGFEGSLRARVGYDL-NPVMPYLTAGIAGSQIKLNNGLDDESKFRVGWTAGAGLEA- 259

Query: 171 GLSESLVARLEYRASKYSKV-----------EGFYNTISLGVGMKF 205
            L+++++ R+EYR ++Y              +     I +G+G KF
Sbjct: 260 KLTDNILGRVEYRYTQYGNKNYDLAGTTVRNKLDTQDIRVGIGYKF 305


>gi|189023912|ref|YP_001934680.1| OmpA-like transmembrane domain protein [Brucella abortus S19]
 gi|225627199|ref|ZP_03785237.1| Porin subfamily protein [Brucella ceti str. Cudo]
 gi|237815152|ref|ZP_04594150.1| Porin subfamily protein [Brucella abortus str. 2308 A]
 gi|260566721|ref|ZP_05837191.1| outer membrane protein [Brucella suis bv. 4 str. 40]
 gi|189019484|gb|ACD72206.1| OmpA-like transmembrane domain protein [Brucella abortus S19]
 gi|225618034|gb|EEH15078.1| Porin subfamily protein [Brucella ceti str. Cudo]
 gi|237789989|gb|EEP64199.1| Porin subfamily protein [Brucella abortus str. 2308 A]
 gi|260156239|gb|EEW91319.1| outer membrane protein [Brucella suis bv. 4 str. 40]
          Length = 305

 Score =  229 bits (583), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 64/226 (28%), Positives = 102/226 (45%), Gaps = 34/226 (15%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+ L   V VS+  L    +A AAD ++          P +     V  ++ + G Y GL
Sbjct: 93  MRTLKSLVIVSAALLPFSATAFAADAIQEQ--------PPVPAPVEVAPQYSWAGGYTGL 144

Query: 61  SALYNGSFGEEAHHNAGGSI---------FAGYNVEDSCIMYGVEGDVRYTVPVLA-DNI 110
              Y G    +A  +  GSI         FAG+N +   I+YGVEGD  Y+    + D +
Sbjct: 145 ---YLGYGWNKAKTSTVGSIKPDDWKAGAFAGWNFQQDQIVYGVEGDAGYSWAKKSKDGL 201

Query: 111 HSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVG 170
               G  GSLR R GY++ + ++ Y T G   +Q        + +   +G TAG G+E  
Sbjct: 202 EVKQGFEGSLRARVGYDL-NPVMPYLTAGIAGSQIKLNNGLDDESKFRVGWTAGAGLEA- 259

Query: 171 GLSESLVARLEYRASKYSKV-----------EGFYNTISLGVGMKF 205
            L+++++ R+EYR ++Y              +     I +G+G KF
Sbjct: 260 KLTDNILGRVEYRYTQYGNKNYDLAGTTVRNKLDTQDIRVGIGYKF 305


>gi|148560659|ref|YP_001258682.1| outer-membrane protein Omp25 [Brucella ovis ATCC 25840]
 gi|3914204|sp|Q45335|OM25_BRUO2 RecName: Full=25 kDa outer-membrane immunogenic protein; Flags:
           Precursor
 gi|1457929|gb|AAB06702.1| 25 kDa outer membrane protein [Brucella ovis]
 gi|148371916|gb|ABQ61895.1| outer-membrane protein Omp25 [Brucella ovis ATCC 25840]
          Length = 201

 Score =  212 bits (541), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 63/215 (29%), Positives = 102/215 (47%), Gaps = 24/215 (11%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+ L   V VS+  L    +A AAD ++          P +     V  ++ + G Y GL
Sbjct: 1   MRTLKSLVIVSAALLPFSATAFAADAIQEQ--------PPVPAPVEVAPQYSWAGGYTGL 52

Query: 61  SALYNGSFGEEAHHNAGGSI---------FAGYNVEDSCIMYGVEGDVRYTVPVLA-DNI 110
              Y G    +A  +  GSI         FAG+N +   I+YGVEG+  Y+    + D +
Sbjct: 53  ---YLGYGWNKAKTSTVGSIKPDDWKAGAFAGWNFQQDQIVYGVEGNAGYSWAKKSKDGL 109

Query: 111 HSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVG 170
               G  GSLR R GY++ + ++ Y T G   +Q        + +   +G TAG G+E  
Sbjct: 110 EVKQGFEGSLRARVGYDL-NPVMPYLTAGIAGSQIKLNNGLDDESKFRVGWTAGAGLEA- 167

Query: 171 GLSESLVARLEYRASKYSKVEGFYNTISLGVGMKF 205
            L+++++ R+EYR ++Y       + I +G+G KF
Sbjct: 168 KLTDNILGRVEYRYTQYGNKLDTQD-IRVGIGYKF 201


>gi|239831535|ref|ZP_04679864.1| Porin subfamily protein [Ochrobactrum intermedium LMG 3301]
 gi|239823802|gb|EEQ95370.1| Porin subfamily protein [Ochrobactrum intermedium LMG 3301]
          Length = 266

 Score =  212 bits (539), Expect = 3e-53,   Method: Composition-based stats.
 Identities = 60/226 (26%), Positives = 99/226 (43%), Gaps = 34/226 (15%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+ L   V  S+  L    +A AAD ++          P +     +  ++ + G Y GL
Sbjct: 54  MRTLKSLVIASAALLPFSATAFAADAIQEQ--------PPVPAPVEMAPQYSWAGGYTGL 105

Query: 61  SALYNGSFGEEAHHNAGGSI---------FAGYNVEDSCIMYGVEGDVRYTVPVLADN-I 110
              Y G    +   N  GSI         +AG+N +    +YGVEGD  Y+    + N +
Sbjct: 106 ---YLGYGWNKVKTNTDGSIKPDDMKAGAYAGWNFQQDQFVYGVEGDAGYSWAKKSKNGL 162

Query: 111 HSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVG 170
               G  GSLR R GY++ + ++ Y T G    Q        + +   +G TAG G+E  
Sbjct: 163 EVKEGFEGSLRGRLGYDL-NPVMPYITAGVAGKQVKLDNGFDDESKFRVGWTAGAGLEA- 220

Query: 171 GLSESLVARLEYRASKYSKV-----------EGFYNTISLGVGMKF 205
            L+++++ R+EYR +++              +   + I +GVG KF
Sbjct: 221 KLTDNILGRVEYRYTQFGNKTYDLGTESVRNKLDTHDIRVGVGYKF 266


>gi|254718838|ref|ZP_05180649.1| OmpA-like transmembrane domain protein [Brucella sp. 83/13]
 gi|265983822|ref|ZP_06096557.1| outer-membrane immunogenic protein [Brucella sp. 83/13]
 gi|306838760|ref|ZP_07471594.1| OmpA-like transmembrane domain protein [Brucella sp. NF 2653]
 gi|306843662|ref|ZP_07476262.1| OmpA-like transmembrane domain protein [Brucella sp. BO1]
 gi|206596726|emb|CAQ68393.1| outer membrane protein 25 [Brucella sp. BO1]
 gi|264662414|gb|EEZ32675.1| outer-membrane immunogenic protein [Brucella sp. 83/13]
 gi|306275972|gb|EFM57681.1| OmpA-like transmembrane domain protein [Brucella sp. BO1]
 gi|306406162|gb|EFM62407.1| OmpA-like transmembrane domain protein [Brucella sp. NF 2653]
          Length = 213

 Score =  209 bits (532), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 64/226 (28%), Positives = 102/226 (45%), Gaps = 34/226 (15%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+ L   V VS+  L    +A AAD ++          P +     V  ++ + G Y GL
Sbjct: 1   MRTLKSLVIVSAALLPFSATAFAADAIQEQ--------PPVPAPVEVAPQYSWAGGYTGL 52

Query: 61  SALYNGSFGEEAHHNAGGSI---------FAGYNVEDSCIMYGVEGDVRYTVPVLA-DNI 110
              Y G    +A  +  GSI         FAG+N +   I+YGVEGD  Y+    + D +
Sbjct: 53  ---YLGYGWNKAKTSTVGSIKPDDWKAGAFAGWNFQQDQIVYGVEGDAGYSWAKKSKDGL 109

Query: 111 HSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVG 170
               G  GSLR R GY++ + ++ Y T G   +Q        + +   +G TAG G+E  
Sbjct: 110 EVKQGFEGSLRARVGYDL-NPVMPYLTAGIAGSQIKLNNGLDDESKFRVGWTAGAGLEA- 167

Query: 171 GLSESLVARLEYRASKYSKV-----------EGFYNTISLGVGMKF 205
            L+++++ R+EYR ++Y              +     I +G+G KF
Sbjct: 168 KLTDNILGRVEYRYTQYGNKNYDLAGTNVRNKLDTQDIRVGIGYKF 213


>gi|23501588|ref|NP_697715.1| outer-membrane protein Omp25 [Brucella suis 1330]
 gi|62289663|ref|YP_221456.1| outer-membrane protein, 25 kDa [Brucella abortus bv. 1 str. 9-941]
 gi|82699590|ref|YP_414164.1| OmpA-like transmembrane domain-containing protein [Brucella
           melitensis biovar Abortus 2308]
 gi|163842972|ref|YP_001627376.1| 25 kDa outer-membrane immunogenic protein precursor [Brucella suis
           ATCC 23445]
 gi|254688973|ref|ZP_05152227.1| OmpA-like transmembrane domain protein [Brucella abortus bv. 6 str.
           870]
 gi|254697107|ref|ZP_05158935.1| OmpA-like transmembrane domain protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|254701484|ref|ZP_05163312.1| OmpA-like transmembrane domain protein [Brucella suis bv. 5 str.
           513]
 gi|254704031|ref|ZP_05165859.1| OmpA-like transmembrane domain protein [Brucella suis bv. 3 str.
           686]
 gi|254707067|ref|ZP_05168895.1| OmpA-like transmembrane domain protein [Brucella pinnipedialis
           M163/99/10]
 gi|254709823|ref|ZP_05171634.1| OmpA-like transmembrane domain protein [Brucella pinnipedialis
           B2/94]
 gi|254713826|ref|ZP_05175637.1| OmpA-like transmembrane domain protein [Brucella ceti M644/93/1]
 gi|254717116|ref|ZP_05178927.1| OmpA-like transmembrane domain protein [Brucella ceti M13/05/1]
 gi|254730003|ref|ZP_05188581.1| OmpA-like transmembrane domain protein [Brucella abortus bv. 4 str.
           292]
 gi|256031313|ref|ZP_05444927.1| OmpA-like transmembrane domain protein [Brucella pinnipedialis
           M292/94/1]
 gi|256159433|ref|ZP_05457205.1| OmpA-like transmembrane domain protein [Brucella ceti M490/95/1]
 gi|256254721|ref|ZP_05460257.1| OmpA-like transmembrane domain protein [Brucella ceti B1/94]
 gi|256257221|ref|ZP_05462757.1| OmpA-like transmembrane domain protein [Brucella abortus bv. 9 str.
           C68]
 gi|256369135|ref|YP_003106643.1| outer-membrane protein Omp25 [Brucella microti CCM 4915]
 gi|260168451|ref|ZP_05755262.1| OmpA-like transmembrane domain protein [Brucella sp. F5/99]
 gi|260545586|ref|ZP_05821327.1| outer-membrane immunogenic protein [Brucella abortus NCTC 8038]
 gi|260754463|ref|ZP_05866811.1| outer membrane protein [Brucella abortus bv. 6 str. 870]
 gi|260757682|ref|ZP_05870030.1| outer-membrane protein [Brucella abortus bv. 4 str. 292]
 gi|260761509|ref|ZP_05873852.1| outer-membrane immunogenic protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260883492|ref|ZP_05895106.1| outer-membrane immunogenic protein [Brucella abortus bv. 9 str.
           C68]
 gi|261218931|ref|ZP_05933212.1| outer membrane protein [Brucella ceti M13/05/1]
 gi|261221901|ref|ZP_05936182.1| outer-membrane immunogenic protein [Brucella ceti B1/94]
 gi|261314536|ref|ZP_05953733.1| outer membrane protein [Brucella pinnipedialis M163/99/10]
 gi|261317361|ref|ZP_05956558.1| outer-membrane immunogenic protein [Brucella pinnipedialis B2/94]
 gi|261321570|ref|ZP_05960767.1| outer membrane protein Omp25 [Brucella ceti M644/93/1]
 gi|261752028|ref|ZP_05995737.1| outer-membrane immunogenic protein [Brucella suis bv. 5 str. 513]
 gi|261754686|ref|ZP_05998395.1| outer-membrane immunogenic protein [Brucella suis bv. 3 str. 686]
 gi|261757914|ref|ZP_06001623.1| outer-membrane immunogenic protein [Brucella sp. F5/99]
 gi|265988399|ref|ZP_06100956.1| outer-membrane immunogenic protein [Brucella pinnipedialis
           M292/94/1]
 gi|265997865|ref|ZP_06110422.1| outer-membrane protein [Brucella ceti M490/95/1]
 gi|3914205|sp|Q45689|OM25_BRUSU RecName: Full=25 kDa outer-membrane immunogenic protein; Flags:
           Precursor
 gi|68067868|sp|Q44664|OM25_BRUAB RecName: Full=25 kDa outer-membrane immunogenic protein; Flags:
           Precursor
 gi|1457937|gb|AAB36695.1| 25 kDa outer membrane protein [Brucella suis 1330]
 gi|23347502|gb|AAN29630.1| outer-membrane protein Omp25 [Brucella suis 1330]
 gi|46251178|gb|AAS84560.1| Omp25 [Brucella ceti]
 gi|46251180|gb|AAS84561.1| Omp25 [Brucella ceti]
 gi|46251182|gb|AAS84562.1| Omp25 [Brucella pinnipedialis]
 gi|46251184|gb|AAS84563.1| Omp25 [Brucella ceti]
 gi|62195795|gb|AAX74095.1| outer-membrane protein, 25 kDa [Brucella abortus bv. 1 str. 9-941]
 gi|82615691|emb|CAJ10678.1| OmpA-like transmembrane domain [Brucella melitensis biovar Abortus
           2308]
 gi|157310307|emb|CAN43865.1| outer membrane protein 25 [Brucella microti CCM 4915]
 gi|157310309|emb|CAN43866.1| outer membrane protein 25 [Brucella microti]
 gi|163673695|gb|ABY37806.1| 25 kDa outer-membrane immunogenic protein precursor [Brucella suis
           ATCC 23445]
 gi|255999295|gb|ACU47694.1| outer-membrane protein Omp25 [Brucella microti CCM 4915]
 gi|260096993|gb|EEW80868.1| outer-membrane immunogenic protein [Brucella abortus NCTC 8038]
 gi|260668000|gb|EEX54940.1| outer-membrane protein [Brucella abortus bv. 4 str. 292]
 gi|260671941|gb|EEX58762.1| outer-membrane immunogenic protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260674571|gb|EEX61392.1| outer membrane protein [Brucella abortus bv. 6 str. 870]
 gi|260873020|gb|EEX80089.1| outer-membrane immunogenic protein [Brucella abortus bv. 9 str.
           C68]
 gi|260920485|gb|EEX87138.1| outer-membrane immunogenic protein [Brucella ceti B1/94]
 gi|260924020|gb|EEX90588.1| outer membrane protein [Brucella ceti M13/05/1]
 gi|261294260|gb|EEX97756.1| outer membrane protein Omp25 [Brucella ceti M644/93/1]
 gi|261296584|gb|EEY00081.1| outer-membrane immunogenic protein [Brucella pinnipedialis B2/94]
 gi|261303562|gb|EEY07059.1| outer membrane protein [Brucella pinnipedialis M163/99/10]
 gi|261737898|gb|EEY25894.1| outer-membrane immunogenic protein [Brucella sp. F5/99]
 gi|261741781|gb|EEY29707.1| outer-membrane immunogenic protein [Brucella suis bv. 5 str. 513]
 gi|261744439|gb|EEY32365.1| outer-membrane immunogenic protein [Brucella suis bv. 3 str. 686]
 gi|262552333|gb|EEZ08323.1| outer-membrane protein [Brucella ceti M490/95/1]
 gi|264660596|gb|EEZ30857.1| outer-membrane immunogenic protein [Brucella pinnipedialis
           M292/94/1]
          Length = 213

 Score =  209 bits (531), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 64/226 (28%), Positives = 102/226 (45%), Gaps = 34/226 (15%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+ L   V VS+  L    +A AAD ++          P +     V  ++ + G Y GL
Sbjct: 1   MRTLKSLVIVSAALLPFSATAFAADAIQEQ--------PPVPAPVEVAPQYSWAGGYTGL 52

Query: 61  SALYNGSFGEEAHHNAGGSI---------FAGYNVEDSCIMYGVEGDVRYTVPVLA-DNI 110
              Y G    +A  +  GSI         FAG+N +   I+YGVEGD  Y+    + D +
Sbjct: 53  ---YLGYGWNKAKTSTVGSIKPDDWKAGAFAGWNFQQDQIVYGVEGDAGYSWAKKSKDGL 109

Query: 111 HSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVG 170
               G  GSLR R GY++ + ++ Y T G   +Q        + +   +G TAG G+E  
Sbjct: 110 EVKQGFEGSLRARVGYDL-NPVMPYLTAGIAGSQIKLNNGLDDESKFRVGWTAGAGLEA- 167

Query: 171 GLSESLVARLEYRASKYSKV-----------EGFYNTISLGVGMKF 205
            L+++++ R+EYR ++Y              +     I +G+G KF
Sbjct: 168 KLTDNILGRVEYRYTQYGNKNYDLAGTTVRNKLDTQDIRVGIGYKF 213


>gi|254693454|ref|ZP_05155282.1| OmpA-like transmembrane domain protein [Brucella abortus bv. 3 str.
           Tulya]
 gi|261213709|ref|ZP_05927990.1| outer membrane protein [Brucella abortus bv. 3 str. Tulya]
 gi|260915316|gb|EEX82177.1| outer membrane protein [Brucella abortus bv. 3 str. Tulya]
          Length = 213

 Score =  209 bits (531), Expect = 3e-52,   Method: Composition-based stats.
 Identities = 64/226 (28%), Positives = 102/226 (45%), Gaps = 34/226 (15%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+ L   V VS+  L    +A AAD ++          P +     V  ++ + G Y GL
Sbjct: 1   MRTLKSLVIVSAALLPFSATAFAADAIQEQ--------PPVPAPVEVAPQYSWAGGYTGL 52

Query: 61  SALYNGSFGEEAHHNAGGSI---------FAGYNVEDSCIMYGVEGDVRYTVPVLA-DNI 110
              Y G    +A  +  GSI         FAG+N +   I+YGVEGD  Y+    + D +
Sbjct: 53  ---YLGYGWNKAKTSTVGSIKPDDWKAGAFAGWNFQQDQIVYGVEGDAGYSWAKKSKDGL 109

Query: 111 HSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVG 170
               G  GSLR R GY++ + ++ Y T G   +Q        + +   +G TAG G+E  
Sbjct: 110 EVKQGFEGSLRARVGYDL-NPVMPYLTAGIAGSQIKLNNGLDDESKFRVGWTAGAGLEA- 167

Query: 171 GLSESLVARLEYRASKYSKV-----------EGFYNTISLGVGMKF 205
            L+++++ R+EYR ++Y              +     I +G+G KF
Sbjct: 168 KLTDNILGRVEYRYTQYGNKNYDLAGTTVRTKLDTQDIRVGIGYKF 213


>gi|306842032|ref|ZP_07474705.1| OmpA-like transmembrane domain protein [Brucella sp. BO2]
 gi|306287873|gb|EFM59293.1| OmpA-like transmembrane domain protein [Brucella sp. BO2]
          Length = 213

 Score =  208 bits (530), Expect = 3e-52,   Method: Composition-based stats.
 Identities = 64/226 (28%), Positives = 102/226 (45%), Gaps = 34/226 (15%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+ L   V VS+  L    +A AAD ++          P +     V  ++ + G Y GL
Sbjct: 1   MRTLKSLVIVSAALLPFSATAFAADAIQEQ--------PPVPAPVEVAPQYSWAGGYTGL 52

Query: 61  SALYNGSFGEEAHHNAGGSI---------FAGYNVEDSCIMYGVEGDVRYTVPVLA-DNI 110
              Y G    +A  +  GSI         FAG+N +   I+YGVEGD  Y+    + D +
Sbjct: 53  ---YLGYGWNKAKTSTVGSIKPDDWKAGAFAGWNFQQDQIVYGVEGDAGYSWAKKSKDGL 109

Query: 111 HSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVG 170
               G  GSLR R GY++ + ++ Y T G   +Q        + +   +G TAG G+E  
Sbjct: 110 EVKQGFEGSLRARVGYDL-NPVMPYLTAGIAGSQIKLNNGLDDESKFRVGWTAGAGLEA- 167

Query: 171 GLSESLVARLEYRASKYSKV-----------EGFYNTISLGVGMKF 205
            L+++++ R+EYR ++Y              +     I +G+G KF
Sbjct: 168 KLTDNILGRVEYRYTQYGNKNYDLAGTTVRNKLDTQDIRVGLGYKF 213


>gi|161618670|ref|YP_001592557.1| 25 kDa outer-membrane immunogenic protein precursor [Brucella canis
           ATCC 23365]
 gi|161335481|gb|ABX61786.1| 25 kDa outer-membrane immunogenic protein precursor [Brucella canis
           ATCC 23365]
          Length = 213

 Score =  207 bits (528), Expect = 5e-52,   Method: Composition-based stats.
 Identities = 64/226 (28%), Positives = 102/226 (45%), Gaps = 34/226 (15%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+ L   V VS+  L    +A AAD ++          P +     V  ++ + G Y GL
Sbjct: 1   MRTLKSLVIVSAALLPFSATAFAADAIQEQ--------PPVPAPVEVAPQYSWAGGYTGL 52

Query: 61  SALYNGSFGEEAHHNAGGSI---------FAGYNVEDSCIMYGVEGDVRYTVPVLA-DNI 110
              Y G    +A  +  GSI         FAG+N +   I+YGVEGD  Y+    + D +
Sbjct: 53  ---YLGYGWNKAKTSTVGSIKPDDWKAGAFAGWNFQKDQIVYGVEGDAGYSWAKKSKDGL 109

Query: 111 HSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVG 170
               G  GSLR R GY++ + ++ Y T G   +Q        + +   +G TAG G+E  
Sbjct: 110 EVKQGFEGSLRARVGYDL-NPVMPYLTAGIAGSQIKLNNGLDDESKFRVGWTAGAGLEA- 167

Query: 171 GLSESLVARLEYRASKYSKV-----------EGFYNTISLGVGMKF 205
            L+++++ R+EYR ++Y              +     I +G+G KF
Sbjct: 168 KLTDNILGRVEYRYTQYGNKNYDLAGTTVRNKLDTQDIRVGIGYKF 213


>gi|17987532|ref|NP_540166.1| 25 kDa outer-membrane immunogenic protein precursor [Brucella
           melitensis bv. 1 str. 16M]
 gi|225852222|ref|YP_002732455.1| OmpA-like transmembrane domain-containing protein [Brucella
           melitensis ATCC 23457]
 gi|256044394|ref|ZP_05447298.1| OmpA-like transmembrane domain protein [Brucella melitensis bv. 1
           str. Rev.1]
 gi|256264270|ref|ZP_05466802.1| outer-membrane protein Omp25 [Brucella melitensis bv. 2 str. 63/9]
 gi|260563745|ref|ZP_05834231.1| outer-membrane immunogenic protein [Brucella melitensis bv. 1 str.
           16M]
 gi|265990813|ref|ZP_06103370.1| outer-membrane immunogenic protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|3914202|sp|Q45321|OM25_BRUME RecName: Full=25 kDa outer-membrane immunogenic protein; Flags:
           Precursor
 gi|1457927|gb|AAB06701.1| 25 kDa outer membrane protein [Brucella melitensis]
 gi|17983234|gb|AAL52430.1| 25 kDa outer-membrane immunogenic protein precursor [Brucella
           melitensis bv. 1 str. 16M]
 gi|225640587|gb|ACO00501.1| OmpA-like transmembrane domain protein [Brucella melitensis ATCC
           23457]
 gi|260153761|gb|EEW88853.1| outer-membrane immunogenic protein [Brucella melitensis bv. 1 str.
           16M]
 gi|263001597|gb|EEZ14172.1| outer-membrane immunogenic protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|263094531|gb|EEZ18340.1| outer-membrane protein Omp25 [Brucella melitensis bv. 2 str. 63/9]
 gi|326408721|gb|ADZ65786.1| OmpA-like transmembrane domain protein [Brucella melitensis M28]
 gi|326538444|gb|ADZ86659.1| OmpA-like transmembrane domain protein [Brucella melitensis M5-90]
          Length = 213

 Score =  207 bits (528), Expect = 6e-52,   Method: Composition-based stats.
 Identities = 63/226 (27%), Positives = 101/226 (44%), Gaps = 34/226 (15%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+ L   V VS+  L    +A AAD ++          P +     V  ++ + G Y GL
Sbjct: 1   MRTLKSLVIVSAALLPFSATAFAADAIQEQ--------PPVPAPVEVAPQYSWAGGYTGL 52

Query: 61  SALYNGSFGEEAHHNAGGSI---------FAGYNVEDSCIMYGVEGDVRYTVPVLA-DNI 110
              Y G    +A  +  GSI         FAG+N +   I+YGVEGD  Y+    + D +
Sbjct: 53  ---YLGYGWNKAKTSTVGSIKPDDWKAGAFAGWNFQQDQIVYGVEGDAGYSWAKKSKDGL 109

Query: 111 HSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVG 170
               G  GSLR R GY++ + ++ Y T G   +Q        + +   +G TAG G+E  
Sbjct: 110 EVKQGFEGSLRARVGYDL-NPVMPYLTAGIAGSQIKLNNGLDDESKFRVGWTAGAGLEA- 167

Query: 171 GLSESLVARLEYRASKYSKV-----------EGFYNTISLGVGMKF 205
            L+++++ R+EYR ++Y              +       +G+G KF
Sbjct: 168 KLTDNILGRVEYRYTQYGNKNYDLAGTTVRNKLDTQDFRVGIGYKF 213


>gi|256113236|ref|ZP_05454104.1| OmpA-like transmembrane domain protein [Brucella melitensis bv. 3
           str. Ether]
 gi|265994648|ref|ZP_06107205.1| outer-membrane immunogenic protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|262765761|gb|EEZ11550.1| outer-membrane immunogenic protein [Brucella melitensis bv. 3 str.
           Ether]
          Length = 213

 Score =  206 bits (524), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 63/226 (27%), Positives = 101/226 (44%), Gaps = 34/226 (15%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+ L   V VS+  L    +A AAD ++          P +     V  ++ + G Y GL
Sbjct: 1   MRTLKSLVIVSAALLPFSATAFAADAIQEQ--------PPVPAPVEVAPQYSWAGGYTGL 52

Query: 61  SALYNGSFGEEAHHNAGGSI---------FAGYNVEDSCIMYGVEGDVRYTVPVLA-DNI 110
              Y G    +A  +  GSI         FAG+N +   I+YGVEGD  Y+    + D +
Sbjct: 53  ---YLGYGWNKAKTSTVGSIKPDDWKAGAFAGWNFQQDQIVYGVEGDAGYSWAKKSKDGL 109

Query: 111 HSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVG 170
               G  GSLR R GY++ + ++ Y T G   +Q        + +   +G TAG G+E  
Sbjct: 110 EVKQGFEGSLRARVGYDL-NPVMPYLTAGIVGSQIKLNNGLDDESKFRVGWTAGAGLEA- 167

Query: 171 GLSESLVARLEYRASKYSKV-----------EGFYNTISLGVGMKF 205
            L+++++ R+EYR ++Y              +       +G+G KF
Sbjct: 168 KLTDNILGRVEYRYTQYGNKNYDLAGTTVRNKLDTQDFRVGIGYKF 213


>gi|3914201|sp|Q45110|OM25_BRUCA RecName: Full=25 kDa outer-membrane immunogenic protein; Flags:
           Precursor
 gi|1457931|gb|AAB36692.1| 25 kDa outer membrane protein [Brucella canis]
          Length = 213

 Score =  206 bits (523), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 65/226 (28%), Positives = 102/226 (45%), Gaps = 34/226 (15%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+ L   V VS+  L    +A AAD ++          P +     V  ++ + G Y GL
Sbjct: 1   MRTLKSLVIVSAALLPFSATAFAADAIQEQ--------PPVPAPVEVAPQYSWAGGYTGL 52

Query: 61  SALYNGSFGEEAHHNAGGSI---------FAGYNVEDSCIMYGVEGDVRYTVPVLA-DNI 110
              Y G    +A  +  GSI         FAG+N +   I+YGVEGD  Y+    + D +
Sbjct: 53  ---YLGYGWNKAKTSTVGSIKPDDWKAGAFAGWNFQKDQIVYGVEGDAGYSWAKKSKDGL 109

Query: 111 HSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVG 170
               G  GSLR R GY++ + ++ Y T G   +Q          +   +G TAG G+E  
Sbjct: 110 EVKQGFEGSLRARVGYDL-NPVMPYLTAGIAGSQIKLNNGLDGESKFRVGWTAGAGLEA- 167

Query: 171 GLSESLVARLEYRASKYSKV-----------EGFYNTISLGVGMKF 205
            L+++++ R+EYR ++YS             +     I +G+G KF
Sbjct: 168 KLTDNILGRVEYRYTQYSNKNYDLAGTTVRNKLDTQDIRVGIGYKF 213


>gi|256060827|ref|ZP_05450987.1| OmpA-like transmembrane domain protein [Brucella neotomae 5K33]
 gi|261324818|ref|ZP_05964015.1| outer-membrane protein Omp25 [Brucella neotomae 5K33]
 gi|3914203|sp|Q45326|OM25_BRUNE RecName: Full=25 kDa outer-membrane immunogenic protein; Flags:
           Precursor
 gi|1457935|gb|AAB36694.1| 25 kDa outer membrane protein [Brucella neotomae]
 gi|261300798|gb|EEY04295.1| outer-membrane protein Omp25 [Brucella neotomae 5K33]
          Length = 213

 Score =  206 bits (523), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 64/226 (28%), Positives = 102/226 (45%), Gaps = 34/226 (15%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+ L   V VS+  L    +A AAD ++          P +     V  ++ + G Y GL
Sbjct: 1   MRTLKSLVIVSAALLPFSATAFAADAIQEQ--------PPVPAPVEVAPQYSWAGGYTGL 52

Query: 61  SALYNGSFGEEAHHNAGGSI---------FAGYNVEDSCIMYGVEGDVRYTVPVLA-DNI 110
              Y G    +A  +  GSI         FAG+N +   I+YGVEGD  Y+    + D +
Sbjct: 53  ---YLGYGWNKAKTSTVGSIKPDDWKAGAFAGWNFQQDQIVYGVEGDAGYSWAKKSKDGL 109

Query: 111 HSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVG 170
               G  GSLR R GY++ + ++ Y T G   +Q        + +   +G TAG G+E  
Sbjct: 110 EVKQGFEGSLRARVGYDL-NLVMPYLTAGIAGSQIKLNNGLDDESKFRVGWTAGAGLEA- 167

Query: 171 GLSESLVARLEYRASKYSKV-----------EGFYNTISLGVGMKF 205
            L+++++ R+EYR ++Y              +     I +G+G KF
Sbjct: 168 KLTDNILGRVEYRYTQYGNKNYDLAGTTVRNKLDTQDIRVGIGYKF 213


>gi|153009914|ref|YP_001371129.1| porin [Ochrobactrum anthropi ATCC 49188]
 gi|151561802|gb|ABS15300.1| porin [Ochrobactrum anthropi ATCC 49188]
          Length = 213

 Score =  205 bits (521), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 58/226 (25%), Positives = 100/226 (44%), Gaps = 34/226 (15%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+ L   V  S+  L    +A AAD ++          P +     +  ++ + G Y GL
Sbjct: 1   MRTLKSLVIASAALLPFSATAFAADAIQEQ--------PPVPAPVEMAPQYSWAGGYTGL 52

Query: 61  SALYNGSFGEEAHHNAGGSI---------FAGYNVEDSCIMYGVEGDVRYTVPVLA-DNI 110
              Y G    +A  +  G++         +AG+N +    +YGVEGD  Y+      D +
Sbjct: 53  ---YLGYGWNKAKTDTVGTVKPDDMKAGAYAGWNFQQDQFVYGVEGDAGYSWAKKTKDGL 109

Query: 111 HSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVG 170
               G  GSLR R GY++ + ++ Y T G   +Q        + +   +G TAG G+E  
Sbjct: 110 EVKQGFEGSLRARLGYDL-NPVMPYITAGVAGSQVKLDNGFDDESKFRVGWTAGAGLEA- 167

Query: 171 GLSESLVARLEYRASKYSKV-----------EGFYNTISLGVGMKF 205
            L+++++ R+EYR +++              +   + I +GVG KF
Sbjct: 168 KLTDNILGRVEYRYTQFGNKTYDLGNESVRNKLDTHDIRVGVGYKF 213


>gi|769745|emb|CAA55872.1| immunogenic protein [Brucella abortus]
 gi|89741444|gb|ABD77595.1| 25 kDa outer membrane protein [Brucella abortus]
          Length = 213

 Score =  203 bits (517), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 63/226 (27%), Positives = 101/226 (44%), Gaps = 34/226 (15%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+ L   V VS+  L    +A AAD ++          P +     V  ++ + G Y GL
Sbjct: 1   MRTLKSLVIVSAALLPFSATAFAADAIQEQ--------PPVPAPVEVAPQYSWAGGYTGL 52

Query: 61  SALYNGSFGEEAHHNAGGSI---------FAGYNVEDSCIMYGVEGDVRYTVPVLA-DNI 110
              Y G    +A  +  GSI         FAG+N +   I+YGVEGD  Y+    + D +
Sbjct: 53  ---YLGYGWNKAKTSTVGSIKPDDWKAGAFAGWNFQQDQIVYGVEGDAGYSWAKKSKDGL 109

Query: 111 HSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVG 170
               G  GSL  R GY++ + ++ Y T G   +Q        + +   +G TAG G+E  
Sbjct: 110 EVKQGFEGSLGARVGYDL-NPVMPYLTAGIAGSQIKLNNGLDDESKFRVGWTAGAGLEA- 167

Query: 171 GLSESLVARLEYRASKYSKV-----------EGFYNTISLGVGMKF 205
            L+++++ R+EYR ++Y              +     I +G+G KF
Sbjct: 168 KLTDNILGRVEYRYTQYGNKNYDLAGTTVRNKLDTQDIRVGIGYKF 213


>gi|327193361|gb|EGE60264.1| outer membrane protein [Rhizobium etli CNPAF512]
          Length = 211

 Score =  199 bits (506), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 66/219 (30%), Positives = 105/219 (47%), Gaps = 22/219 (10%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+ L   +  S+ A+A    AQAAD V +           +A +  V    ++ G Y G 
Sbjct: 1   MRVLIAGLMASAFAIAGVSVAQAADAVDQVPEA------PVAQDAPVKPAGNWEGFYLGG 54

Query: 61  SALYN-GSFGEEAH-HNAGGSIFAGYNVEDSCIMYGVEGDVRYTV-PVLADNIHSLHGIG 117
           +  YN G FG + H +  GG +F GYN +   I+YGVE D+ Y+   V +  + + +G  
Sbjct: 55  AGTYNMGDFGSDRHTYGFGGQVFTGYNWQQGQIVYGVESDLGYSGDDVSSGGVKNKYGWN 114

Query: 118 GSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLV 177
           GS+R R GY++ +  LLY T G  +     +    + +    G T G GVE   ++ ++ 
Sbjct: 115 GSVRGRVGYDM-NPFLLYGTAGLALGNIKVSDGTSDESKTNYGYTVGAGVEA-FVTNNIT 172

Query: 178 ARLEYRASKYSKVE-----------GFYNTISLGVGMKF 205
            RLEYR + Y   +              N++ LG+G+KF
Sbjct: 173 TRLEYRYTDYQSKDYDLDSGSFSRGYDENSVKLGIGVKF 211


>gi|190891163|ref|YP_001977705.1| outer membrane protein [Rhizobium etli CIAT 652]
 gi|190696442|gb|ACE90527.1| outer membrane protein [Rhizobium etli CIAT 652]
          Length = 211

 Score =  199 bits (506), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 67/219 (30%), Positives = 106/219 (48%), Gaps = 22/219 (10%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+ L   +  S+ A+A    AQAAD V +           +A +  V    ++ G Y G 
Sbjct: 1   MRVLIAGLMASAFAIAGVSVAQAADAVDQVPEA------PVAQDAPVKPAGNWEGFYLGG 54

Query: 61  SALYN-GSFGEEAH-HNAGGSIFAGYNVEDSCIMYGVEGDVRYTV-PVLADNIHSLHGIG 117
           +  YN G FG + H +  GG +F GYN +   I+YGVE D+ Y+   V +  + + +G  
Sbjct: 55  AGTYNMGDFGSDRHTYGFGGQVFTGYNWQQGQIVYGVESDLGYSGDDVSSGGVKNKYGWN 114

Query: 118 GSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLV 177
           GS+R R GY++ +  LLY T G  +     +    + +  A G T G GVE   ++ ++ 
Sbjct: 115 GSVRGRVGYDM-NPFLLYGTAGLALGNIKVSDGTSDESKTAYGYTVGAGVEA-FVTNNIT 172

Query: 178 ARLEYRASKYSKVE-----------GFYNTISLGVGMKF 205
            RLEYR + Y   +              N++ LG+G+KF
Sbjct: 173 TRLEYRYTDYQSKDYDLDSGSFSRGYDENSVKLGIGVKF 211


>gi|3914820|sp|Q52866|ROPB_RHILV RecName: Full=22 kDa outer membrane protein; Flags: Precursor
 gi|525267|emb|CAA56751.1| outer membrane protein [Rhizobium leguminosarum bv. viciae 248]
          Length = 211

 Score =  198 bits (504), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 66/219 (30%), Positives = 103/219 (47%), Gaps = 22/219 (10%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+ L   +  S  A+A   +AQAAD V +           +A    V     + G Y G 
Sbjct: 1   MRVLIAGLMASVFAIAGVSAAQAADRVDQVPEA------PVAQEAPVKPAGSWEGFYLGG 54

Query: 61  SALYN-GSFGEEAH-HNAGGSIFAGYNVEDSCIMYGVEGDVRYTV-PVLADNIHSLHGIG 117
           +  YN G FG + H +  GG +F GYN +   I+YGVE D+ Y+   V +  + + +G  
Sbjct: 55  AGTYNMGDFGSDRHTYGFGGQVFTGYNWQQGQIVYGVESDLGYSGDDVSSGGVENKYGWN 114

Query: 118 GSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLV 177
           GS+R R GY++ +  LLY T G  +     +    + +    G T G GVE   ++ ++ 
Sbjct: 115 GSVRGRVGYDM-NPFLLYGTAGLAIGDVKVSDDTSDESKTNFGYTVGAGVEA-FVTNNIT 172

Query: 178 ARLEYRASKYSKVE-----------GFYNTISLGVGMKF 205
            RLEYR + Y   +              N++ LG+G+KF
Sbjct: 173 TRLEYRYTDYQSKDYDLDSGSFSRGYDENSVKLGIGVKF 211


>gi|222085476|ref|YP_002544006.1| outer membrane protein [Agrobacterium radiobacter K84]
 gi|221722924|gb|ACM26080.1| outer membrane protein [Agrobacterium radiobacter K84]
          Length = 210

 Score =  190 bits (483), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 61/219 (27%), Positives = 101/219 (46%), Gaps = 23/219 (10%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+ L   + VS+ A+  F +A AAD V +                  P  ++++G Y G 
Sbjct: 1   MRTLIKTLMVSAFAIGGFNAAYAADAVEQIPQ-------PPVAQEAAPAINNWSGFYIGG 53

Query: 61  SALYN-GSFGEEAH-HNAGGSIFAGYNVEDSCIMYGVEGDVRYTV-PVLADNIHSLHGIG 117
           +  +N G F    + +  GG  F GYN +   I+YGVE D+ Y       + + + +G+ 
Sbjct: 54  AGDWNKGHFSRNGNGYGFGGEAFTGYNWQQGQIVYGVEADLGYAGIDSTRNGLTAKNGVN 113

Query: 118 GSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLV 177
           GS+R R GY+  +  +LY T G  + Q   +      +  A+G T G G E   ++ ++ 
Sbjct: 114 GSVRGRLGYDF-NPFMLYGTAGLAIGQNKLSDDTSSDSKTAVGYTVGAGAET-FITNNVT 171

Query: 178 ARLEYRASKYSKVE-----------GFYNTISLGVGMKF 205
           ARLEYR + Y K                 ++ +G+G+KF
Sbjct: 172 ARLEYRYTDYGKKNFDLDSGNFSRGYDEQSVKVGIGVKF 210


>gi|241203970|ref|YP_002975066.1| porin [Rhizobium leguminosarum bv. trifolii WSM1325]
 gi|240857860|gb|ACS55527.1| porin [Rhizobium leguminosarum bv. trifolii WSM1325]
          Length = 211

 Score =  186 bits (473), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 66/219 (30%), Positives = 105/219 (47%), Gaps = 22/219 (10%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+ L   +  S  A+A   +AQAAD V +           +A +  V    ++ G Y G 
Sbjct: 1   MRVLIAGLMASVFAIAGLSAAQAADAVDQIPEA------PVAQDAPVKPAGNWEGFYLGG 54

Query: 61  SALYN-GSFGEEAH-HNAGGSIFAGYNVEDSCIMYGVEGDVRYTV-PVLADNIHSLHGIG 117
           +  YN G FG + H +  GG +F GYN +   I+YGVE D+ Y+   V +  + + +G  
Sbjct: 55  AGTYNMGDFGSDRHTYGFGGQVFTGYNWQQGQIVYGVESDLGYSGDDVSSGGVKNKYGWN 114

Query: 118 GSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLV 177
           GS+R R GY++ +  LLY T G  +     +    + +    G T G GVE   ++ ++ 
Sbjct: 115 GSVRGRVGYDM-NPFLLYGTAGLAIGDVKVSDDTSDESKTNFGYTVGAGVEA-FVTNNIT 172

Query: 178 ARLEYRASKYSKVE-----------GFYNTISLGVGMKF 205
            RLEYR + Y   +              N++ LG+G+KF
Sbjct: 173 TRLEYRYTDYQSKDYDLDSGSFSRGYDENSVKLGIGVKF 211


>gi|218675314|ref|ZP_03524983.1| outer membrane protein [Rhizobium etli GR56]
          Length = 211

 Score =  186 bits (471), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 68/219 (31%), Positives = 107/219 (48%), Gaps = 22/219 (10%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+ L   +  S+ A+A   +AQAAD V +           IA +  V    ++ G Y G 
Sbjct: 1   MRVLIAGLMASAFAIAGVSAAQAADAVDQVPEA------PIAQDAPVKPAGNWEGFYLGG 54

Query: 61  SALYN-GSFGEEAH-HNAGGSIFAGYNVEDSCIMYGVEGDVRYTV-PVLADNIHSLHGIG 117
           +  YN G FG + H +  GG +F GYN +   I+YGVE D+ Y+   V +  + + +G  
Sbjct: 55  AGTYNMGDFGSDRHTYGFGGQVFTGYNWQQGQIVYGVESDLGYSGDDVSSGGVKNKYGWN 114

Query: 118 GSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLV 177
           GS+R R GY++ +  LLY T G  +     +    + +  A G T G GVE   ++ ++ 
Sbjct: 115 GSVRGRVGYDM-NPFLLYGTAGLALGNIKVSDDTSDESKTAYGYTVGAGVEA-FVTNNIT 172

Query: 178 ARLEYRASKYSKVE-----------GFYNTISLGVGMKF 205
            RLEYR + Y   +              N++ LG+G+KF
Sbjct: 173 TRLEYRYTDYQSKDYDLDSGSFSRGYDENSVKLGIGVKF 211


>gi|116251355|ref|YP_767193.1| ropB outer membrane protein [Rhizobium leguminosarum bv. viciae
           3841]
 gi|115256003|emb|CAK07084.1| putative ropB outer membrane protein [Rhizobium leguminosarum bv.
           viciae 3841]
 gi|220979413|gb|ACL97988.1| outer membrane protein B [Rhizobium leguminosarum bv. viciae]
          Length = 211

 Score =  185 bits (469), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 66/219 (30%), Positives = 104/219 (47%), Gaps = 22/219 (10%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+ L   +  S  A+A   +AQAAD V +           +A    V    ++ G Y G 
Sbjct: 1   MRVLIAGLMASVFAIAGVSAAQAADAVDQVPEA------PVAQEAPVKPAGNWEGFYLGG 54

Query: 61  SALYN-GSFGEEAH-HNAGGSIFAGYNVEDSCIMYGVEGDVRYTV-PVLADNIHSLHGIG 117
           +  YN G FG + H +  GG +F GYN +   I+YGVE D+ Y+   V +  + + +G  
Sbjct: 55  AGTYNMGDFGSDRHTYGFGGQVFTGYNWQQGQIVYGVESDLGYSGDDVSSGGVKNKYGWN 114

Query: 118 GSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLV 177
           GS+R R GY++ +  LLY T G  +     +    + +    G T G GVE   ++ ++ 
Sbjct: 115 GSVRGRVGYDM-NPFLLYGTAGLAIGDVKVSDDTSDESKTNFGYTVGAGVEA-FVTNNIT 172

Query: 178 ARLEYRASKYSKVE-----------GFYNTISLGVGMKF 205
            RLEYR + Y   +              N++ LG+G+KF
Sbjct: 173 TRLEYRYTDYQSKDYDLDSGSFSRGYDENSVKLGIGVKF 211


>gi|209548691|ref|YP_002280608.1| porin [Rhizobium leguminosarum bv. trifolii WSM2304]
 gi|209534447|gb|ACI54382.1| porin [Rhizobium leguminosarum bv. trifolii WSM2304]
          Length = 211

 Score =  184 bits (467), Expect = 6e-45,   Method: Composition-based stats.
 Identities = 61/221 (27%), Positives = 98/221 (44%), Gaps = 26/221 (11%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVP--IRHDFNGPYA 58
           M+ L   +  S  A+A   +A                +P     +  P      + G Y 
Sbjct: 1   MRVLIAGLMASVFAIAGISAA--------QAADAVDQIPEAPVAQEAPVKPAGSWEGFYL 52

Query: 59  GLSALYN-GSFGEEAH-HNAGGSIFAGYNVEDSCIMYGVEGDVRYTV-PVLADNIHSLHG 115
           G +  YN G FG + H +  GG +F GYN +   I+YGVE D+ Y+   V +  + + +G
Sbjct: 53  GGAGTYNMGDFGSDRHTYGFGGQVFTGYNWQQGQIVYGVESDLGYSGDDVSSGGVKNKYG 112

Query: 116 IGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSES 175
             GS+R R GY++ +  LLY T G  +     +    + +    G T G GVE   ++ +
Sbjct: 113 WNGSVRGRVGYDM-NPFLLYGTAGLALGNVKVSDGTSDESKTNYGYTVGAGVEA-FVTNN 170

Query: 176 LVARLEYRASKYSKVE-----------GFYNTISLGVGMKF 205
           +  RLEYR + Y   +              N++ LG+G+KF
Sbjct: 171 ITTRLEYRYTDYQSKDYDLDSGSFSRGYDENSVKLGIGVKF 211


>gi|86357119|ref|YP_469011.1| outer membrane protein [Rhizobium etli CFN 42]
 gi|86281221|gb|ABC90284.1| outer membrane protein [Rhizobium etli CFN 42]
          Length = 211

 Score =  182 bits (461), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 66/219 (30%), Positives = 106/219 (48%), Gaps = 22/219 (10%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+ L   +  S+ A+A   +AQAAD V +           +A +  V    ++ G Y G 
Sbjct: 1   MRVLIAGLMASAFAIAGVSAAQAADAVDQVPEA------PVAQDAPVKPAGNWEGFYLGG 54

Query: 61  SALYN-GSFGEEAH-HNAGGSIFAGYNVEDSCIMYGVEGDVRYTV-PVLADNIHSLHGIG 117
           +  YN G FG + H +  GG +F GYN +   I+YGVE D+ Y+   V +  + + +G  
Sbjct: 55  AGTYNMGDFGSDRHTYGFGGQVFTGYNWQAGQIVYGVESDLGYSGDDVSSGGVKNKYGWN 114

Query: 118 GSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLV 177
           GS+R R GY++ +  LLY T G  +     +    + +    G T G GVE   ++ ++ 
Sbjct: 115 GSVRGRVGYDM-NPFLLYGTAGLALGNVKVSDGTSDESKTNYGYTVGAGVEA-FVTNNIT 172

Query: 178 ARLEYRASKYSKVE-----------GFYNTISLGVGMKF 205
            RLEYR + Y   +              N++ LG+G+KF
Sbjct: 173 TRLEYRYTDYQSKDYDLDSGSFSRGYDENSVKLGIGVKF 211


>gi|260469600|ref|ZP_05813765.1| OmpA domain protein transmembrane region-containing protein
           [Mesorhizobium opportunistum WSM2075]
 gi|259028626|gb|EEW29937.1| OmpA domain protein transmembrane region-containing protein
           [Mesorhizobium opportunistum WSM2075]
          Length = 217

 Score =  180 bits (456), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 67/218 (30%), Positives = 98/218 (44%), Gaps = 29/218 (13%)

Query: 6   LAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYN 65
           LAV +   AL    +A AAD V+          P             + GPYAG++  Y 
Sbjct: 11  LAVALGLFALGG--TAYAADVVQEE--------PPAPAPVAELPVASWAGPYAGINLGYG 60

Query: 66  GSFGEEAHH--------NAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADN-IHSLHGI 116
            S   +              GS+F GY  +    +YG E ++ Y      DN +HS  G 
Sbjct: 61  FSGRTKEKDLGFETDTKGFVGSVFGGYQWQQENFVYGGEAELGYNGVKGDDNGVHSKGGF 120

Query: 117 GGSLRIRGGYEVSDSLLLYATVGPDV-AQKYETGKAGEITPIAIGGTAGVGVEVGGLSES 175
            GSLR R GY V+  +LLY T G    + K E    G  T   +G TAG+G ++  L+++
Sbjct: 121 EGSLRARLGYAVTPEILLYGTGGLAGRSLKVEDDTFGSDTATMLGWTAGLGTDI-KLTDN 179

Query: 176 LVARLEYRASKY--------SKVEGFYNTISLGVGMKF 205
           +  R+EYR + +         KV+   N ++ G+GMKF
Sbjct: 180 VFGRVEYRYTDFGSKSFDNIGKVKATDNRVTFGLGMKF 217


>gi|15964926|ref|NP_385279.1| outer membrane protein [Sinorhizobium meliloti 1021]
 gi|307300997|ref|ZP_07580766.1| porin [Sinorhizobium meliloti BL225C]
 gi|15074105|emb|CAC45752.1| Probable outer membrane protein [Sinorhizobium meliloti 1021]
 gi|306903952|gb|EFN34538.1| porin [Sinorhizobium meliloti BL225C]
          Length = 212

 Score =  179 bits (455), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 62/222 (27%), Positives = 104/222 (46%), Gaps = 27/222 (12%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYV-PIRHDFNGPYAG 59
           M+ L   +  S++AL +F +A AAD V          VP      Y  P   +++G Y G
Sbjct: 1   MRTLTTTLMASAMALVAFQAAHAADVVDE--------VPAAPAAEYTEPAVRNWSGAYVG 52

Query: 60  LSALYNGSFGEEAHHNAG----GSIFAGYNVEDSCIMYGVEGDVRYTV-PVLADNIHSLH 114
            +  ++    +   +N      G ++ GYNV+D  ++YG E DV YT     +       
Sbjct: 53  GTIDWHHGEADATGNNKSVGFGGGLYGGYNVQDGQMVYGGEADVNYTGNDSRSSGRRVKQ 112

Query: 115 GIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSE 174
           G+ GS+R R G ++ + +L+Y T G  +     +  AG      +G TAGVG E   +++
Sbjct: 113 GVNGSVRGRVGVDL-NPVLVYGTAGVALGNAKLSTPAGSDDKTLVGWTAGVGAET-FVTD 170

Query: 175 SLVARLEYRASKYSKVE-----------GFYNTISLGVGMKF 205
           ++ AR EYR + Y   +              +++ LG+G+KF
Sbjct: 171 NITARAEYRYTDYGSKDFRAGGSTISSGYDEHSVKLGMGVKF 212


>gi|150396008|ref|YP_001326475.1| porin [Sinorhizobium medicae WSM419]
 gi|150027523|gb|ABR59640.1| porin [Sinorhizobium medicae WSM419]
          Length = 212

 Score =  178 bits (452), Expect = 4e-43,   Method: Composition-based stats.
 Identities = 61/222 (27%), Positives = 102/222 (45%), Gaps = 27/222 (12%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYV-PIRHDFNGPYAG 59
           M+ L   +  S++AL +F +A AAD V          +P      Y  P   +++G Y G
Sbjct: 1   MRMLTTTLMASAMALVAFQAAHAADVVDE--------IPAAPAAEYTEPAVRNWSGAYVG 52

Query: 60  LSALYNGSFGEEAHHNAG----GSIFAGYNVEDSCIMYGVEGDVRYTV-PVLADNIHSLH 114
            +  ++    +   +N      G ++ GYNV+D  ++YG E D+ YT     +       
Sbjct: 53  GTIDWHHGEADATGNNKSVGTGGGLYGGYNVQDGQMVYGGEADINYTGNDSHSSGRRVQQ 112

Query: 115 GIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSE 174
           G+ GS+R R G +V + +L+Y T G  +        AG      +G TAGVG E   +++
Sbjct: 113 GLNGSVRARVGVDV-NPVLVYGTAGVALGNAELKTPAGSDDKTLVGWTAGVGAET-FVTD 170

Query: 175 SLVARLEYRASKYSKVE-----------GFYNTISLGVGMKF 205
           ++ AR EYR + Y   +              + + LG+G+KF
Sbjct: 171 NITARAEYRYTDYGSKDFRTGGTTISSGYDEHAVKLGMGVKF 212


>gi|307317731|ref|ZP_07597169.1| porin [Sinorhizobium meliloti AK83]
 gi|306896493|gb|EFN27241.1| porin [Sinorhizobium meliloti AK83]
          Length = 212

 Score =  177 bits (448), Expect = 9e-43,   Method: Composition-based stats.
 Identities = 61/222 (27%), Positives = 104/222 (46%), Gaps = 27/222 (12%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYV-PIRHDFNGPYAG 59
           M+ L   +  S++AL +F +A AAD V          VP      Y  P   +++G Y G
Sbjct: 1   MRTLTTTLMASAMALVAFQAAHAADVVDE--------VPAAPAAEYTEPAVRNWSGAYVG 52

Query: 60  LSALYNGSFGEEAHHNAG----GSIFAGYNVEDSCIMYGVEGDVRYTV-PVLADNIHSLH 114
            +  ++    +   +N      G ++ GY+V+D  ++YG E DV YT     +       
Sbjct: 53  GTIDWHHGEADATGNNKSVGFGGGLYGGYDVQDGQMVYGGEADVNYTGNDSRSSGRRVKQ 112

Query: 115 GIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSE 174
           G+ GS+R R G ++ + +L+Y T G  +     +  AG      +G TAGVG E   +++
Sbjct: 113 GVNGSVRGRVGVDL-NPVLVYGTAGVALGNAKLSTPAGSDDKTLVGWTAGVGAET-FVTD 170

Query: 175 SLVARLEYRASKYSKVE-----------GFYNTISLGVGMKF 205
           ++ AR EYR + Y   +              +++ LG+G+KF
Sbjct: 171 NITARAEYRYTDYGSKDFRAGGSTISSGYDEHSVKLGMGVKF 212


>gi|13476553|ref|NP_108123.1| outer membrane protein [Mesorhizobium loti MAFF303099]
 gi|14027314|dbj|BAB54268.1| outer membrane protein [Mesorhizobium loti MAFF303099]
          Length = 218

 Score =  175 bits (445), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 66/219 (30%), Positives = 93/219 (42%), Gaps = 30/219 (13%)

Query: 6   LAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYN 65
           LAV +   AL    +A AAD V+          P             + GPYAGL+  Y 
Sbjct: 11  LAVALGLFALGG--TAYAADVVQEE--------PPAPAPVAELPVASWAGPYAGLNVGYG 60

Query: 66  GSFGEEAHH--------NAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADN-IHSLHGI 116
            S   +              GS+F GY  +    +YG E ++ Y      DN I+S  G 
Sbjct: 61  FSGRTKEKDFDVSTDTKGFVGSVFGGYQWQQENFVYGGEAELGYNGVKGDDNGINSKAGF 120

Query: 117 GGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGK--AGEITPIAIGGTAGVGVEVGGLSE 174
            GSLR R GY V+  +LLY T G                     +G TAGVG ++  L++
Sbjct: 121 EGSLRARLGYAVTPEILLYGTGGLAGRSLKVEDTVLGVSDRATMLGWTAGVGTDI-KLTD 179

Query: 175 SLVARLEYRASKY--------SKVEGFYNTISLGVGMKF 205
           ++  R+EYR + +         KV+   N ++ GVGMKF
Sbjct: 180 NVFGRVEYRYTDFGSKSFDGIGKVKATDNRVTFGVGMKF 218


>gi|319784400|ref|YP_004143876.1| porin [Mesorhizobium ciceri biovar biserrulae WSM1271]
 gi|317170288|gb|ADV13826.1| porin [Mesorhizobium ciceri biovar biserrulae WSM1271]
          Length = 220

 Score =  175 bits (444), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 68/222 (30%), Positives = 98/222 (44%), Gaps = 34/222 (15%)

Query: 6   LAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYN 65
           LAV +   AL+   +A AAD V           P             + GPYAGL+  Y 
Sbjct: 11  LAVALGLFALSG--TAYAADVVSEE--------PPAPAPIAELPVASWAGPYAGLNVGY- 59

Query: 66  GSFGEEAHHNAG------------GSIFAGYNVEDSCIMYGVEGDVRYTVPVLAD-NIHS 112
           G  G     + G            GS+F GY  +    +YG E ++ Y      D  ++S
Sbjct: 60  GFSGHTKEKDLGVDNVDVGTKGFVGSVFGGYQWQQENFVYGAEAELGYNGVKGDDSGVNS 119

Query: 113 LHGIGGSLRIRGGYEVSDSLLLYATVGPDV-AQKYETGKAGEITPIAIGGTAGVGVEVGG 171
             G  GSLR R GY V+  +LLY T G    + K E    G      +G TAG+G ++  
Sbjct: 120 KAGFEGSLRARLGYAVTPEILLYGTGGLAGRSLKVEDDVYGSDRATLLGWTAGLGTDI-K 178

Query: 172 LSESLVARLEYRASKY--------SKVEGFYNTISLGVGMKF 205
           L++++  R+EYR + +         KV+   N ++ GVGMKF
Sbjct: 179 LTDNVFGRVEYRYTDFGSKSFDGIGKVKATDNRVTFGVGMKF 220


>gi|315121798|ref|YP_004062287.1| outer membrane protein [Candidatus Liberibacter solanacearum
           CLso-ZC1]
 gi|313495200|gb|ADR51799.1| outer membrane protein [Candidatus Liberibacter solanacearum
           CLso-ZC1]
          Length = 231

 Score =  175 bits (443), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 90/232 (38%), Positives = 128/232 (55%), Gaps = 28/232 (12%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVR-----RAHHGGRGVVPTIA-TNRYVPIRHDFN 54
           M+K FLAVGVS+L L SF + QAAD V+     +     RGVVPT+   NRYV  +    
Sbjct: 1   MKKFFLAVGVSTLTLVSFSAVQAADAVQRPQRRQHASVSRGVVPTVVSANRYVYSQQGIE 60

Query: 55  GPYAGLSALYNGSF-GEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADN---- 109
           GPYAG+S  +  +F G++ + + GGS+FAGYNV++    YG E D RY+  + +      
Sbjct: 61  GPYAGMSIFHERNFSGKDHNKDIGGSLFAGYNVQEGDFFYGAEADARYSHDIASKEHKAA 120

Query: 110 ------------IHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQ----KYETGKAGE 153
                       ++      GSLR RGGYE++  +++Y TVG               A  
Sbjct: 121 RLDQKDDAAVSKMYHAADFSGSLRFRGGYEIAAPVVVYGTVGVAAVHKASKAPADAAASP 180

Query: 154 ITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFYNTISLGVGMKF 205
                IGGTAG+GVE   L ++++ R+EYRA+KYS V    N +SLG+G++F
Sbjct: 181 AKAFYIGGTAGLGVE-SVLVDNIIGRVEYRATKYSGVSHLQNVVSLGLGIRF 231


>gi|218663696|ref|ZP_03519626.1| outer membrane protein [Rhizobium etli IE4771]
          Length = 203

 Score =  174 bits (441), Expect = 7e-42,   Method: Composition-based stats.
 Identities = 65/211 (30%), Positives = 103/211 (48%), Gaps = 22/211 (10%)

Query: 9   GVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYN-GS 67
             S+ A+A   +AQAAD V +           +A +  V    ++ G Y G +  YN G 
Sbjct: 1   MASAFAIAGVSAAQAADAVDQVPEA------PVAQDAPVKPAGNWEGFYLGGAGTYNMGD 54

Query: 68  FGEEAH-HNAGGSIFAGYNVEDSCIMYGVEGDVRYTV-PVLADNIHSLHGIGGSLRIRGG 125
           FG + H +  GG +F GYN +   I+YGVE D+ Y+   V +  + + +G  GS+R R G
Sbjct: 55  FGSDRHTYGFGGQVFTGYNWQAGQIVYGVESDLGYSGDDVSSGGVENKYGWNGSVRGRVG 114

Query: 126 YEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRAS 185
           Y++ +  LLY T G  +     +    + +  A G T G GVE   ++ ++  RLEYR +
Sbjct: 115 YDM-NPFLLYGTAGLALGNIKVSDDTSDESKTAYGYTVGAGVEA-FVTNNITTRLEYRYT 172

Query: 186 KYSKVE-----------GFYNTISLGVGMKF 205
            Y   +              N++ LG+G+KF
Sbjct: 173 DYQSKDYDLDSGSFSRGYDENSVKLGIGVKF 203


>gi|222148166|ref|YP_002549123.1| outer membrane protein [Agrobacterium vitis S4]
 gi|221735154|gb|ACM36117.1| outer membrane protein [Agrobacterium vitis S4]
          Length = 212

 Score =  174 bits (440), Expect = 9e-42,   Method: Composition-based stats.
 Identities = 58/222 (26%), Positives = 98/222 (44%), Gaps = 27/222 (12%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVP-IRHDFNGPYAG 59
           M+ L + +  SS  L+    A AAD V          VP       +P    ++ G Y G
Sbjct: 1   MRTLVMILLASSAGLSLVTGAHAADAVMS--------VPEAPAAVDMPAPVSNWAGAYVG 52

Query: 60  LSALYNGSFGEEAHHN---AGGSIFAGYNVEDSCIMYGVEGDVRY--TVPVLADNIHSLH 114
            +  Y       +  +    GG ++ GYN+++  I+YG E D+ Y          ++   
Sbjct: 53  GAGTYTMGRSHGSKFSARAFGGQVYGGYNMQNDKIVYGGEADIGYDGNGSRSGAGLNGKQ 112

Query: 115 GIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSE 174
           G+ GS+R R GY++ +  ++Y T G   A    +G  G  +  A+G T G GVE   ++ 
Sbjct: 113 GVNGSIRGRVGYDL-NPFMVYGTAGVAAADTKISGAGGSDSKAALGYTVGAGVEA-MVTN 170

Query: 175 SLVARLEYRASKYSKVEG-----------FYNTISLGVGMKF 205
           ++  R+EYR + Y   +               ++ +G+GMKF
Sbjct: 171 NITTRVEYRYTDYQNKDYNIGGSKVSRGFDDQSVKVGIGMKF 212


>gi|227821495|ref|YP_002825465.1| putative outer membrane protein [Sinorhizobium fredii NGR234]
 gi|227340494|gb|ACP24712.1| putative outer membrane protein [Sinorhizobium fredii NGR234]
          Length = 212

 Score =  172 bits (437), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 62/222 (27%), Positives = 106/222 (47%), Gaps = 27/222 (12%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYV-PIRHDFNGPYAG 59
           M+ L  A+  S++ L +F +A AAD V          +P      Y  P   +++G Y G
Sbjct: 1   MRTLTTALMASAITLVAFQAAHAADAVEE--------IPAAPAAEYTEPAVKNWSGAYVG 52

Query: 60  LSALYNGSFGEEAHHN----AGGSIFAGYNVEDSCIMYGVEGDVRYTV-PVLADNIHSLH 114
            +A ++    +   +N     GG ++ GYNV+D  ++YG E DV Y      +       
Sbjct: 53  GTANWHYGEADATGNNKSVAFGGGLYGGYNVQDGQMVYGGEADVNYAGNDSTSSGRKVKQ 112

Query: 115 GIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSE 174
           G+ GSLR R G ++ + +L+Y T G  +     +  AG      +G TAG G E   +++
Sbjct: 113 GVNGSLRGRVGVDM-NPVLVYGTAGLALGNAKLSTPAGSDDKTLVGWTAGAGAET-FVTD 170

Query: 175 SLVARLEYRASKYSKVE-----------GFYNTISLGVGMKF 205
           ++ AR+EYR + Y+  +              +++ LG+G+KF
Sbjct: 171 NVTARVEYRYTDYASKDFRAGGSTVSSGYDEHSVRLGMGVKF 212


>gi|159185080|ref|NP_355120.2| outer membrane protein [Agrobacterium tumefaciens str. C58]
 gi|159140353|gb|AAK87905.2| outer membrane protein [Agrobacterium tumefaciens str. C58]
          Length = 209

 Score =  172 bits (436), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 60/217 (27%), Positives = 93/217 (42%), Gaps = 28/217 (12%)

Query: 7   AVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNG 66
            + V+SL   S  +A AAD V           P     +       ++GPY G+      
Sbjct: 3   TLIVTSLLALSASTAMAADAVYE--------TPAPPVAQETLPVFTWSGPYLGIQGGAGW 54

Query: 67  SFGEEA------HHNAGGSI---FAGYNVE-DSCIMYGVEGDVRYTVPVLA-DNIHSLHG 115
           + G+ +        +  G I   FAGYN + D+ ++ G+EGDV Y         I     
Sbjct: 55  ANGDFSAGGPVVSDDFNGGILGAFAGYNYQFDNNMVLGIEGDVDYNWNDNDYSGIKVGTD 114

Query: 116 IGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSES 175
             GS+R R GY   D  L+YAT G    + +     G+      G T G GV+    +++
Sbjct: 115 WQGSVRGRVGYAF-DHALIYATAGWTATRGFIETPVGDDKATFNGYTVGAGVDY-AFTDN 172

Query: 176 LVARLEYRASKYSKVEGF-------YNTISLGVGMKF 205
           +  RLEYR + Y   + F        +T+ +G+G+KF
Sbjct: 173 VFGRLEYRYNDYGDKDIFGINTDFDQHTVKVGLGVKF 209


>gi|116251075|ref|YP_766913.1| outer membrane protein [Rhizobium leguminosarum bv. viciae 3841]
 gi|115255723|emb|CAK06804.1| putative outer membrane protein [Rhizobium leguminosarum bv. viciae
           3841]
 gi|220979415|gb|ACL97989.1| outer membrane protein B2 [Rhizobium leguminosarum bv. viciae]
          Length = 205

 Score =  168 bits (425), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 53/213 (24%), Positives = 84/213 (39%), Gaps = 26/213 (12%)

Query: 7   AVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNG 66
            V  ++L L+    A AAD             P   +   V   +D++G Y G    Y+ 
Sbjct: 5   LVACAALTLSVAVPAVAADLTYE--------TPPAPSAGQVSSAYDWSGFYLGAQGGYSW 56

Query: 67  S----FGEEAHHNAGG-SIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGSLR 121
           S     G +   ++G   + AGYN +   I+YG+E D  Y       N ++      S R
Sbjct: 57  SQATILGSDQDIDSGTSGLHAGYNFQSGNIVYGIENDFNYN---FEKNDNANLEWDASGR 113

Query: 122 IRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLE 181
            R GY    +L            K +   AG+   I IG TAG G+E   ++++++ R E
Sbjct: 114 ARVGYAWDRTLFFATAGVAAGGGKVDIPAAGKKDGILIGWTAGGGIE-HAVTDNILVRAE 172

Query: 182 YRASKYSKVE---------GFYNTISLGVGMKF 205
           YR S +   +            + +  G   KF
Sbjct: 173 YRHSDFGNKDFGSTIGEVGATQDKVLFGTSYKF 205


>gi|241203671|ref|YP_002974767.1| hypothetical protein Rleg_0932 [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240857561|gb|ACS55228.1| conserved hypothetical protein [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 205

 Score =  165 bits (419), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 54/213 (25%), Positives = 84/213 (39%), Gaps = 26/213 (12%)

Query: 7   AVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNG 66
            V  + LAL+    A AAD             P   +   V   +D++G Y G    Y+ 
Sbjct: 5   LVACAVLALSVAVPAVAADLTYE--------TPPAPSAGEVSSAYDWSGFYLGAQGGYSW 56

Query: 67  S----FGEEAHHNAGG-SIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGSLR 121
           S     G +   ++G   + AGYN +   I+YG+E D  Y       N ++      S R
Sbjct: 57  SQAKILGSDQDIDSGTSGLHAGYNFQSGNIVYGIENDFNYN---FEKNDNANLEWDASGR 113

Query: 122 IRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLE 181
            R GY    +L            K +   AG+   I IG TAG G+E   ++++++ R E
Sbjct: 114 ARVGYAWDRTLFFATAGVAAGGGKVDISAAGKKDGILIGWTAGGGIE-HAVTDNILVRGE 172

Query: 182 YRASKYSKVE---------GFYNTISLGVGMKF 205
           YR S +   +            + +  G   KF
Sbjct: 173 YRHSDFGNKDFGSTIGDVGATQDKVLFGTSYKF 205


>gi|209548422|ref|YP_002280339.1| porin [Rhizobium leguminosarum bv. trifolii WSM2304]
 gi|209534178|gb|ACI54113.1| porin [Rhizobium leguminosarum bv. trifolii WSM2304]
          Length = 204

 Score =  162 bits (411), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 51/213 (23%), Positives = 84/213 (39%), Gaps = 27/213 (12%)

Query: 7   AVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNG 66
            +  + LAL++   A AAD                     +   ++++G Y G    Y+ 
Sbjct: 5   LIACAVLALSAAVPAVAADLTYET---------PAPAAEQISSAYNWSGFYLGGQGGYSW 55

Query: 67  S----FGEEAHHNAG-GSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGSLR 121
           S     G + + + G   + AGYN +   I+YG+E D  Y      D   +      S R
Sbjct: 56  SQTKILGSDENIDGGTAGLHAGYNFQSGNIVYGIENDFNYNFKKNDD---ANLEWDASGR 112

Query: 122 IRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLE 181
            R GY ++ +L            K +   AG+   I IG TAG G+E   +++ ++ R E
Sbjct: 113 ARVGYALNRTLFFATAGVAAGGGKVDIPTAGKKDGILIGWTAGGGIE-HAVTDHILVRGE 171

Query: 182 YRASKYSKVE---------GFYNTISLGVGMKF 205
           YR S +S  +            + +  G   KF
Sbjct: 172 YRHSDFSNKDFGSAIGDVGAKQDKVLFGTSYKF 204


>gi|146425515|emb|CAM89327.2| 25 kDa outer membrane protein [Brucella melitensis]
 gi|146425525|emb|CAM89318.2| 25 kDa outer membrane protein [Brucella melitensis]
 gi|146425535|emb|CAM89309.2| 25 kDa outer membrane protein [Brucella melitensis]
 gi|146425545|emb|CAM89300.2| 25 kDa outer membrane protein [Brucella melitensis]
 gi|146425565|emb|CAM89282.2| 25 kDa outer membrane protein [Brucella melitensis]
 gi|146425575|emb|CAM89273.2| 25 kDa outer membrane protein [Brucella melitensis]
 gi|146425585|emb|CAM89264.2| 25 kDa outer membrane protein [Brucella melitensis]
 gi|146425595|emb|CAM89255.2| 25 kDa outer membrane protein [Brucella melitensis]
 gi|146425605|emb|CAM89246.2| 25 kDa outer membrane protein [Brucella melitensis]
 gi|146425615|emb|CAM89237.2| 25 kDa outer membrane protein [Brucella melitensis]
 gi|146425625|emb|CAM89228.2| 25 kDa outer membrane protein [Brucella melitensis]
 gi|146425635|emb|CAM89219.2| 25 kDa outer membrane protein [Brucella melitensis]
 gi|146425645|emb|CAM89210.2| 25 kDa outer membrane protein [Brucella melitensis]
 gi|146425655|emb|CAM89201.2| 25 kDa outer membrane protein [Brucella melitensis]
 gi|146425665|emb|CAM89192.2| 25 kDa outer membrane protein [Brucella melitensis]
 gi|146425675|emb|CAM89183.2| 25 kDa outer membrane protein [Brucella melitensis]
 gi|146425685|emb|CAM89174.2| 25 kDa outer membrane protein [Brucella melitensis]
 gi|146425695|emb|CAM89165.2| 25 kDa outer membrane protein [Brucella melitensis]
 gi|146425705|emb|CAM89156.2| 25 kDa outer membrane protein [Brucella abortus]
 gi|146425715|emb|CAM89147.2| 25 kDa outer membrane protein [Brucella abortus]
 gi|146425725|emb|CAM89138.2| 25 kDa outer membrane protein [Brucella abortus]
 gi|146425735|emb|CAM89129.2| 25 kDa outer membrane protein [Brucella abortus]
 gi|146425745|emb|CAM89120.2| 25 kDa outer membrane protein [Brucella abortus]
 gi|146425755|emb|CAM89111.2| 25 kDa outer membrane protein [Brucella abortus]
 gi|146425765|emb|CAM89102.2| 25 kDa outer membrane protein [Brucella abortus]
 gi|146425775|emb|CAM89093.2| 25 kDa outer membrane protein [Brucella abortus]
 gi|146425785|emb|CAM89084.2| 25 kDa outer membrane protein [Brucella abortus]
 gi|146425795|emb|CAM89075.2| 25 kDa outer membrane protein [Brucella abortus]
 gi|146425805|emb|CAM89066.2| 25 kDa outer membrane protein [Brucella abortus]
 gi|146425815|emb|CAM89057.2| 25 kDa outer membrane protein [Brucella abortus]
 gi|146425825|emb|CAM89048.2| 25 kDa outer membrane protein [Brucella abortus]
 gi|146425835|emb|CAM89039.2| 25 kDa outer membrane protein [Brucella abortus]
 gi|146425845|emb|CAM89030.2| 25 kDa outer membrane protein [Brucella abortus]
 gi|146425855|emb|CAM89021.2| 25 kDa outer membrane protein [Brucella abortus]
 gi|146425865|emb|CAM89012.2| 25 kDa outer membrane protein [Brucella abortus]
 gi|146425875|emb|CAM89003.2| 25 kDa outer membrane protein [Brucella abortus]
 gi|146425885|emb|CAM88994.2| 25 kDa outer membrane protein [Brucella abortus]
 gi|146425895|emb|CAM88985.2| 25 kDa outer membrane protein [Brucella abortus]
 gi|146425905|emb|CAM88976.2| 25 kDa outer membrane protein [Brucella abortus]
 gi|146426370|emb|CAM89822.2| 25 kDa outer membrane protein [Brucella suis]
 gi|146426380|emb|CAM89813.2| 25 kDa outer membrane protein [Brucella suis]
 gi|146426390|emb|CAM89804.2| 25 kDa outer membrane protein [Brucella suis]
 gi|146426400|emb|CAM89795.2| 25 kDa outer membrane protein [Brucella suis]
 gi|146426410|emb|CAM89786.2| 25 kDa outer membrane protein [Brucella suis]
 gi|146426420|emb|CAM89777.2| 25 kDa outer membrane protein [Brucella suis]
 gi|146426430|emb|CAM89768.2| 25 kDa outer membrane protein [Brucella suis]
 gi|146426440|emb|CAM89759.2| 25 kDa outer membrane protein [Brucella suis]
 gi|146426450|emb|CAM89750.2| 25 kDa outer membrane protein [Brucella suis]
 gi|146426460|emb|CAM89741.2| 25 kDa outer membrane protein [Brucella suis]
 gi|146426470|emb|CAM89732.2| 25 kDa outer membrane protein [Brucella suis]
 gi|146426480|emb|CAM89723.2| 25 kDa outer membrane protein [Brucella suis]
 gi|146426490|emb|CAM89714.2| 25 kDa outer membrane protein [Brucella suis]
 gi|146426500|emb|CAM89705.2| 25 kDa outer membrane protein [Brucella suis]
 gi|146426510|emb|CAM89696.2| 25 kDa outer membrane protein [Brucella suis]
 gi|146426520|emb|CAM89687.2| 25 kDa outer membrane protein [Brucella suis]
 gi|146426530|emb|CAM89678.2| 25 kDa outer membrane protein [Brucella suis]
 gi|146426540|emb|CAM89669.2| 25 kDa outer membrane protein [Brucella suis]
 gi|146426550|emb|CAM89660.2| 25 kDa outer membrane protein [Brucella suis]
 gi|146426560|emb|CAM89651.2| 25 kDa outer membrane protein [Brucella suis]
 gi|146426570|emb|CAM89642.2| 25 kDa outer membrane protein [Brucella suis]
 gi|146426580|emb|CAM89633.2| 25 kDa outer membrane protein [Brucella suis]
 gi|146426590|emb|CAM89624.2| 25 kDa outer membrane protein [Brucella suis]
 gi|146426600|emb|CAM89615.2| 25 kDa outer membrane protein [Brucella suis]
 gi|146426610|emb|CAM89606.2| 25 kDa outer membrane protein [Brucella suis]
 gi|146426620|emb|CAM89597.2| 25 kDa outer membrane protein [Brucella suis]
 gi|146426630|emb|CAM89588.2| 25 kDa outer membrane protein [Brucella suis]
 gi|146426640|emb|CAM89579.2| 25 kDa outer membrane protein [Brucella suis]
 gi|146426650|emb|CAM89570.2| 25 kDa outer membrane protein [Brucella suis]
 gi|146426660|emb|CAM89561.2| 25 kDa outer membrane protein [Brucella suis]
 gi|146426670|emb|CAM89552.2| 25 kDa outer membrane protein [Brucella suis ATCC 23445]
 gi|146426680|emb|CAM89543.2| 25 kDa outer membrane protein [Brucella suis]
 gi|146426690|emb|CAM89534.2| 25 kDa outer membrane protein [Brucella suis]
 gi|146426700|emb|CAM89525.2| 25 kDa outer membrane protein [Brucella suis]
 gi|146426710|emb|CAM89516.2| 25 kDa outer membrane protein [Brucella suis]
 gi|146426720|emb|CAM89507.2| 25 kDa outer membrane protein [Brucella suis]
 gi|146426730|emb|CAM89498.2| 25 kDa outer membrane protein [Brucella suis]
 gi|146426740|emb|CAM89489.2| 25 kDa outer membrane protein [Brucella suis]
 gi|146426750|emb|CAM89480.2| 25 kDa outer membrane protein [Brucella suis]
 gi|146426760|emb|CAM89471.2| 25 kDa outer membrane protein [Brucella suis]
 gi|146426770|emb|CAM89462.2| 25 kDa outer membrane protein [Brucella suis]
 gi|146426780|emb|CAM89453.2| 25 kDa outer membrane protein [Brucella suis 1330]
 gi|146426900|emb|CAM89345.2| 25 kDa outer membrane protein [Brucella melitensis]
 gi|146426910|emb|CAM89336.2| 25 kDa outer membrane protein [Brucella melitensis]
 gi|146427366|emb|CAM90326.2| 25 kDa outer membrane protein [Brucella sp. 5/95]
 gi|146427376|emb|CAM90317.2| 25 kDa outer membrane protein [Brucella sp. 59/94]
 gi|146427386|emb|CAM90308.2| 25 kDa outer membrane protein [Brucella sp. UK28/03-13840]
 gi|146427396|emb|CAM90299.2| 25 kDa outer membrane protein [Brucella sp. F7/99]
 gi|146427406|emb|CAM90290.2| 25 kDa outer membrane protein [Brucella sp. F10/99]
 gi|146427416|emb|CAM90281.2| 25 kDa outer membrane protein [Brucella sp. F9/99]
 gi|146427426|emb|CAM90272.2| 25 kDa outer membrane protein [Brucella sp. F8/99]
 gi|146427436|emb|CAM90263.2| 25 kDa outer membrane protein [Brucella sp. F6/99]
 gi|146427446|emb|CAM90254.2| 25 kDa outer membrane protein [Brucella sp. UK5/01]
 gi|146427456|emb|CAM90245.2| 25 kDa outer membrane protein [Brucella sp. UK40/99]
 gi|146427466|emb|CAM90236.2| 25 kDa outer membrane protein [Brucella sp. UK13/99]
 gi|146427476|emb|CAM90227.2| 25 kDa outer membrane protein [Brucella sp. 61/94]
 gi|146427486|emb|CAM90218.2| 25 kDa outer membrane protein [Brucella sp. 4/96]
 gi|146427496|emb|CAM90209.2| 25 kDa outer membrane protein [Brucella sp. 55/94]
 gi|146427506|emb|CAM90200.2| 25 kDa outer membrane protein [Brucella sp. UK24/00 (M192)]
 gi|146427516|emb|CAM90191.2| 25 kDa outer membrane protein [Brucella sp. 44/94]
 gi|146427526|emb|CAM90182.2| 25 kDa outer membrane protein [Brucella sp. 39/94]
 gi|146427536|emb|CAM90173.2| 25 kDa outer membrane protein [Brucella sp. UK31/04]
 gi|146427546|emb|CAM90164.2| 25 kDa outer membrane protein [Brucella sp. VLA04/06]
 gi|146427556|emb|CAM90155.2| 25 kDa outer membrane protein [Brucella sp. VLA04/105]
 gi|146427566|emb|CAM90146.2| 25 kDa outer membrane protein [Brucella sp. VLA04.72]
 gi|146427576|emb|CAM90137.2| 25 kDa outer membrane protein [Brucella sp. VLA04.67]
 gi|146427586|emb|CAM90128.2| 25 kDa outer membrane protein [Brucella sp. F96/2]
 gi|146427596|emb|CAM90119.2| 25 kDa outer membrane protein [Brucella sp. F23/97]
 gi|146427606|emb|CAM90110.2| 25 kDa outer membrane protein [Brucella sp. UK15/02]
 gi|146427616|emb|CAM90101.2| 25 kDa outer membrane protein [Brucella sp. UK10/01]
 gi|146427626|emb|CAM90092.2| 25 kDa outer membrane protein [Brucella sp. UK4/01]
 gi|146427636|emb|CAM90083.2| 25 kDa outer membrane protein [Brucella sp. UK10/00]
 gi|146427646|emb|CAM90074.2| 25 kDa outer membrane protein [Brucella sp. UK5/97]
 gi|146427656|emb|CAM90065.2| 25 kDa outer membrane protein [Brucella sp. UK3/97]
 gi|146427666|emb|CAM90056.2| 25 kDa outer membrane protein [Brucella sp. UK1/97]
 gi|146427676|emb|CAM90047.2| 25 kDa outer membrane protein [Brucella sp. 2/96]
 gi|146427686|emb|CAM90038.2| 25 kDa outer membrane protein [Brucella sp. 14/95]
 gi|146427696|emb|CAM90029.2| 25 kDa outer membrane protein [Brucella sp. UK35/99]
 gi|146427706|emb|CAM90020.2| 25 kDa outer membrane protein [Brucella sp. UK15/98]
 gi|146427716|emb|CAM90011.2| 25 kDa outer membrane protein [Brucella sp. 52/94]
 gi|146427726|emb|CAM90002.2| 25 kDa outer membrane protein [Brucella sp. 36/94]
 gi|146427846|emb|CAM89894.2| 25 kDa outer membrane protein [Brucella suis]
 gi|146427856|emb|CAM89885.2| 25 kDa outer membrane protein [Brucella suis]
 gi|146427866|emb|CAM89876.2| 25 kDa outer membrane protein [Brucella suis]
 gi|146427876|emb|CAM89867.2| 25 kDa outer membrane protein [Brucella suis]
 gi|146427886|emb|CAM89858.2| 25 kDa outer membrane protein [Brucella suis]
 gi|146427896|emb|CAM89849.2| 25 kDa outer membrane protein [Brucella suis]
 gi|146427906|emb|CAM89840.2| 25 kDa outer membrane protein [Brucella suis]
 gi|146427916|emb|CAM89831.2| 25 kDa outer membrane protein [Brucella suis]
 gi|146427988|emb|CAM90407.2| 25 kDa outer membrane protein [Brucella sp. F5/02]
 gi|146428001|emb|CAM90398.2| 25 kDa outer membrane protein [Brucella sp. F5/99]
 gi|146428011|emb|CAM90389.2| 25 kDa outer membrane protein [Brucella sp. VLA05/8]
 gi|146428021|emb|CAM90380.2| 25 kDa outer membrane protein [Brucella sp. VLA05/4]
 gi|146428031|emb|CAM90371.2| 25 kDa outer membrane protein [Brucella sp. UK3/05]
 gi|146428041|emb|CAM90362.2| 25 kDa outer membrane protein [Brucella sp. 14/94]
 gi|146428051|emb|CAM90353.2| 25 kDa outer membrane protein [Brucella sp. UK2/2000]
 gi|146428061|emb|CAM90344.2| 25 kDa outer membrane protein [Brucella sp. UK1/2000]
 gi|146428071|emb|CAM90335.2| 25 kDa outer membrane protein [Brucella sp. UK43/99]
 gi|170015689|emb|CAP05282.1| 25 kDa outer membrane protein [Brucella sp. BO1]
          Length = 163

 Score =  162 bits (411), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 51/173 (29%), Positives = 77/173 (44%), Gaps = 22/173 (12%)

Query: 7   AVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNG 66
            V VS+  L    +A AAD ++          P +     V  ++ + G Y GL   Y G
Sbjct: 1   LVIVSAALLPFSATAFAADAIQEQ--------PPVPAPVEVAPQYSWAGGYTGL---YLG 49

Query: 67  SFGEEAHHNAGGSI---------FAGYNVEDSCIMYGVEGDVRYTVPVLA-DNIHSLHGI 116
               +A  +  GSI         FAG+N +   I+YGVEGD  Y+    + D +    G 
Sbjct: 50  YGWNKAKTSTVGSIKPDDWKAGAFAGWNFQQDQIVYGVEGDAGYSWAKKSKDGLEVKQGF 109

Query: 117 GGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEV 169
            GSLR R GY++ + ++ Y T G   +Q        + +   +G TAG G+E 
Sbjct: 110 EGSLRARVGYDL-NPVMPYLTAGIAGSQIKLNNGLDDESKFRVGWTAGAGLEA 161


>gi|325293521|ref|YP_004279385.1| Outer membrane protein [Agrobacterium sp. H13-3]
 gi|325061374|gb|ADY65065.1| Outer membrane protein [Agrobacterium sp. H13-3]
          Length = 210

 Score =  162 bits (409), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 58/218 (26%), Positives = 94/218 (43%), Gaps = 29/218 (13%)

Query: 7   AVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNG 66
            + V+SL   S  +A AAD V           P     +       ++GPY G+      
Sbjct: 3   TLIVTSLLALSASTAMAADAVYE--------TPAPPVAQETLPVFTWSGPYLGIQGGAGW 54

Query: 67  SFGEE------AHHNAGGSI---FAGYNVE-DSCIMYGVEGDVRYTVPVLA-DNIHSLHG 115
           + G+       A  +  G I   FAGYN + D+  + G+EGDV Y         ++    
Sbjct: 55  ANGDFSAGGPVASDSFDGGILGAFAGYNYQFDNNFVLGIEGDVDYNWNDNDYAGVNIGTD 114

Query: 116 IGGSLRIRGGYEVSDSLLLYATVGPDVAQKYET-GKAGEITPIAIGGTAGVGVEVGGLSE 174
             GS+R R GY   D  L+Y T G    + +     AG+ +    G T G G++    ++
Sbjct: 115 WQGSVRGRVGYAF-DRALIYGTAGWTATRGFIETPGAGKDSTTFNGYTVGAGLDY-AFTD 172

Query: 175 SLVARLEYRASKYSKVEGF-------YNTISLGVGMKF 205
           ++  R+EYR + Y   + F        +T+ +G+G+KF
Sbjct: 173 NVFGRIEYRYNDYGDKDIFGVNTDFDQSTVKVGLGVKF 210


>gi|146427796|emb|CAM89939.2| 25 kDa outer membrane protein [Brucella canis]
 gi|146427806|emb|CAM89930.2| 25 kDa outer membrane protein [Brucella canis]
 gi|146427816|emb|CAM89921.2| 25 kDa outer membrane protein [Brucella canis]
 gi|146427826|emb|CAM89912.2| 25 kDa outer membrane protein [Brucella canis]
 gi|146427836|emb|CAM89903.2| 25 kDa outer membrane protein [Brucella canis]
          Length = 163

 Score =  161 bits (408), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 51/173 (29%), Positives = 77/173 (44%), Gaps = 22/173 (12%)

Query: 7   AVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNG 66
            V VS+  L    +A AAD ++          P +     V  ++ + G Y GL   Y G
Sbjct: 1   LVIVSAALLPFSATAFAADAIQEQ--------PPVPAPVEVAPQYSWAGGYTGL---YLG 49

Query: 67  SFGEEAHHNAGGSI---------FAGYNVEDSCIMYGVEGDVRYTVPVLA-DNIHSLHGI 116
               +A  +  GSI         FAG+N +   I+YGVEGD  Y+    + D +    G 
Sbjct: 50  YGWNKAKTSTVGSIKPDDWKAGAFAGWNFQKDQIVYGVEGDAGYSWAKKSKDGLEVKQGF 109

Query: 117 GGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEV 169
            GSLR R GY++ + ++ Y T G   +Q        + +   +G TAG G+E 
Sbjct: 110 EGSLRARVGYDL-NPVMPYLTAGIAGSQIKLNNGLDDESKFRVGWTAGAGLEA 161


>gi|31322670|gb|AAP22071.1| outer membrane protein [Sinorhizobium fredii]
          Length = 212

 Score =  161 bits (408), Expect = 5e-38,   Method: Composition-based stats.
 Identities = 58/222 (26%), Positives = 99/222 (44%), Gaps = 27/222 (12%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYV-PIRHDFNGPYAG 59
           M+ L   +  S++AL +  +A AAD V          VP      Y  P   +++G Y G
Sbjct: 1   MRTLTTTLMASAIALVALQAAHAADAVDE--------VPAAPAAEYTDPAVKNWSGAYVG 52

Query: 60  LSALYNGSFGEEAHHNAGGSIFAGY----NVEDSCIMYGVEGDVRYTV-PVLADNIHSLH 114
            +A ++    +    N       G     NV+D  ++YG E DV Y      +       
Sbjct: 53  GTANWHHGEADATGGNTSAGFGGGLYGGYNVQDGQMVYGGEADVNYAGNDSHSSGRRVKQ 112

Query: 115 GIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSE 174
           G+ GS+R R G ++ + +L+Y T G  +     +  AG      +G TAG G E   +++
Sbjct: 113 GVNGSVRGRVGVDL-NPVLVYGTAGLALGNAKLSTPAGSDDKTLVGWTAGAGAET-FVTD 170

Query: 175 SLVARLEYRASKYSKVE-----------GFYNTISLGVGMKF 205
           ++ AR+EYR + Y+  +              +++ LG+G+KF
Sbjct: 171 NVTARVEYRYTDYASKDFRTGGSTVSSGYDEHSVKLGMGVKF 212


>gi|146425555|emb|CAM89291.2| 25 kDa outer membrane protein [Brucella melitensis]
          Length = 163

 Score =  161 bits (407), Expect = 5e-38,   Method: Composition-based stats.
 Identities = 51/173 (29%), Positives = 77/173 (44%), Gaps = 22/173 (12%)

Query: 7   AVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNG 66
            V VS+  L    +A AAD ++          P +     V  ++ + G Y GL   Y G
Sbjct: 1   LVIVSAALLPFSATAFAADAIQEQ--------PPVPAPVEVAPQYSWAGGYTGL---YLG 49

Query: 67  SFGEEAHHNAGGSI---------FAGYNVEDSCIMYGVEGDVRYTVPVLA-DNIHSLHGI 116
               +A  +  GSI         FAG+N +   I+YGVEGD  Y+    + D +    G 
Sbjct: 50  YGWNKAKTSTVGSIKPDDWKAGAFAGWNFQQDQIVYGVEGDAGYSWAKKSKDGLEVKQGF 109

Query: 117 GGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEV 169
            GSLR R GY++ + ++ Y T G   +Q        + +   +G TAG G+E 
Sbjct: 110 EGSLRARVGYDL-NPVMPYLTAGIVGSQIKLNNGLDDESKFRVGWTAGAGLEA 161


>gi|146426790|emb|CAM89444.2| 25 kDa outer membrane protein [Brucella ovis]
 gi|146426800|emb|CAM89435.2| 25 kDa outer membrane protein [Brucella ovis]
 gi|146426810|emb|CAM89426.2| 25 kDa outer membrane protein [Brucella ovis]
 gi|146426820|emb|CAM89417.2| 25 kDa outer membrane protein [Brucella ovis]
 gi|146426830|emb|CAM89408.2| 25 kDa outer membrane protein [Brucella ovis]
 gi|146426840|emb|CAM89399.2| 25 kDa outer membrane protein [Brucella ovis]
 gi|146426850|emb|CAM89390.2| 25 kDa outer membrane protein [Brucella ovis]
 gi|146426860|emb|CAM89381.2| 25 kDa outer membrane protein [Brucella ovis]
 gi|146426870|emb|CAM89372.2| 25 kDa outer membrane protein [Brucella ovis]
 gi|146426880|emb|CAM89363.2| 25 kDa outer membrane protein [Brucella ovis]
 gi|146426890|emb|CAM89354.2| 25 kDa outer membrane protein [Brucella ovis]
          Length = 163

 Score =  160 bits (406), Expect = 7e-38,   Method: Composition-based stats.
 Identities = 50/173 (28%), Positives = 77/173 (44%), Gaps = 22/173 (12%)

Query: 7   AVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNG 66
            V VS+  L    +A AAD ++          P +     V  ++ + G Y GL   Y G
Sbjct: 1   LVIVSAALLPFSATAFAADAIQEQ--------PPVPAPVEVAPQYSWAGGYTGL---YLG 49

Query: 67  SFGEEAHHNAGGSI---------FAGYNVEDSCIMYGVEGDVRYTVPVLA-DNIHSLHGI 116
               +A  +  GSI         FAG+N +   I+YGVEG+  Y+    + D +    G 
Sbjct: 50  YGWNKAKTSTVGSIKPDDWKAGAFAGWNFQQDQIVYGVEGNAGYSWAKKSKDGLEVKQGF 109

Query: 117 GGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEV 169
            GSLR R GY++ + ++ Y T G   +Q        + +   +G TAG G+E 
Sbjct: 110 EGSLRARVGYDL-NPVMPYLTAGIAGSQIKLNNGLDDESKFRVGWTAGAGLEA 161


>gi|15888468|ref|NP_354149.1| outer membrane protein [Agrobacterium tumefaciens str. C58]
 gi|18139945|gb|AAL60203.1|AF445083_1 outer membrane protein [Agrobacterium tumefaciens str. C58]
 gi|15156164|gb|AAK86934.1| outer membrane protein [Agrobacterium tumefaciens str. C58]
          Length = 218

 Score =  160 bits (406), Expect = 7e-38,   Method: Composition-based stats.
 Identities = 62/228 (27%), Positives = 98/228 (42%), Gaps = 33/228 (14%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIR-HDFNGPYAG 59
           M+     +  S++A A F +A AAD V          VP        P    D++G Y G
Sbjct: 1   MRIFVATLMASTMAAAGFSAAYAADAVNE--------VPQAPVAYDQPAAVKDWSGAYLG 52

Query: 60  LSALYNGSFGEEAHHNAGG-----SIFAGYNVEDSCIMYGVEGDVRY------TVPVLAD 108
            +  Y+      ++           ++ GYN++   I+YG E DV           V   
Sbjct: 53  GTVNYDWGRFSSSNDGRDAKGFGGGVYGGYNMQSGQIVYGAEADVNMGDEKGSAGTVAGR 112

Query: 109 NIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVE 168
            +    G+ GSLR R GY++ +  LLY T G  V+         + +  A+G T G GVE
Sbjct: 113 AVEGKQGVNGSLRGRVGYDM-NPFLLYGTAGLAVSDNKVRDGVNKDSATALGYTVGAGVE 171

Query: 169 VGGLSESLVARLEYRASKYSKVEGF-----------YNTISLGVGMKF 205
              +++++ ARLEYR S Y K +              +++  G+G+KF
Sbjct: 172 A-MVTDNITARLEYRYSDYQKKDYTLGNDAFSRGFDDHSVKAGIGVKF 218


>gi|146427766|emb|CAM89966.2| 25 kDa outer membrane protein [Brucella canis]
 gi|146427776|emb|CAM89957.2| 25 kDa outer membrane protein [Brucella canis]
 gi|146427786|emb|CAM89948.2| 25 kDa outer membrane protein [Brucella canis]
          Length = 163

 Score =  160 bits (405), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 51/173 (29%), Positives = 76/173 (43%), Gaps = 22/173 (12%)

Query: 7   AVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNG 66
            V VS+  L    +A AAD ++          P +     V  ++ + G Y GL   Y G
Sbjct: 1   LVIVSAALLPFSATAFAADAIQEQ--------PPVPAPVEVAPQYSWAGGYTGL---YLG 49

Query: 67  SFGEEAHHNAGGSI---------FAGYNVEDSCIMYGVEGDVRYTVPVLA-DNIHSLHGI 116
               +A  +  GSI         FAG+N +   I+YGVEGD  Y+    + D      G 
Sbjct: 50  YGWNKAKTSTVGSIKPDDWKAGAFAGWNFQKDQIVYGVEGDAGYSWAKKSKDGPEVKQGF 109

Query: 117 GGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEV 169
            GSLR R GY++ + ++ Y T G   +Q        + +   +G TAG G+E 
Sbjct: 110 EGSLRARVGYDL-NPVMPYLTAGIAGSQIKLNNGLDDESKFRVGWTAGAGLEA 161


>gi|146427736|emb|CAM89993.2| 25 kDa outer membrane protein [Brucella neotomae]
 gi|146427746|emb|CAM89984.2| 25 kDa outer membrane protein [Brucella neotomae]
 gi|146427756|emb|CAM89975.2| 25 kDa outer membrane protein [Brucella neotomae]
          Length = 163

 Score =  159 bits (403), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 51/173 (29%), Positives = 77/173 (44%), Gaps = 22/173 (12%)

Query: 7   AVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNG 66
            V VS+  L    +A AAD ++          P +     V  ++ + G Y GL   Y G
Sbjct: 1   LVIVSAALLPFSATAFAADAIQEQ--------PPVPAPVEVAPQYSWAGGYTGL---YLG 49

Query: 67  SFGEEAHHNAGGSI---------FAGYNVEDSCIMYGVEGDVRYTVPVLA-DNIHSLHGI 116
               +A  +  GSI         FAG+N +   I+YGVEGD  Y+    + D +    G 
Sbjct: 50  YGWNKAKTSTVGSIKPDDWKAGAFAGWNFQQDQIVYGVEGDAGYSWAKKSKDGLEVKQGF 109

Query: 117 GGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEV 169
            GSLR R GY++ + ++ Y T G   +Q        + +   +G TAG G+E 
Sbjct: 110 EGSLRARVGYDL-NLVMPYLTAGIAGSQIKLNNGLDDESKFRVGWTAGAGLEA 161


>gi|110634323|ref|YP_674531.1| OmpA-like transmembrane region [Mesorhizobium sp. BNC1]
 gi|110285307|gb|ABG63366.1| OmpA-like transmembrane region [Chelativorans sp. BNC1]
          Length = 216

 Score =  159 bits (401), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 65/201 (32%), Positives = 93/201 (46%), Gaps = 22/201 (10%)

Query: 20  SAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALY--------NGSFGEE 71
            A AAD +                   V     + GPYAG++  Y        +G+ GE 
Sbjct: 23  PAYAADVIMEQPPAPPAA------PMEVAPVATWAGPYAGIALGYGFSGEVSADGAPGEV 76

Query: 72  AHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTV-PVLADNIHSLHGIGGSLRIRGGYEVSD 130
                 G++F G+  +    +YGVEGD+ Y         +   HG+ GSLR R GY  +D
Sbjct: 77  ETDGFVGNVFGGWQGQSGQFVYGVEGDIGYNGMEGSEGGVDVEHGVDGSLRARLGYAATD 136

Query: 131 SLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYS-- 188
           ++LLYAT G   ++   +G     +  A+G TAG GV+V  L+    ARLEYR +  S  
Sbjct: 137 NVLLYATGGGAASRLEASGGGLTESETAVGWTAGAGVDV-KLTPKSFARLEYRYTDLSAE 195

Query: 189 ----KVEGFYNTISLGVGMKF 205
                V+   N + LGVGM+F
Sbjct: 196 FDSVDVDTTSNKVMLGVGMQF 216


>gi|325292505|ref|YP_004278369.1| outer membrane protein [Agrobacterium sp. H13-3]
 gi|325060358|gb|ADY64049.1| outer membrane protein [Agrobacterium sp. H13-3]
          Length = 218

 Score =  157 bits (398), Expect = 6e-37,   Method: Composition-based stats.
 Identities = 61/227 (26%), Positives = 103/227 (45%), Gaps = 31/227 (13%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+     +  S++A A F +A AAD V             +A ++  P++ ++ G Y G 
Sbjct: 1   MRIFVATIMASTIAAAGFSAAHAADAVNDVPQA------PVAYDQPAPVK-NWTGAYLGG 53

Query: 61  SALYNGSFGEEAHHNAGG-----SIFAGYNVEDSCIMYGVEGDVRY------TVPVLADN 109
           +A Y+      ++           I+ GYN+++  I+YG E DV           V  + 
Sbjct: 54  TANYDWGRFSSSNDGRDAKGAGGGIYGGYNMQNGQIVYGAEADVNLGRERGSAGTVGGNA 113

Query: 110 IHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEV 169
           +    G+ GSLR R GY++ +  LLY T G   +         + +  A+G T G GVE 
Sbjct: 114 VEGKQGVNGSLRARVGYDM-NPFLLYGTAGLAASDNKVRDATSKDSATALGYTVGAGVEA 172

Query: 170 GGLSESLVARLEYRASKYSKVEG-----------FYNTISLGVGMKF 205
             +++++ ARLEYR S Y K +              +++  G+G+KF
Sbjct: 173 -MVTDNITARLEYRYSDYQKKDYSLDSGAFSRGFDDHSVKAGIGVKF 218


>gi|307944219|ref|ZP_07659560.1| 22 kDa outer membrane protein [Roseibium sp. TrichSKD4]
 gi|307772565|gb|EFO31785.1| 22 kDa outer membrane protein [Roseibium sp. TrichSKD4]
          Length = 242

 Score =  157 bits (397), Expect = 9e-37,   Method: Composition-based stats.
 Identities = 58/232 (25%), Positives = 90/232 (38%), Gaps = 35/232 (15%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M++L  A   +++++A    + AAD  + A        P          R D++G YAG 
Sbjct: 19  MKRLACAAIAATVSVAGLAPSYAADLPQAAPTYDTTYEPAP------SGRFDWSGAYAGG 72

Query: 61  SALYNGSFGEEAH----------HNAGGSIFAGYNVE-DSCIMYGVEGDVRYTVPVLAD- 108
           S  +  S  +             +   G +  GYN      I+ GVE D + T       
Sbjct: 73  SLGWVWSGFDTTSSPTGSFDHDTNGFSGGVHGGYNFAITPNIVAGVELDFQMTDLYENTV 132

Query: 109 ----NIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAG 164
               N+ +      S R R GY + D  L+Y T G  +A              A+G TAG
Sbjct: 133 RNGVNVKTSSAWNSSARARLGYAM-DRFLVYGTAGLAIADLSINANGASEDTTALGWTAG 191

Query: 165 VGVEVGGLSESLVARLEYRASKYS-----------KVEGFYNTISLGVGMKF 205
            GVE G +S +L AR+EY    +            + +   +T+  G+  KF
Sbjct: 192 AGVE-GAISNNLTARVEYLYQDFGRESFTLGGSKYRADLDTSTVRFGLSYKF 242


>gi|114705635|ref|ZP_01438538.1| outer membrane protein [Fulvimarina pelagi HTCC2506]
 gi|114538481|gb|EAU41602.1| outer membrane protein [Fulvimarina pelagi HTCC2506]
          Length = 228

 Score =  154 bits (389), Expect = 8e-36,   Method: Composition-based stats.
 Identities = 56/217 (25%), Positives = 90/217 (41%), Gaps = 26/217 (11%)

Query: 13  LALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSFGEE- 71
           LA  +     AA P     +      P        P    ++GPYAG    YN S  +  
Sbjct: 14  LATIALALPLAAMPAHAQDNASETAFPDSRIPESAPPVAIWSGPYAGTFVGYNVSRFDNL 73

Query: 72  -----AHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTV-------PVLADNIHSLHGIGGS 119
                +     G  +AG+N++D  ++YGVEGDV            +   ++     + GS
Sbjct: 74  RGASISGDGVAGGAYAGFNLQDGSLVYGVEGDVGGAGFDATRRNALGNLDLSGESNVFGS 133

Query: 120 LRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVAR 179
           LR R G +V D  L+Y T G  +A+   +      +  ++G T G GVE   +++S+  R
Sbjct: 134 LRGRVGVDV-DPFLVYGTGGLAIAETELSLGGVSDSEASVGYTIGAGVEAQ-VTDSIRTR 191

Query: 180 LEYRASKYSKVEG-----------FYNTISLGVGMKF 205
           LEYR S +   +              +++  GV + F
Sbjct: 192 LEYRYSDFGSSDYDLGRTSVSSGFDEHSVRAGVSLNF 228


>gi|163759157|ref|ZP_02166243.1| outer membrane protein [Hoeflea phototrophica DFL-43]
 gi|162283561|gb|EDQ33846.1| outer membrane protein [Hoeflea phototrophica DFL-43]
          Length = 212

 Score =  152 bits (383), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 63/221 (28%), Positives = 95/221 (42%), Gaps = 25/221 (11%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+   LA+  ++L++       AAD +           P       +P    + G Y G 
Sbjct: 1   MRIRKLALLAAALSVPLATPVLAADAILEQP-------PVPPVAETLPQSFIWTGGYVGG 53

Query: 61  SALYNGSFGEE----AHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLA-DNIHSLHG 115
              Y     +          GG ++ GYN +   I+YGVEGD+ Y+    +   +    G
Sbjct: 54  YGEYKWGEFDALAGDDADGFGGGVYGGYNWQSDNIVYGVEGDLGYSGADASLGGVTGEQG 113

Query: 116 IGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSES 175
             GSLR R GY++ +  LLYAT G    +   T  AG  T   +G TAG G E   ++E+
Sbjct: 114 FNGSLRARLGYDI-NPFLLYATGGLAATRAEVTSAAGSDTNTHLGWTAGAGAEA-FVTEN 171

Query: 176 LVARLEYRASKYSKVEG-----------FYNTISLGVGMKF 205
           +  RLEYR + Y                  +++ LG+GMKF
Sbjct: 172 ITTRLEYRYTDYGSETYNLGGTNVSSGFDDHSVRLGIGMKF 212


>gi|332717162|ref|YP_004444628.1| 25 kDa outer-membrane immunogenic protein [Agrobacterium sp. H13-3]
 gi|325063847|gb|ADY67537.1| 25 kDa outer-membrane immunogenic protein [Agrobacterium sp. H13-3]
          Length = 223

 Score =  147 bits (370), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 60/226 (26%), Positives = 89/226 (39%), Gaps = 32/226 (14%)

Query: 2   QKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLS 61
           + L  ++    L      ++ AAD V        G +P       V     ++G Y G S
Sbjct: 8   RMLKQSLLALGLLGILSDASVAADAV--------GDIPAAPVVNDVAPAFSWDGVYVGAS 59

Query: 62  ALYNGS------FGEEAHHNAGGS---IFAGYNVE-DSCIMYGVEGDVRYTV-PVLADNI 110
           A Y  +      FG    H   G     FAGYN E    I+ GVEGD+ Y          
Sbjct: 60  AGYGWNRVKSTTFGVTTKHEFDGGRFSGFAGYNAEVAPSIILGVEGDLGYAWGDKTIVTS 119

Query: 111 HSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVG 170
               G+ GS R+R GY + D  L+Y   G            GE + +  G T G GV+  
Sbjct: 120 EVSAGLNGSARLRAGYAI-DRALIYTAAGYTATDSEVKAPFGEDSKVLHGWTVGAGVDY- 177

Query: 171 GLSESLVARLEYRASKYSKV-----------EGFYNTISLGVGMKF 205
             + +L  R+EYR + + K            +   + + +G+G+KF
Sbjct: 178 AFTNNLFGRVEYRYNDFGKATYHTGPITSTGDVSEHVVKVGLGVKF 223


>gi|190891678|ref|YP_001978220.1| outer membrane protein [Rhizobium etli CIAT 652]
 gi|218510868|ref|ZP_03508746.1| outer membrane protein [Rhizobium etli Brasil 5]
 gi|190696957|gb|ACE91042.1| outer membrane protein [Rhizobium etli CIAT 652]
          Length = 207

 Score =  146 bits (369), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 51/217 (23%), Positives = 83/217 (38%), Gaps = 30/217 (13%)

Query: 7   AVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNG 66
               ++       +A AAD V+         VPT            ++GPY G+      
Sbjct: 3   LTIATAFLALVATTAFAADVVQD--------VPTAPVA--AAPVFTWSGPYFGIDGGAGW 52

Query: 67  ------SFGEEAHHNAGGSIF---AGYNVEDSCIMYGVEGDVRYTVPVLAD-NIHSLHGI 116
                 + G  A  +  G +F   AGYN +   I+ G+EG++ +                
Sbjct: 53  LNGDFSAGGASADEDFNGGVFGAFAGYNFQFDNIVVGIEGNIEHNWNEEDALGADVGTDW 112

Query: 117 GGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKA-GEITPIAIGGTAGVGVEVGGLSES 175
            G++R R GY   D  L+Y   G    + Y       + T    G T G GV+   ++ +
Sbjct: 113 AGAVRGRVGYAF-DKALIYGAAGWAATRGYVDAPGFDKETETFNGYTVGAGVDF-AITNN 170

Query: 176 LVARLEYRASKYS-------KVEGFYNTISLGVGMKF 205
           + AR EYR + Y         V+   + +  G+G+KF
Sbjct: 171 IFARGEYRYNDYGEKDILGVDVDLDQHELKFGIGVKF 207


>gi|150396648|ref|YP_001327115.1| porin [Sinorhizobium medicae WSM419]
 gi|150028163|gb|ABR60280.1| porin [Sinorhizobium medicae WSM419]
          Length = 215

 Score =  143 bits (361), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 62/220 (28%), Positives = 93/220 (42%), Gaps = 20/220 (9%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M +  L    ++  L     A AAD            V T+ +  +        G    L
Sbjct: 1   MIRNVLVAIFAAFMLGG--KAHAADL--AQPPEPTPTVETVHSFVWTGGYLGLQGGGGWL 56

Query: 61  SALYNGSFGEEAHHNAGG--SIFAGYNVEDSCIMYGVEGDVRYTV-----PVLADNIHSL 113
           ++  +   G  +   +GG    FAGYN +    + GVEGDV Y        V   N    
Sbjct: 57  NSDLSVPGGGGSKRFSGGLLGAFAGYNYQHGDWVVGVEGDVSYNWNDETVTVFGTNTDVG 116

Query: 114 HGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKY-ETGKAGEITPIAIGGTAGVGVEVGGL 172
             + GS+R R GY V+D  LLYAT G  V + + +   A +      G T G GV+  G 
Sbjct: 117 TDVSGSVRARLGYTVNDRTLLYATGGWAVTRGFVDVAGAPKEKETFNGWTIGGGVDY-GF 175

Query: 173 SESLVARLEYRASKYS-------KVEGFYNTISLGVGMKF 205
           ++S+  R EYR + +S        V+   +  ++GVG+KF
Sbjct: 176 TDSVFGRAEYRYNDFSDKDVGGVDVDLDQHQFTIGVGVKF 215


>gi|218513075|ref|ZP_03509915.1| outer membrane protein [Rhizobium etli 8C-3]
          Length = 134

 Score =  141 bits (356), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 42/136 (30%), Positives = 68/136 (50%), Gaps = 14/136 (10%)

Query: 82  AGYNVEDSCIMYGVEGDVRYTVP-VLADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGP 140
            GYN +   I+YGVE D+ Y+   V +  + + +G  GS+R R GY++ +  LLY T G 
Sbjct: 1   TGYNWQQGQIVYGVESDLGYSGDDVSSGGVKNKYGWNGSVRGRVGYDM-NPFLLYGTAGL 59

Query: 141 DVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVE--------- 191
            +     +    + +  A G T G GVE   ++ ++  RLEYR + Y   +         
Sbjct: 60  ALGNIKVSDGTSDESKTAYGYTVGAGVEA-FVTNNITTRLEYRYTDYQSKDYDLDSGSFS 118

Query: 192 --GFYNTISLGVGMKF 205
                N++ LG+G+KF
Sbjct: 119 RGYDENSVKLGIGVKF 134


>gi|218461202|ref|ZP_03501293.1| outer membrane protein [Rhizobium etli Kim 5]
 gi|218658675|ref|ZP_03514605.1| outer membrane protein [Rhizobium etli IE4771]
          Length = 207

 Score =  141 bits (356), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 48/217 (22%), Positives = 80/217 (36%), Gaps = 30/217 (13%)

Query: 7   AVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNG 66
               ++       +A AAD V+ A                      ++GPY G+      
Sbjct: 3   LTIATTFLALVATTAFAADVVQEAPTAPLAAA----------PVFTWSGPYFGIDGGAAW 52

Query: 67  ------SFGEEAHHNAGGSIF---AGYNVEDSCIMYGVEGDVRYTVPVLAD-NIHSLHGI 116
                 + G  A  +  G +F   AGYN +    + G+EG++ +                
Sbjct: 53  LNGDFSAGGASASEDFNGGVFGGFAGYNFQFDNFVVGIEGNLEHNWNEEDALGAEVGTDW 112

Query: 117 GGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKA-GEITPIAIGGTAGVGVEVGGLSES 175
            G++R R GY   D  L+Y   G    + Y       + T    G T G GV+   ++ +
Sbjct: 113 AGAVRGRVGYAF-DKALIYGAAGWAATRGYVDAPGFDKETETFNGYTVGAGVDF-AITNN 170

Query: 176 LVARLEYRASKYS-------KVEGFYNTISLGVGMKF 205
           + AR EYR + Y         V+   + +  G+G+KF
Sbjct: 171 IFARGEYRYNDYGEQDILGVDVDLDQHELKFGIGVKF 207


>gi|86358535|ref|YP_470427.1| outer membrane protein [Rhizobium etli CFN 42]
 gi|86282637|gb|ABC91700.1| outer membrane protein [Rhizobium etli CFN 42]
          Length = 208

 Score =  140 bits (354), Expect = 9e-32,   Method: Composition-based stats.
 Identities = 51/218 (23%), Positives = 84/218 (38%), Gaps = 31/218 (14%)

Query: 7   AVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNG 66
               ++       SA AAD V+                        ++GPY G+    + 
Sbjct: 3   LTIATTFLALVATSAFAADAVQDVPAAPVAAA----------PAFTWSGPYLGIDGGASW 52

Query: 67  SFGE-------EAHHNAGG--SIFAGYNVE-DSCIMYGVEGDVRYTVPVLAD-NIHSLHG 115
             G+       ++    GG    FAGYN + D+ I+ G+EG++ Y               
Sbjct: 53  LNGDFSAGGASDSQDFNGGVFGAFAGYNFQFDNNIVVGIEGNLEYNWNEEEALGADVGTD 112

Query: 116 IGGSLRIRGGYEVSDSLLLYATVGPDVAQKYET-GKAGEITPIAIGGTAGVGVEVGGLSE 174
             G++R R GY   D  LLY   G    + Y     + + T    G T G GV+   ++ 
Sbjct: 113 WAGAVRGRVGYAF-DRALLYGAAGWTATRGYVDLPGSDKETETFNGYTVGAGVDF-AITN 170

Query: 175 SLVARLEYRASKYS-------KVEGFYNTISLGVGMKF 205
           ++ AR EYR + +         V+   + +  G+G+KF
Sbjct: 171 NIFARGEYRYNDFGEKDILGVDVDLNQHELKFGIGVKF 208


>gi|218461155|ref|ZP_03501246.1| outer membrane protein [Rhizobium etli Kim 5]
          Length = 168

 Score =  140 bits (354), Expect = 9e-32,   Method: Composition-based stats.
 Identities = 52/167 (31%), Positives = 82/167 (49%), Gaps = 10/167 (5%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+ L   +  S+ A+A   +AQAAD V +           +A +  V    ++ G Y G 
Sbjct: 1   MRVLIAGLMASAFAIAGVSAAQAADAVDQVPEA------PVAQDAPVKPAGNWEGFYLGG 54

Query: 61  SALYN-GSFGEEAH-HNAGGSIFAGYNVEDSCIMYGVEGDVRYTV-PVLADNIHSLHGIG 117
           +  YN G FG + H +  GG +F GYN +   I+YGVE D+ Y+   V +  + + +G  
Sbjct: 55  AGTYNMGDFGSDRHTYGFGGQVFTGYNWQAGQIVYGVESDLGYSGDDVSSGGVENKYGWN 114

Query: 118 GSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAG 164
           GS+R R GY++ +  LLY T G  +     +    + +  A G T G
Sbjct: 115 GSVRGRVGYDM-NPFLLYGTAGLALGNIKVSDDTSDESKTAYGYTVG 160


>gi|327189607|gb|EGE56759.1| outer membrane protein [Rhizobium etli CNPAF512]
          Length = 207

 Score =  140 bits (353), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 49/217 (22%), Positives = 81/217 (37%), Gaps = 30/217 (13%)

Query: 7   AVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNG 66
               ++       +A AAD V+ A                      ++GPY G+      
Sbjct: 3   LTIATAFLALVATTAFAADVVQEAPTAPVAAA----------PVFTWSGPYFGIDGGAGW 52

Query: 67  ------SFGEEAHHNAGGSIF---AGYNVEDSCIMYGVEGDVRYTVPVLAD-NIHSLHGI 116
                 + G  A  +  G +F   AGYN +   I+ G+EG++ +                
Sbjct: 53  LNGDFSAGGASADEDFNGGVFGAFAGYNFQFDNIVVGIEGNIEHNWNEEDALGADVGTDW 112

Query: 117 GGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKA-GEITPIAIGGTAGVGVEVGGLSES 175
            G++R R GY   D  L+Y   G    + Y       + T    G T G GV+   ++ +
Sbjct: 113 AGAVRGRVGYAF-DKALIYGAAGWAATRGYVDAPGFDKETETFNGYTVGAGVDF-AITNN 170

Query: 176 LVARLEYRASKYS-------KVEGFYNTISLGVGMKF 205
           + AR EYR + Y         V+   + +  G+G+KF
Sbjct: 171 IFARGEYRYNDYGEKDILGVDVDLDQHELKFGIGVKF 207


>gi|307320995|ref|ZP_07600402.1| porin [Sinorhizobium meliloti AK83]
 gi|306893369|gb|EFN24148.1| porin [Sinorhizobium meliloti AK83]
          Length = 213

 Score =  139 bits (350), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 48/151 (31%), Positives = 73/151 (48%), Gaps = 14/151 (9%)

Query: 68  FGEEAHHNAGG--SIFAGYNVEDSCIMYGVEGDVRYTV---PVLADNIHSLHGIGGSLRI 122
            G  +   +GG    FAGYN +    + GVEGDV Y      V   +  +   + GS+R 
Sbjct: 64  GGSASEKFSGGLFGAFAGYNYQHGDWVVGVEGDVSYNWNDETVFGSDTEAGTDVSGSVRA 123

Query: 123 RGGYEVSDSLLLYATVGPDVAQKY-ETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLE 181
           R GY V+D  L+YAT G  V + + +   A +      G T G GV+  G ++S+  R E
Sbjct: 124 RLGYTVNDRTLIYATGGWAVTRGFVDVAGAPKEKETFNGWTIGGGVDY-GFTDSVFGRAE 182

Query: 182 YRASKYS-------KVEGFYNTISLGVGMKF 205
           YR + +         V+   +  ++GVG+KF
Sbjct: 183 YRYNDFGDKDVGGVNVDLDQHQFTVGVGVKF 213


>gi|227821981|ref|YP_002825952.1| outer membrane protein [Sinorhizobium fredii NGR234]
 gi|227340981|gb|ACP25199.1| outer membrane protein [Sinorhizobium fredii NGR234]
          Length = 216

 Score =  139 bits (350), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 54/219 (24%), Positives = 86/219 (39%), Gaps = 25/219 (11%)

Query: 9   GVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNG-- 66
            + ++ +A F ++ AA P   A                      + G Y GL        
Sbjct: 1   MIRNVLVAMFGASLAAGPTYAADITEAPE--PAPAILETTPTFVWTGGYVGLQGGGGWLN 58

Query: 67  ----SFGEEAHHNAGGSIF---AGYNVEDSCIMYGVEGDVRYTV-----PVLADNIHSLH 114
                 G  A  +  G +F   AGYN +    + GVEGDV Y        V   +     
Sbjct: 59  SDLSVPGASASEDFSGGLFGAFAGYNYQMGDWVVGVEGDVSYNWNDKSFTVFGASTEVGT 118

Query: 115 GIGGSLRIRGGYEVSDSLLLYATVGPDVAQKY-ETGKAGEITPIAIGGTAGVGVEVGGLS 173
            + GS+R R GY +++  LLY T G  V + + +   A +      G T G G++    +
Sbjct: 119 DVSGSVRGRVGYTLNEKALLYGTGGWAVTRGFVDVAGAPKEKETFNGWTIGGGIDY-AFT 177

Query: 174 ESLVARLEYRASKYS-------KVEGFYNTISLGVGMKF 205
            S+  R EYR + +         V+   +  ++GVG+KF
Sbjct: 178 NSMFGRAEYRYNDFGDKDVGGVDVDLDQHQFTVGVGVKF 216


>gi|239830970|ref|ZP_04679299.1| Porin subfamily protein [Ochrobactrum intermedium LMG 3301]
 gi|239823237|gb|EEQ94805.1| Porin subfamily protein [Ochrobactrum intermedium LMG 3301]
          Length = 240

 Score =  139 bits (349), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 57/240 (23%), Positives = 88/240 (36%), Gaps = 49/240 (20%)

Query: 3   KLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSA 62
           KL   +  S++AL +   A+AAD V                   V     + G Y G   
Sbjct: 13  KLKALLLASTVALVAATGAKAADAVIEQE----------PAPVVVAPSFTWTGAYIGGQI 62

Query: 63  LYNG----------SFGEEAHHNAGGSIFAGYNVEDSC-IMYGVEGDVRYTVPVLADNI- 110
            Y            S+G+       G ++AGYN +    I+ G++GDV Y       ++ 
Sbjct: 63  GYGWGKSNFDGDVFSYGDVKPDGFLGGVYAGYNFDLGNNIVLGIDGDVTYNDVSKDIDVF 122

Query: 111 ---------HSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAG-----EITP 156
                     +     G++R R GY V D  + Y   G        +G          + 
Sbjct: 123 DGDLAVGDFETKLRWSGAVRARVGYAV-DRFMPYLAGGVAFGNIKNSGSIDGIGSFSESK 181

Query: 157 IAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFY-----------NTISLGVGMKF 205
              G TAG GV+    +++L+ RLEYR + Y   +  +           N + LGV  KF
Sbjct: 182 TLTGWTAGAGVDYAA-TDNLIVRLEYRYTDYGDKDIDFGGLNINQDFKTNEVRLGVAYKF 240


>gi|15965438|ref|NP_385791.1| outer-membrane protein [Sinorhizobium meliloti 1021]
 gi|307310613|ref|ZP_07590260.1| porin [Sinorhizobium meliloti BL225C]
 gi|15074619|emb|CAC46264.1| Probable outer-membrane protein [Sinorhizobium meliloti 1021]
 gi|306899723|gb|EFN30349.1| porin [Sinorhizobium meliloti BL225C]
          Length = 215

 Score =  138 bits (348), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 48/153 (31%), Positives = 73/153 (47%), Gaps = 16/153 (10%)

Query: 68  FGEEAHHNAGG--SIFAGYNVEDSCIMYGVEGDVRYTV-----PVLADNIHSLHGIGGSL 120
            G  +   +GG    FAGYN +    + GVEGDV Y        V   +  +   + GS+
Sbjct: 64  GGSASEKFSGGLFGAFAGYNYQHGDWVVGVEGDVSYNWNDETVTVFGSDTEAGTDVSGSV 123

Query: 121 RIRGGYEVSDSLLLYATVGPDVAQKY-ETGKAGEITPIAIGGTAGVGVEVGGLSESLVAR 179
           R R GY V+D  L+YAT G  V + + +   A +      G T G GV+  G ++S+  R
Sbjct: 124 RARLGYTVNDRTLIYATGGWAVTRGFVDVAGAPKEKETFNGWTIGGGVDY-GFTDSVFGR 182

Query: 180 LEYRASKYS-------KVEGFYNTISLGVGMKF 205
            EYR + +         V+   +  ++GVG+KF
Sbjct: 183 AEYRYNDFGDKDVGGVNVDLDQHQFTVGVGVKF 215


>gi|222087507|ref|YP_002546044.1| outer membrane protein [Agrobacterium radiobacter K84]
 gi|221724955|gb|ACM28111.1| outer membrane protein [Agrobacterium radiobacter K84]
          Length = 204

 Score =  138 bits (348), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 54/217 (24%), Positives = 92/217 (42%), Gaps = 32/217 (14%)

Query: 8   VGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSAL---- 63
           + + +L   +  SA AAD                           ++GPY G+       
Sbjct: 1   MLIPALLALASTSAVAADLTEE-----------PVAAAAPASVFTWSGPYLGVHGGGAIT 49

Query: 64  ---YNGSFGEEAHHNAGGSI--FAGYNVEDSCIMYGVEGDVRYTVPVLA--DNIHSLHGI 116
              +    G+++    GG +  F GYN +   ++ GV+G++ Y     A  +        
Sbjct: 50  KGNFKFGSGDQSEDFKGGFLGNFFGYNYQFDKVVVGVDGNIDYNWNNKAVANASSVGTDW 109

Query: 117 GGSLRIRGGYEVSDSLLLYATVGPDVAQKY-ETGKAGEITPIAIGGTAGVGVEVGGLSES 175
            G++R R GY   D+LL+Y   G   A+ + +   +G+   +  G TAG GV+    + +
Sbjct: 110 SGAVRGRVGYAF-DNLLIYGAAGWTAARGFADVSGSGDGKVVFSGWTAGTGVDY-AFTNN 167

Query: 176 LVARLEYRASKYS-------KVEGFYNTISLGVGMKF 205
           + AR EYR S +        K +    +I+LGVG+KF
Sbjct: 168 IFARAEYRYSDFGSKELQGVKSDLTEQSINLGVGLKF 204


>gi|241518381|ref|YP_002979009.1| porin [Rhizobium leguminosarum bv. trifolii WSM1325]
 gi|240862794|gb|ACS60458.1| porin [Rhizobium leguminosarum bv. trifolii WSM1325]
          Length = 207

 Score =  137 bits (346), Expect = 7e-31,   Method: Composition-based stats.
 Identities = 46/206 (22%), Positives = 76/206 (36%), Gaps = 30/206 (14%)

Query: 18  FCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNG------SFGEE 71
             +A AAD V                         ++GPY G+            + G  
Sbjct: 14  STTALAADAVPVI----------SDAPVAAAPAFTWSGPYLGIDGGAGWLNGDFSAGGAS 63

Query: 72  AHHNAGGSIFAG---YNVEDSCIMYGVEGDVRYTVPVLAD-NIHSLHGIGGSLRIRGGYE 127
           A  +  G IF G   YN +   I+ G+EG++ +                 G++R R GY 
Sbjct: 64  ASEDFNGGIFGGFVGYNFQFDNIVVGIEGNLEHNWNEEEALGADVGTDWTGAVRGRVGYA 123

Query: 128 VSDSLLLYATVGPDVAQKYET-GKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASK 186
             D  L+Y   G    + Y       + T    G T G G++   ++ ++ AR EYR + 
Sbjct: 124 F-DKALIYGAAGWTATRGYVDLPGLDKETETFNGYTVGAGLDF-AITNNIFARGEYRYND 181

Query: 187 YS-------KVEGFYNTISLGVGMKF 205
           +         V+   + +  G+G+KF
Sbjct: 182 FGEKDVLGVDVDLDQHELKFGIGVKF 207


>gi|218508536|ref|ZP_03506414.1| outer membrane protein [Rhizobium etli Brasil 5]
          Length = 144

 Score =  137 bits (345), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 48/151 (31%), Positives = 75/151 (49%), Gaps = 10/151 (6%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+ L   +  S+ A+A    AQAAD V +           +A +  V    ++ G Y G 
Sbjct: 1   MRVLIAGLMASAFAIAGVSVAQAADAVDQVPEA------PVAQDAPVKPAGNWEGFYLGG 54

Query: 61  SALYN-GSFGEEAH-HNAGGSIFAGYNVEDSCIMYGVEGDVRYTV-PVLADNIHSLHGIG 117
           +  YN G FG + H +  GG +F GYN +   I+YGVE D+ Y+   V +  + + +G  
Sbjct: 55  AGTYNMGDFGSDRHTYGFGGQVFTGYNWQQGQIVYGVESDLGYSGDDVSSGGVKNKYGWN 114

Query: 118 GSLRIRGGYEVSDSLLLYATVGPDVAQKYET 148
           GS+R R GY++ +  LLY T G  +     +
Sbjct: 115 GSVRGRVGYDM-NPFLLYGTAGLALGNIKVS 144


>gi|153007478|ref|YP_001368693.1| porin [Ochrobactrum anthropi ATCC 49188]
 gi|151559366|gb|ABS12864.1| porin [Ochrobactrum anthropi ATCC 49188]
          Length = 229

 Score =  136 bits (343), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 60/240 (25%), Positives = 88/240 (36%), Gaps = 49/240 (20%)

Query: 3   KLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSA 62
           KL   +  S++AL +   A+AAD V                   V     ++G Y G   
Sbjct: 2   KLKALLLASTVALVAATGAKAADAVIEQE----------PVPVVVAPTFTWSGAYIGGQI 51

Query: 63  LYNG----------SFGEEAHHNAGGSIFAGYNVEDSC-IMYGVEGDVRYTVPVLADNIH 111
            Y            SFG        G I+AGYN +    I+ G++GDV Y       +++
Sbjct: 52  GYGWGKSDFSGDVYSFGNVKPDGFLGGIYAGYNFDLGNSIVLGIDGDVTYNDVSKDIDVY 111

Query: 112 S----------LHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAG-----EITP 156
           S               G++R R GY V D  + Y   G        +G          + 
Sbjct: 112 SGDLAVGDFETKLRWSGAVRARVGYAV-DRFMPYLAGGVAFGNIKNSGSIDGIGSFSESK 170

Query: 157 IAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEG-----------FYNTISLGVGMKF 205
              G TAG GV+    +++L+ RLEYR + Y   +              N + LGV  KF
Sbjct: 171 TLTGWTAGAGVDYAA-TDNLIVRLEYRYTDYGDKDIEFGGLNVNQDFKTNEVRLGVAYKF 229


>gi|222149200|ref|YP_002550157.1| outer membrane protein [Agrobacterium vitis S4]
 gi|221736185|gb|ACM37148.1| outer membrane protein [Agrobacterium vitis S4]
          Length = 212

 Score =  135 bits (340), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 48/203 (23%), Positives = 76/203 (37%), Gaps = 28/203 (13%)

Query: 21  AQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGP---------YAGLSALYNGSFGEE 71
           A AAD V +        VPT       P    + G          +   +    G+   +
Sbjct: 20  AMAADAVDQ--------VPTAPAAVETPAAFSWAGGYIGVYGGYGWLDATLSQGGASLSD 71

Query: 72  AHHNAGGSIFAGYNVEDS-CIMYGVEGDVRYTVPVLA-DNIHSLHGIGGSLRIRGGYEVS 129
                    F G+N +    ++ GVE DV Y         +     + GS R R GY + 
Sbjct: 72  NFDGGRIGGFGGWNFDVGHNVILGVEADVNYDWNENNYSGVKVGMDVSGSARARAGYAI- 130

Query: 130 DSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSK 189
           D  L++   G    + Y    +G+      G T G GV+   ++  +  RLEYR + Y  
Sbjct: 131 DRALIFVAGGWTADRTYIKSSSGDFNKTLNGWTIGAGVDY-AITNRIFTRLEYRYNDYGT 189

Query: 190 V-------EGFYNTISLGVGMKF 205
                   +   N ++LG+G+KF
Sbjct: 190 KNISGIDFDSKQNVVNLGIGIKF 212


>gi|222102056|ref|YP_002546646.1| hypothetical protein Arad_12130 [Agrobacterium radiobacter K84]
 gi|221728173|gb|ACM31182.1| conserved hypothetical protein [Agrobacterium radiobacter K84]
          Length = 205

 Score =  135 bits (340), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 46/180 (25%), Positives = 68/180 (37%), Gaps = 18/180 (10%)

Query: 40  TIATNRYVPIRHDFNGPYAGLSALYNG----SFGEEAHHNAG-GSIFAGYNVEDSCIMYG 94
                +     ++++G Y G    Y+       G +   N G      GYN +   I+YG
Sbjct: 30  APQPEQQAYSAYNWSGFYLGAQGGYSWNKAKYLGADQSLNTGSAGAHVGYNFQTGNIIYG 89

Query: 95  VEGDVRYTVPVLADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEI 154
           +E D  Y          +      S R R GY +  +LL           K +    G+ 
Sbjct: 90  IENDFNYNFDK---GNKADLQWDASGRARVGYALDRTLLFATAGLAAAGGKVDAPAIGKK 146

Query: 155 TPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVE---------GFYNTISLGVGMKF 205
             I IG TAG GVE   L+++++ R EYR S + K +              I LG   KF
Sbjct: 147 DDILIGWTAGAGVE-RALTDNILIRGEYRYSDFGKKDFGSDIGDFSATQQKIILGASYKF 205


>gi|306844393|ref|ZP_07476983.1| outer membrane protein [Brucella sp. BO1]
 gi|306275206|gb|EFM56956.1| outer membrane protein [Brucella sp. BO1]
          Length = 227

 Score =  134 bits (338), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 52/238 (21%), Positives = 84/238 (35%), Gaps = 47/238 (19%)

Query: 3   KLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSA 62
           KL   +  S++ L +   A AAD V                   V     +NG Y G   
Sbjct: 2   KLKALLFASTVVLVATTGANAADAVIEQE----------PAPVVVAPTFTWNGAYLGGQI 51

Query: 63  LYNGSFGEEAHHNAG----------GSIFAGYNVEDSC-IMYGVEGDVRYTVPVLA---- 107
            Y       ++ + G          G ++AGYN +    ++ G++GDV Y          
Sbjct: 52  GYAWGKSHFSYDSTGLGDIKPDGFLGGLYAGYNFDLGNSVVLGIDGDVTYNDVSKNIDFL 111

Query: 108 -----DNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVA----QKYETGKAGEITPIA 158
                 +  +     G++R R GY V D  L Y   G        +      +   +   
Sbjct: 112 DGNDAGSFENRLRWSGAVRARAGYAV-DRFLPYIAGGVAFGSLRNRGEFEDASFSQSKTL 170

Query: 159 IGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFY-----------NTISLGVGMKF 205
            G T G G++    +++++ RLEYR + Y   +  +           N I  GV  KF
Sbjct: 171 TGWTIGAGMDYAA-TDNVILRLEYRYTDYGNKDYGFDDAAVTNNFKTNDIRFGVAYKF 227


>gi|307315839|ref|ZP_07595348.1| porin [Sinorhizobium meliloti BL225C]
 gi|306898513|gb|EFN29191.1| porin [Sinorhizobium meliloti BL225C]
          Length = 208

 Score =  134 bits (338), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 51/213 (23%), Positives = 80/213 (37%), Gaps = 31/213 (14%)

Query: 12  SLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSFGEE 71
           S  L     A AAD               +      P    ++G Y G+      + GE 
Sbjct: 8   SFILFGSSGAMAADVTFDNS--------ALPPVSEAP--FSWSGAYIGVQGGGGWASGEF 57

Query: 72  AHHNAGG---------SIFAGYNVE-DSCIMYGVEGDVRYTVPVLAD-NIHSLHGIGGSL 120
           +     G           F GYN + D+ ++ G+EGDV +                 GS+
Sbjct: 58  SGFGINGSEDANGGSLGGFVGYNYQFDNNLVLGIEGDVEHDWNEQQVFGADFGTDWAGSV 117

Query: 121 RIRGGYEVSDSLLLYATVGPDVAQKYET-GKAGEITPIAIGGTAGVGVEVGGLSESLVAR 179
           R R GY   D+ L+YAT G    + Y      G+      G T G G++    +  +  R
Sbjct: 118 RGRLGYAF-DNALIYATAGWAATRGYVEVPGLGKDEKTFNGYTVGAGLDY-AFTNQVFGR 175

Query: 180 LEYRASKYS-------KVEGFYNTISLGVGMKF 205
           +EYR + Y         V+   + + +G+G+KF
Sbjct: 176 VEYRYNDYGDQDLQGINVDVDQHAVKVGLGIKF 208


>gi|153011627|ref|YP_001372841.1| porin [Ochrobactrum anthropi ATCC 49188]
 gi|151563515|gb|ABS17012.1| porin [Ochrobactrum anthropi ATCC 49188]
          Length = 228

 Score =  134 bits (337), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 53/239 (22%), Positives = 84/239 (35%), Gaps = 48/239 (20%)

Query: 3   KLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSA 62
           K+   +  S++AL +   A+AAD +           P             + G Y G   
Sbjct: 2   KIKSLLLASTVALIATTGAKAADAIVEEPAPVIVAEP----------IFSWTGAYIGGQI 51

Query: 63  LYNGSFGEEAH------HNAGGSIFAGYNVEDSC-IMYGVEGDVRYTVPVLA-------- 107
            Y     E             G ++AGYN +     + GV+GD+ Y              
Sbjct: 52  GYGWGKSEFEDAFRVKPDGFLGGLYAGYNFDVGNNFILGVDGDITYNNLKDNYSATDGDI 111

Query: 108 -DNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGE--------ITPIA 158
             ++ S     G++R R G    D  + Y   G        T  A +         +   
Sbjct: 112 AGDLESKLRWSGAVRARAGVAF-DRFMPYIAGGVAFGSVKNTLSATDGVDEISVSQSKTY 170

Query: 159 IGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFY------------NTISLGVGMKF 205
            G TAG GV+    +++L+ RLEYR + Y K +  +            + + LGV  KF
Sbjct: 171 TGWTAGAGVDYAA-TDNLILRLEYRYTDYGKKDFDFGTDVSVEDKFKTHDVRLGVAYKF 228


>gi|256060263|ref|ZP_05450438.1| outer membrane protein [Brucella neotomae 5K33]
 gi|261324236|ref|ZP_05963433.1| Omp25c [Brucella neotomae 5K33]
 gi|46251235|gb|AAS84588.1| Omp25c [Brucella neotomae]
 gi|261300216|gb|EEY03713.1| Omp25c [Brucella neotomae 5K33]
          Length = 228

 Score =  132 bits (333), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 52/239 (21%), Positives = 83/239 (34%), Gaps = 48/239 (20%)

Query: 3   KLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSA 62
           KL   +  S++ L +     AAD V                   V     +NG Y G   
Sbjct: 2   KLKALLFASTVVLVAATGTNAADAVIEQE----------PAPVVVAPTFTWNGAYLGGQI 51

Query: 63  LYNGSFGEEAHHNAG----------GSIFAGYNVEDSC-IMYGVEGDVRYTVPVLADN-- 109
            Y       ++ + G          G ++AGYN +    ++ G++GDV Y       +  
Sbjct: 52  GYAWGKSHFSYDSTGLGDIKPDGFLGGLYAGYNFDLGNSVVLGIDGDVTYNDVSKNIDFL 111

Query: 110 --------IHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVA----QKYETGKAGEITPI 157
                     +     G++R R GY V D  L Y   G        +    G     +  
Sbjct: 112 DENNAAATFENRLRWSGAVRARAGYAV-DRFLPYIAGGVAFGSLRNRGEFEGTGFSQSKT 170

Query: 158 AIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFY-----------NTISLGVGMKF 205
             G T G G++    +++++ RLEYR + Y   +  +           N I  GV  KF
Sbjct: 171 LTGWTIGAGMDYAA-TDNVILRLEYRYTDYGNKDYGFDDAAVTNNFKTNDIRFGVAYKF 228


>gi|256060262|ref|ZP_05450437.1| outer membrane protein, putative [Brucella neotomae 5K33]
 gi|261324235|ref|ZP_05963432.1| Omp25d [Brucella neotomae 5K33]
 gi|46251251|gb|AAS84596.1| Omp25d [Brucella neotomae]
 gi|261300215|gb|EEY03712.1| Omp25d [Brucella neotomae 5K33]
          Length = 230

 Score =  132 bits (332), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 50/241 (20%), Positives = 83/241 (34%), Gaps = 50/241 (20%)

Query: 3   KLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSA 62
                +G S +A+ +  SA AAD +                   +     + G Y G   
Sbjct: 2   TFKNLLGASLVAVITSTSAYAADAIVAQE----------PAPIAIAPSFSWAGAYFGGQV 51

Query: 63  LY-----------NGSFGEEAHHNAGGSIFAGYNVEDS-CIMYGVEGDVRYTVPVLADNI 110
            Y           NGS  E   +   G ++ GYN +     + G++ +V Y     + + 
Sbjct: 52  GYGWGRAKLENRTNGSTSEFKPNGFIGGLYTGYNFDTGNNFILGLDANVDYNNLKKSRDF 111

Query: 111 -----------HSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYET----GKAGEIT 155
                       +     G++R R GY + D  + Y   G        +    G+    +
Sbjct: 112 ITSGNPVQTTGETQLRWSGAVRARAGYAI-DRFMPYIAGGVAFGGIKNSLRIGGEESSKS 170

Query: 156 PIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKV-----------EGFYNTISLGVGMK 204
               G T G G++    +++++ RLEYR + Y K                N I LGV  K
Sbjct: 171 KTQTGWTVGAGIDYAA-TDNVLLRLEYRYTDYGKKNFGLNDLDTRGSFKTNDIRLGVAYK 229

Query: 205 F 205
           F
Sbjct: 230 F 230


>gi|225851658|ref|YP_002731891.1| porin [Brucella melitensis ATCC 23457]
 gi|256264831|ref|ZP_05467363.1| Omp25d [Brucella melitensis bv. 2 str. 63/9]
 gi|225640023|gb|ACN99936.1| porin [Brucella melitensis ATCC 23457]
 gi|263095287|gb|EEZ18914.1| Omp25d [Brucella melitensis bv. 2 str. 63/9]
 gi|326408138|gb|ADZ65203.1| porin [Brucella melitensis M28]
 gi|326537849|gb|ADZ86064.1| porin [Brucella melitensis M5-90]
          Length = 230

 Score =  132 bits (331), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 49/241 (20%), Positives = 82/241 (34%), Gaps = 50/241 (20%)

Query: 3   KLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSA 62
                +G S +A+ +  SA AAD +                   +     + G Y G   
Sbjct: 2   TFKNLLGASLVAVITSTSAYAADAIVAQE----------PAPIAIAPSFSWAGAYFGGQV 51

Query: 63  LY-----------NGSFGEEAHHNAGGSIFAGYNVEDSC-IMYGVEGDVRYTVPVLADNI 110
            Y           NG   E   +   G ++ GYN +     + G++ +V Y     + + 
Sbjct: 52  GYGWGRAKLENRTNGGTSEFKPNGFIGGLYTGYNFDTGNHFILGLDANVDYNNLKKSRDF 111

Query: 111 -----------HSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYET----GKAGEIT 155
                       +     G++R R GY + D  + Y   G        +    G+    +
Sbjct: 112 ITSGNPVQTTGETQLRWSGAVRARAGYAI-DRFMPYIAGGVAFGGIKNSLRIGGEESSKS 170

Query: 156 PIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKV-----------EGFYNTISLGVGMK 204
               G T G G++    +++++ RLEYR + Y K                N I LGV  K
Sbjct: 171 KTQTGWTVGAGIDYAA-TDNVLLRLEYRYTDYGKKNFGLNDLDTRGSFKTNDIRLGVAYK 229

Query: 205 F 205
           F
Sbjct: 230 F 230


>gi|17988113|ref|NP_540747.1| 25 kDa outer-membrane immunogenic protein precursor [Brucella
           melitensis bv. 1 str. 16M]
 gi|23501032|ref|NP_697159.1| outer membrane protein [Brucella suis 1330]
 gi|62289099|ref|YP_220892.1| hypothetical protein BruAb1_0115 [Brucella abortus bv. 1 str.
           9-941]
 gi|82699037|ref|YP_413611.1| outer membrane protein [Brucella melitensis biovar Abortus 2308]
 gi|148559864|ref|YP_001258156.1| putative outer membrane protein [Brucella ovis ATCC 25840]
 gi|161618106|ref|YP_001591993.1| 22 kDa outer membrane protein precursor [Brucella canis ATCC 23365]
 gi|163842393|ref|YP_001626797.1| 22 kDa outer membrane protein precursor [Brucella suis ATCC 23445]
 gi|189023374|ref|YP_001934142.1| outer membrane protein [Brucella abortus S19]
 gi|225626661|ref|ZP_03784700.1| Porin subfamily protein [Brucella ceti str. Cudo]
 gi|237814591|ref|ZP_04593589.1| Porin subfamily protein [Brucella abortus str. 2308 A]
 gi|254690428|ref|ZP_05153682.1| outer membrane protein, putative [Brucella abortus bv. 6 str. 870]
 gi|254694916|ref|ZP_05156744.1| outer membrane protein, putative [Brucella abortus bv. 3 str.
           Tulya]
 gi|254707184|ref|ZP_05169012.1| outer membrane protein, putative [Brucella pinnipedialis
           M163/99/10]
 gi|254709271|ref|ZP_05171082.1| outer membrane protein, putative [Brucella pinnipedialis B2/94]
 gi|254713306|ref|ZP_05175117.1| outer membrane protein, putative [Brucella ceti M644/93/1]
 gi|254716340|ref|ZP_05178151.1| outer membrane protein, putative [Brucella ceti M13/05/1]
 gi|254731459|ref|ZP_05190037.1| outer membrane protein, putative [Brucella abortus bv. 4 str. 292]
 gi|256030794|ref|ZP_05444408.1| outer membrane protein, putative [Brucella pinnipedialis M292/94/1]
 gi|256045910|ref|ZP_05448784.1| outer membrane protein, putative [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|256112624|ref|ZP_05453545.1| outer membrane protein, putative [Brucella melitensis bv. 3 str.
           Ether]
 gi|256158815|ref|ZP_05456676.1| outer membrane protein, putative [Brucella ceti M490/95/1]
 gi|256254200|ref|ZP_05459736.1| outer membrane protein, putative [Brucella ceti B1/94]
 gi|256258680|ref|ZP_05464216.1| outer membrane protein, putative [Brucella abortus bv. 9 str. C68]
 gi|256368582|ref|YP_003106088.1| 25 kDa outer-membrane immunogenic protein precursor [Brucella
           microti CCM 4915]
 gi|260169698|ref|ZP_05756509.1| 25 kDa outer-membrane immunogenic protein precursor [Brucella sp.
           F5/99]
 gi|260546396|ref|ZP_05822136.1| conserved hypothetical protein [Brucella abortus NCTC 8038]
 gi|260563195|ref|ZP_05833681.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. 16M]
 gi|260567238|ref|ZP_05837708.1| Omp25d [Brucella suis bv. 4 str. 40]
 gi|260755975|ref|ZP_05868323.1| outer membrane protein [Brucella abortus bv. 6 str. 870]
 gi|260759199|ref|ZP_05871547.1| outer membrane protein [Brucella abortus bv. 4 str. 292]
 gi|260884996|ref|ZP_05896610.1| Omp25d [Brucella abortus bv. 9 str. C68]
 gi|261215250|ref|ZP_05929531.1| outer membrane protein [Brucella abortus bv. 3 str. Tulya]
 gi|261218121|ref|ZP_05932402.1| conserved hypothetical protein [Brucella ceti M13/05/1]
 gi|261221348|ref|ZP_05935629.1| Omp25d [Brucella ceti B1/94]
 gi|261314665|ref|ZP_05953862.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10]
 gi|261316777|ref|ZP_05955974.1| conserved hypothetical protein [Brucella pinnipedialis B2/94]
 gi|261321032|ref|ZP_05960229.1| conserved hypothetical protein [Brucella ceti M644/93/1]
 gi|261759234|ref|ZP_06002943.1| outer membrane protein [Brucella sp. F5/99]
 gi|265987848|ref|ZP_06100405.1| Omp25d [Brucella pinnipedialis M292/94/1]
 gi|265992322|ref|ZP_06104879.1| Omp25d [Brucella melitensis bv. 1 str. Rev.1]
 gi|265994064|ref|ZP_06106621.1| Omp25d [Brucella melitensis bv. 3 str. Ether]
 gi|265997308|ref|ZP_06109865.1| Omp25d [Brucella ceti M490/95/1]
 gi|297247515|ref|ZP_06931233.1| 22 kDa outer membrane protein precursor [Brucella abortus bv. 5
           str. B3196]
 gi|17983867|gb|AAL53011.1| 25 kDa outer-membrane immunogenic protein precursor [Brucella
           melitensis bv. 1 str. 16M]
 gi|23346896|gb|AAN29074.1| outer membrane protein, putative [Brucella suis 1330]
 gi|46251245|gb|AAS84593.1| Omp25d [Brucella abortus]
 gi|46251247|gb|AAS84594.1| Omp25d [Brucella ovis]
 gi|46251249|gb|AAS84595.1| Omp25d [Brucella canis]
 gi|46251253|gb|AAS84597.1| Omp25d [Brucella ceti]
 gi|46251255|gb|AAS84598.1| Omp25d [Brucella ceti]
 gi|46251257|gb|AAS84599.1| Omp25d [Brucella ceti]
 gi|46251259|gb|AAS84600.1| Omp25d [Brucella pinnipedialis]
 gi|62195231|gb|AAX73531.1| outer membrane protein, hypothetical [Brucella abortus bv. 1 str.
           9-941]
 gi|82615138|emb|CAJ10071.1| outer membrane protein, putative [Brucella melitensis biovar
           Abortus 2308]
 gi|148371121|gb|ABQ61100.1| putative outer membrane protein [Brucella ovis ATCC 25840]
 gi|161334917|gb|ABX61222.1| 22 kDa outer membrane protein precursor [Brucella canis ATCC 23365]
 gi|163673116|gb|ABY37227.1| 22 kDa outer membrane protein precursor [Brucella suis ATCC 23445]
 gi|189018946|gb|ACD71668.1| outer membrane protein, putative [Brucella abortus S19]
 gi|225618318|gb|EEH15361.1| Porin subfamily protein [Brucella ceti str. Cudo]
 gi|237789428|gb|EEP63638.1| Porin subfamily protein [Brucella abortus str. 2308 A]
 gi|255998740|gb|ACU47139.1| 25 kDa outer-membrane immunogenic protein precursor [Brucella
           microti CCM 4915]
 gi|260096503|gb|EEW80379.1| conserved hypothetical protein [Brucella abortus NCTC 8038]
 gi|260153211|gb|EEW88303.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. 16M]
 gi|260156756|gb|EEW91836.1| Omp25d [Brucella suis bv. 4 str. 40]
 gi|260669517|gb|EEX56457.1| outer membrane protein [Brucella abortus bv. 4 str. 292]
 gi|260676083|gb|EEX62904.1| outer membrane protein [Brucella abortus bv. 6 str. 870]
 gi|260874524|gb|EEX81593.1| Omp25d [Brucella abortus bv. 9 str. C68]
 gi|260916857|gb|EEX83718.1| outer membrane protein [Brucella abortus bv. 3 str. Tulya]
 gi|260919932|gb|EEX86585.1| Omp25d [Brucella ceti B1/94]
 gi|260923210|gb|EEX89778.1| conserved hypothetical protein [Brucella ceti M13/05/1]
 gi|261293722|gb|EEX97218.1| conserved hypothetical protein [Brucella ceti M644/93/1]
 gi|261296000|gb|EEX99496.1| conserved hypothetical protein [Brucella pinnipedialis B2/94]
 gi|261303691|gb|EEY07188.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10]
 gi|261739218|gb|EEY27214.1| outer membrane protein [Brucella sp. F5/99]
 gi|262551776|gb|EEZ07766.1| Omp25d [Brucella ceti M490/95/1]
 gi|262765045|gb|EEZ10966.1| Omp25d [Brucella melitensis bv. 3 str. Ether]
 gi|263003388|gb|EEZ15681.1| Omp25d [Brucella melitensis bv. 1 str. Rev.1]
 gi|264660045|gb|EEZ30306.1| Omp25d [Brucella pinnipedialis M292/94/1]
 gi|297174684|gb|EFH34031.1| 22 kDa outer membrane protein precursor [Brucella abortus bv. 5
           str. B3196]
          Length = 230

 Score =  131 bits (329), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 49/241 (20%), Positives = 82/241 (34%), Gaps = 50/241 (20%)

Query: 3   KLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSA 62
                +G S +A+ +  SA AAD +                   +     + G Y G   
Sbjct: 2   TFKNLLGASLVAVITSTSAYAADAIVAQE----------PAPIAIAPSFSWAGAYFGGQV 51

Query: 63  LY-----------NGSFGEEAHHNAGGSIFAGYNVEDS-CIMYGVEGDVRYTVPVLADNI 110
            Y           NG   E   +   G ++ GYN +     + G++ +V Y     + + 
Sbjct: 52  GYGWGRAKLENRTNGGTSEFKPNGFIGGLYTGYNFDTGNNFILGLDANVDYNNLKKSRDF 111

Query: 111 -----------HSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYET----GKAGEIT 155
                       +     G++R R GY + D  + Y   G        +    G+    +
Sbjct: 112 ITSGNPVQTTGETQLRWSGAVRARAGYAI-DRFMPYIAGGVAFGGIKNSLRIGGEESSKS 170

Query: 156 PIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKV-----------EGFYNTISLGVGMK 204
               G T G G++    +++++ RLEYR + Y K                N I LGV  K
Sbjct: 171 KTQTGWTVGAGIDYAA-TDNVLLRLEYRYTDYGKKNFGLNDLDTRGSFKTNDIRLGVAYK 229

Query: 205 F 205
           F
Sbjct: 230 F 230


>gi|254700931|ref|ZP_05162759.1| outer membrane protein, putative [Brucella suis bv. 5 str. 513]
 gi|261751446|ref|ZP_05995155.1| outer membrane protein [Brucella suis bv. 5 str. 513]
 gi|261741199|gb|EEY29125.1| outer membrane protein [Brucella suis bv. 5 str. 513]
          Length = 232

 Score =  131 bits (329), Expect = 7e-29,   Method: Composition-based stats.
 Identities = 49/243 (20%), Positives = 82/243 (33%), Gaps = 52/243 (21%)

Query: 3   KLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSA 62
                +G S +A+ +  SA AAD +                   +     + G Y G   
Sbjct: 2   TFKNLLGASLVAVITSTSAYAADAIVAQE----------PAPIAIAPSFSWAGAYFGGQV 51

Query: 63  LY-----------NGSFGEEAHHNAGGSIFAGYNVEDS-CIMYGVEGDVRYTVPVLADNI 110
            Y           NG   E   +   G ++ GYN +     + G++ +V Y     + + 
Sbjct: 52  GYGWGRAKLENRTNGGTSEFKPNGFIGGLYTGYNFDTGNNFILGLDANVDYNNLKKSRDF 111

Query: 111 -----------HSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAG------E 153
                       +     G++R R GY + D  + Y   G        + + G       
Sbjct: 112 ITSGNPVQTTGETQLRWSGAVRARAGYAI-DRFMPYIAGGIAFGGIKNSLRIGGEESSKS 170

Query: 154 ITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKV-----------EGFYNTISLGVG 202
            +    G T G G++    +++++ RLEYR + Y K                N I LGV 
Sbjct: 171 KSKTQTGWTVGAGIDYAA-TDNVLLRLEYRYTDYGKKNFGLNDLDTRGSFKTNDIRLGVA 229

Query: 203 MKF 205
            KF
Sbjct: 230 YKF 232


>gi|90419513|ref|ZP_01227423.1| OmpA-like transmembrane domain [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90336450|gb|EAS50191.1| OmpA-like transmembrane domain [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 223

 Score =  130 bits (328), Expect = 9e-29,   Method: Composition-based stats.
 Identities = 48/205 (23%), Positives = 79/205 (38%), Gaps = 31/205 (15%)

Query: 25  DPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSFGEEAH------HNAGG 78
           D +           P  A        + ++G YAG    YN S  +++           G
Sbjct: 26  DVIYEEPQ-----PPVAAPIAPSTPVYVWSGAYAGAFVGYNTSNFDQSTGASFDGDGFVG 80

Query: 79  SIFAGYNVEDSCIMYGVEGDVRYTV-------PVLADNIHSLHGIGGSLRIRGGYEVSDS 131
            ++ GYN +    ++G+E D+  +              + +   I GS R R G  V D 
Sbjct: 81  GVYTGYNWQADQFVFGLEADLGGSDVDASGTNAATGAQLDADSNIFGSFRARVGVAV-DP 139

Query: 132 LLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVE 191
            L++AT G   A+   +      +  +IG T G GVE   +S+ +  RLEYR S +    
Sbjct: 140 FLVFATGGLAAARNELSLNGFSDSQTSIGYTLGAGVEAR-VSDDVTTRLEYRYSDFGSET 198

Query: 192 G-----------FYNTISLGVGMKF 205
                         ++I  G+ +KF
Sbjct: 199 YDLGNTSVSSGFDEHSIRAGIALKF 223


>gi|306844392|ref|ZP_07476982.1| outer membrane protein [Brucella sp. BO1]
 gi|306275205|gb|EFM56955.1| outer membrane protein [Brucella sp. BO1]
          Length = 230

 Score =  130 bits (327), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 49/241 (20%), Positives = 82/241 (34%), Gaps = 50/241 (20%)

Query: 3   KLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSA 62
                +G S +A+ +  SA AAD +                   +     + G Y G   
Sbjct: 2   TFKNLLGASLVAVITSTSAYAADAIVAQE----------PAPIAIAPGFSWAGAYFGGQV 51

Query: 63  LY-----------NGSFGEEAHHNAGGSIFAGYNVEDS-CIMYGVEGDVRYTVPVLADNI 110
            Y           NG   E   +   G ++ GYN +     + G++ +V Y     + + 
Sbjct: 52  GYGWGRAKLENRTNGGTSEFKPNGFIGGLYTGYNFDTGNNFILGLDANVDYNNLKKSRDF 111

Query: 111 -----------HSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYET----GKAGEIT 155
                       +     G++R R GY + D  + Y   G        +    G+    +
Sbjct: 112 ITNGNPVQTTGETQLRWSGAVRARAGYAI-DRFMPYIAGGVAFGGIKNSLRIGGEESSKS 170

Query: 156 PIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKV-----------EGFYNTISLGVGMK 204
               G T G G++    +++++ RLEYR + Y K                N I LGV  K
Sbjct: 171 KTQTGWTVGAGIDYAA-TDNVLLRLEYRYTDYGKKNFGLNDLDTRGSFKTNDIRLGVAYK 229

Query: 205 F 205
           F
Sbjct: 230 F 230


>gi|254718339|ref|ZP_05180150.1| outer membrane protein, putative [Brucella sp. 83/13]
 gi|265983298|ref|ZP_06096033.1| conserved hypothetical protein [Brucella sp. 83/13]
 gi|306839561|ref|ZP_07472367.1| outer membrane protein [Brucella sp. NF 2653]
 gi|306842593|ref|ZP_07475242.1| outer membrane protein [Brucella sp. BO2]
 gi|264661890|gb|EEZ32151.1| conserved hypothetical protein [Brucella sp. 83/13]
 gi|306287238|gb|EFM58726.1| outer membrane protein [Brucella sp. BO2]
 gi|306405347|gb|EFM61620.1| outer membrane protein [Brucella sp. NF 2653]
          Length = 230

 Score =  130 bits (326), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 49/241 (20%), Positives = 82/241 (34%), Gaps = 50/241 (20%)

Query: 3   KLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSA 62
                +G S +A+ +  SA AAD +                   +     + G Y G   
Sbjct: 2   TFKNLLGASLVAVITSTSAYAADAIVAQE----------PAPIAIAPGFSWAGAYFGGQV 51

Query: 63  LY-----------NGSFGEEAHHNAGGSIFAGYNVEDS-CIMYGVEGDVRYTVPVLADNI 110
            Y           NG   E   +   G ++ GYN +     + G++ +V Y     + + 
Sbjct: 52  GYGWGRAKLENRTNGGTSEFKPNGFIGGLYTGYNFDTGNNFILGLDANVDYNNLKKSRDF 111

Query: 111 -----------HSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYET----GKAGEIT 155
                       +     G++R R GY + D  + Y   G        +    G+    +
Sbjct: 112 ITSGNPVQTTGETQLRWSGAVRARAGYAI-DRFMPYIAGGVAFGGIKNSLRIGGEESSKS 170

Query: 156 PIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKV-----------EGFYNTISLGVGMK 204
               G T G G++    +++++ RLEYR + Y K                N I LGV  K
Sbjct: 171 KTQTGWTVGAGIDYAA-TDNVLLRLEYRYTDYGKKNFGLNDLDTRGSFKTNDIRLGVAYK 229

Query: 205 F 205
           F
Sbjct: 230 F 230


>gi|315498453|ref|YP_004087257.1| porin [Asticcacaulis excentricus CB 48]
 gi|315416465|gb|ADU13106.1| porin [Asticcacaulis excentricus CB 48]
          Length = 199

 Score =  130 bits (326), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 47/179 (26%), Positives = 77/179 (43%), Gaps = 27/179 (15%)

Query: 52  DFNGPYAGLSALYN----------GSFGEEAHHNAG---GSIFAGYNVEDSCIMYGVEGD 98
           DF+GPY      Y           G+  E A  + G     +  G+N + +  ++GVE D
Sbjct: 23  DFSGPYIAGQGGYAKTKLEVTYSAGTTTESASDDTGNGAAGVILGFNAQSNGAVFGVETD 82

Query: 99  VRYT-----VPVLADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGE 153
           + +        VL + + +     G++R R G+ VS + L Y   G    + Y      +
Sbjct: 83  LNWNNAKDRYRVLGEEVETGIDYSGAVRARLGF-VSGNTLFYGAAGVAGTRAYVEYDGEK 141

Query: 154 ITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEG-------FYNTISLGVGMKF 205
            T    G TAG+G +    S+ +  R+EYR + +  VE           ++ LG+GMKF
Sbjct: 142 ETETVAGWTAGIGAD-HAFSDRVFGRIEYRYTDFGDVEDDGVKAELMQQSVWLGLGMKF 199


>gi|237814592|ref|ZP_04593590.1| Porin subfamily protein [Brucella abortus str. 2308 A]
 gi|237789429|gb|EEP63639.1| Porin subfamily protein [Brucella abortus str. 2308 A]
          Length = 239

 Score =  128 bits (322), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 44/200 (22%), Positives = 71/200 (35%), Gaps = 38/200 (19%)

Query: 42  ATNRYVPIRHDFNGPYAGLSALYNGSFGEEAHHNAG----------GSIFAGYNVEDSC- 90
                V     +NG Y G    Y       ++ + G          G ++AGYN +    
Sbjct: 42  PAPVVVAPTFTWNGAYLGGQIGYAWGKSHFSYDSTGLGDIKPDGFLGGLYAGYNFDLGNS 101

Query: 91  IMYGVEGDVRYTVPVLADN----------IHSLHGIGGSLRIRGGYEVSDSLLLYATVGP 140
           ++ G++GDV Y       +            +     G++R R GY V D  L Y   G 
Sbjct: 102 VVLGIDGDVTYNDVSKNIDFLDENNAAATFENRLRWSGAVRARAGYAV-DRFLPYIAGGV 160

Query: 141 DVA----QKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFY-- 194
                  +    G     +    G T G G++    +++++ RLEYR + Y   +  +  
Sbjct: 161 AFGSLRNRGEFEGTGFSQSKTLTGWTIGAGMDYAA-TDNVILRLEYRYTDYGNKDYGFDD 219

Query: 195 ---------NTISLGVGMKF 205
                    N I  GV  KF
Sbjct: 220 AAVTNNFKTNDIRFGVAYKF 239


>gi|294851523|ref|ZP_06792196.1| outer membrane protein [Brucella sp. NVSL 07-0026]
 gi|294820112|gb|EFG37111.1| outer membrane protein [Brucella sp. NVSL 07-0026]
          Length = 237

 Score =  128 bits (321), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 44/200 (22%), Positives = 71/200 (35%), Gaps = 38/200 (19%)

Query: 42  ATNRYVPIRHDFNGPYAGLSALYNGSFGEEAHHNAG----------GSIFAGYNVEDSC- 90
                V     +NG Y G    Y       ++ + G          G ++AGYN +    
Sbjct: 40  PAPVVVAPTFTWNGAYLGGQIGYAWGKSHFSYDSTGLGDIKPDGFLGGLYAGYNFDLGNS 99

Query: 91  IMYGVEGDVRYTVPVLADN----------IHSLHGIGGSLRIRGGYEVSDSLLLYATVGP 140
           ++ G++GDV Y       +            +     G++R R GY V D  L Y   G 
Sbjct: 100 VVLGIDGDVTYNDVSKNIDFLDENNAAATFENHLRWSGAVRARAGYAV-DRFLPYIAGGV 158

Query: 141 DVA----QKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFY-- 194
                  +    G     +    G T G G++    +++++ RLEYR + Y   +  +  
Sbjct: 159 AFGSLRNRGEFEGTGFSQSKTLTGWTIGAGMDYAA-TDNVILRLEYRYTDYGNKDYGFDD 217

Query: 195 ---------NTISLGVGMKF 205
                    N I  GV  KF
Sbjct: 218 AAVTNNFKTNDIRFGVAYKF 237


>gi|254470094|ref|ZP_05083498.1| outer membrane protein [Pseudovibrio sp. JE062]
 gi|211960405|gb|EEA95601.1| outer membrane protein [Pseudovibrio sp. JE062]
          Length = 221

 Score =  128 bits (321), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 51/228 (22%), Positives = 89/228 (39%), Gaps = 30/228 (13%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M ++     ++   +A   ++ AAD  +        +             +D++G Y G 
Sbjct: 1   MLRIASCTAIAFGLMAG--TSLAADLPQPVQPSQPEISYETPA---TFSAYDWSGAYIGA 55

Query: 61  SALY--------NGSFG--EEAHHNAGGSIFAGYNVE-DSCIMYGVEGDVRYTV-PVLAD 108
           +A +        +G+ G  ++  +     + AGYN      ++ G E D++Y      + 
Sbjct: 56  NAGWGFLSADGKSGASGALDDDQNGVTAGVHAGYNFMVAPSVVLGAEADIQYNDLEEKSA 115

Query: 109 NIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVE 168
            +        ++R R GY + D  L+Y T G           AG+    AIG   G GVE
Sbjct: 116 GVELQSDWNATVRARAGYAL-DRTLVYGTGGAAFKDLTAKSSAGKDEKTAIGYVVGAGVE 174

Query: 169 VGGLSESLVARLEYRASKYS-----------KVEGFYNTISLGVGMKF 205
              ++++L ARLEY    +            K +   N +  GV MKF
Sbjct: 175 -HAVTDTLTARLEYLYQDFGDQKFDFGGTTEKTKIDENLVRAGVSMKF 221


>gi|156739552|gb|ABU93436.1| Omp25 [Brucella abortus]
          Length = 123

 Score =  127 bits (319), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 38/124 (30%), Positives = 61/124 (49%), Gaps = 12/124 (9%)

Query: 64  YNGSFGEEAHHNAGGSI---------FAGYNVEDSCIMYGVEGDVRYTVPVLA-DNIHSL 113
           Y G    +A  +  GSI         FAG+N +   I+YGVEGD  Y+    + D +   
Sbjct: 2   YLGYGWNKAKTSTVGSIKPDDWKAGAFAGWNFQQDQIVYGVEGDAGYSWAKKSKDGLEVK 61

Query: 114 HGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLS 173
            G  GSLR R GY++ + ++ Y T G   +Q        + +   +G TAG G+E   L+
Sbjct: 62  QGFEGSLRARVGYDL-NPVMPYLTAGIAGSQIKLNNGLDDESKFRVGWTAGAGLEA-KLT 119

Query: 174 ESLV 177
           ++++
Sbjct: 120 DNIL 123


>gi|254718340|ref|ZP_05180151.1| outer membrane protein [Brucella sp. 83/13]
 gi|265983299|ref|ZP_06096034.1| conserved hypothetical protein [Brucella sp. 83/13]
 gi|306839562|ref|ZP_07472368.1| outer membrane protein [Brucella sp. NF 2653]
 gi|264661891|gb|EEZ32152.1| conserved hypothetical protein [Brucella sp. 83/13]
 gi|306405348|gb|EFM61621.1| outer membrane protein [Brucella sp. NF 2653]
          Length = 227

 Score =  127 bits (318), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 43/199 (21%), Positives = 71/199 (35%), Gaps = 37/199 (18%)

Query: 42  ATNRYVPIRHDFNGPYAGLSALYNGSFGEEAHHNAG----------GSIFAGYNVEDSC- 90
                V     +NG Y G    Y       ++ + G          G ++AGYN +    
Sbjct: 31  PAPVVVAPTFTWNGAYLGGQIGYAWGKSHFSYDSTGLGDIKPDGFLGGLYAGYNFDLGNS 90

Query: 91  IMYGVEGDVRYTVPVLA---------DNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPD 141
           ++ G++GDV Y                +  +     G++R R GY V D  L Y   G  
Sbjct: 91  VVLGIDGDVTYNDVSKNIDFLDGNDAGSFENRLRWSGAVRARAGYAV-DRFLPYIAGGVA 149

Query: 142 VA----QKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFY--- 194
                 +      +   +    G T G G++    +++++ RLEYR + Y   +  +   
Sbjct: 150 FGSLRNRGEFEDASFSQSKTLTGWTIGAGMDYAA-TDNVILRLEYRYTDYGNKDYGFDDA 208

Query: 195 --------NTISLGVGMKF 205
                   N I  GV  KF
Sbjct: 209 AVTNNFKTNDIRFGVAYKF 227


>gi|225626662|ref|ZP_03784701.1| Porin subfamily protein [Brucella ceti str. Cudo]
 gi|225618319|gb|EEH15362.1| Porin subfamily protein [Brucella ceti str. Cudo]
          Length = 239

 Score =  127 bits (318), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 44/200 (22%), Positives = 72/200 (36%), Gaps = 38/200 (19%)

Query: 42  ATNRYVPIRHDFNGPYAGLSALYNGSFGEEAHHNAG----------GSIFAGYNVEDSC- 90
                V +   +NG Y G    Y       ++ + G          G ++AGYN +    
Sbjct: 42  PAPVVVALTFTWNGAYLGGQIGYAWGKSHFSYDSTGLGDIKPDGFLGGLYAGYNFDLGNS 101

Query: 91  IMYGVEGDVRYTVPVLADNI----------HSLHGIGGSLRIRGGYEVSDSLLLYATVGP 140
           ++ G++GDV Y       +            +     G++R R GY V D  L Y   G 
Sbjct: 102 VVLGIDGDVTYNDVSKNIDFLDENNAAATFENRLRWSGAVRARAGYAV-DRFLPYIAGGV 160

Query: 141 DVA----QKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFY-- 194
                  +    G     +    G T G G++    +++++ RLEYR + Y   +  +  
Sbjct: 161 AFGSLRNRGEFEGTGFSQSKTLTGWTIGAGMDYAA-TDNVILRLEYRYTDYGNKDYGFDD 219

Query: 195 ---------NTISLGVGMKF 205
                    N I  GV  KF
Sbjct: 220 AAVTNNFKTNDIRFGVAYKF 239


>gi|156739530|gb|ABU93425.1| Omp25 [Brucella suis]
 gi|156739540|gb|ABU93430.1| Omp25 [Brucella abortus]
 gi|156739558|gb|ABU93439.1| Omp25 [Brucella melitensis]
 gi|156739590|gb|ABU93455.1| Omp25 [Brucella suis]
 gi|156739594|gb|ABU93457.1| Omp25 [Brucella suis]
 gi|156739614|gb|ABU93467.1| Omp25 [Brucella melitensis]
 gi|156739630|gb|ABU93475.1| Omp25 [Brucella suis]
          Length = 128

 Score =  127 bits (318), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 42/133 (31%), Positives = 65/133 (48%), Gaps = 15/133 (11%)

Query: 55  GPYAGLSALYNGSFGEEAHHNAGGSI---------FAGYNVEDSCIMYGVEGDVRYTVPV 105
           G Y GL   Y G    +A  +  GSI         FAG+N +   I+YGVEGD  Y+   
Sbjct: 1   GGYTGL---YLGYGWNKAKTSTVGSIKPDDWKAGAFAGWNFQQDQIVYGVEGDAGYSWAK 57

Query: 106 LA-DNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAG 164
            + D +    G  GSLR R GY++ + ++ Y T G   +Q        + +   +G TAG
Sbjct: 58  KSKDGLEVKQGFEGSLRARVGYDL-NPVMPYLTAGIAGSQIKLNNGLDDESKFRVGWTAG 116

Query: 165 VGVEVGGLSESLV 177
            G+E   L+++++
Sbjct: 117 AGLEA-KLTDNIL 128


>gi|328542837|ref|YP_004302946.1| OmpA-like transmembrane domain [polymorphum gilvum SL003B-26A1]
 gi|326412583|gb|ADZ69646.1| OmpA-like transmembrane domain, putative [Polymorphum gilvum
           SL003B-26A1]
          Length = 223

 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 51/232 (21%), Positives = 84/232 (36%), Gaps = 36/232 (15%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+ L  A    ++   +   A AAD  +          P I  N+    R D++G Y G 
Sbjct: 1   MKSLAAAGVSIAVLAGASLPAFAADLPQ-------PAQPVIYDNQVSSARFDWSGFYFGG 53

Query: 61  SALYNGS----------FGEEAHHNAGGSIFAGYNVE-DSCIMYGVEGDVRYTV-----P 104
           +  +                       G + AGYN      I+ G+E D + +       
Sbjct: 54  NLGWGWGQFTTNSALTGRFNSDASGVNGGVHAGYNHAITPNIIAGLEADFQLSDLEKRRS 113

Query: 105 VLADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAG 164
           V    + +      ++R R GY   D  ++Y T G  +A         +    AIG T G
Sbjct: 114 VAGVGVKTSSDWNSTIRGRLGYAF-DRFMIYGTGGLAIADLEVAAAGSKGNETAIGWTLG 172

Query: 165 VGVEVGGLSESLVARLEYRASKYS-----------KVEGFYNTISLGVGMKF 205
            G+E G +++++ ARLEY    +            + +   +    GV  KF
Sbjct: 173 AGIE-GAVTDNVTARLEYLYQDFGRESFTLGGTRYRTDLDASIARFGVSYKF 223


>gi|148559219|ref|YP_001258157.1| putative outer membrane protein [Brucella ovis ATCC 25840]
 gi|46251231|gb|AAS84586.1| Omp25c [Brucella ovis]
 gi|148370476|gb|ABQ60455.1| putative outer membrane protein [Brucella ovis ATCC 25840]
          Length = 228

 Score =  126 bits (317), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 44/200 (22%), Positives = 69/200 (34%), Gaps = 38/200 (19%)

Query: 42  ATNRYVPIRHDFNGPYAGLSALYNG----------SFGEEAHHNAGGSIFAGYNVEDSC- 90
                V     +NG Y G    Y              G+       G ++AGYN +    
Sbjct: 31  PAPVVVAPTFTWNGAYLGGQIGYAWGKSHFSYDPTDLGDIKPDGFLGGLYAGYNFDLGNS 90

Query: 91  IMYGVEGDVRYTVPVLADNI----------HSLHGIGGSLRIRGGYEVSDSLLLYATVGP 140
           ++ G++GDV Y       +            +     G++R R GY V D  L Y   G 
Sbjct: 91  VVLGIDGDVTYNDVSKNIDFLDENNAAATFENRLRWSGAVRARAGYAV-DRFLPYIAGGV 149

Query: 141 DVA----QKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFY-- 194
                  +    G     +    G T G G++    +++++ RLEYR + Y   +  +  
Sbjct: 150 AFGSLRNRGEFEGAGFSQSKTLTGWTIGAGMDYAA-TDNVILRLEYRYTDYGNKDYGFDD 208

Query: 195 ---------NTISLGVGMKF 205
                    N I  GV  KF
Sbjct: 209 AAVTNNFKTNDIRFGVAYKF 228


>gi|17988112|ref|NP_540746.1| 25 kDa outer-membrane immunogenic protein precursor [Brucella
           melitensis bv. 1 str. 16M]
 gi|23501033|ref|NP_697160.1| outer membrane protein [Brucella suis 1330]
 gi|62289100|ref|YP_220893.1| hypothetical protein BruAb1_0116 [Brucella abortus bv. 1 str.
           9-941]
 gi|82699038|ref|YP_413612.1| outer membrane protein [Brucella melitensis biovar Abortus 2308]
 gi|161618107|ref|YP_001591994.1| 22 kDa outer membrane protein precursor [Brucella canis ATCC 23365]
 gi|163842394|ref|YP_001626798.1| 22 kDa outer membrane protein precursor [Brucella suis ATCC 23445]
 gi|189023375|ref|YP_001934143.1| outer membrane protein [Brucella abortus S19]
 gi|225851659|ref|YP_002731892.1| outer membrane protein [Brucella melitensis ATCC 23457]
 gi|254690429|ref|ZP_05153683.1| outer membrane protein [Brucella abortus bv. 6 str. 870]
 gi|254694917|ref|ZP_05156745.1| outer membrane protein [Brucella abortus bv. 3 str. Tulya]
 gi|254696123|ref|ZP_05157951.1| outer membrane protein [Brucella abortus bv. 2 str. 86/8/59]
 gi|254700932|ref|ZP_05162760.1| outer membrane protein [Brucella suis bv. 5 str. 513]
 gi|254705300|ref|ZP_05167128.1| outer membrane protein [Brucella suis bv. 3 str. 686]
 gi|254707183|ref|ZP_05169011.1| outer membrane protein [Brucella pinnipedialis M163/99/10]
 gi|254709272|ref|ZP_05171083.1| outer membrane protein [Brucella pinnipedialis B2/94]
 gi|254713305|ref|ZP_05175116.1| outer membrane protein [Brucella ceti M644/93/1]
 gi|254716341|ref|ZP_05178152.1| outer membrane protein [Brucella ceti M13/05/1]
 gi|254731460|ref|ZP_05190038.1| outer membrane protein [Brucella abortus bv. 4 str. 292]
 gi|256030795|ref|ZP_05444409.1| outer membrane protein [Brucella pinnipedialis M292/94/1]
 gi|256045911|ref|ZP_05448785.1| outer membrane protein [Brucella melitensis bv. 1 str. Rev.1]
 gi|256112625|ref|ZP_05453546.1| outer membrane protein [Brucella melitensis bv. 3 str. Ether]
 gi|256158816|ref|ZP_05456677.1| outer membrane protein [Brucella ceti M490/95/1]
 gi|256254201|ref|ZP_05459737.1| outer membrane protein [Brucella ceti B1/94]
 gi|256258681|ref|ZP_05464217.1| outer membrane protein [Brucella abortus bv. 9 str. C68]
 gi|256264830|ref|ZP_05467362.1| Omp25c [Brucella melitensis bv. 2 str. 63/9]
 gi|260546397|ref|ZP_05822137.1| conserved hypothetical protein [Brucella abortus NCTC 8038]
 gi|260563196|ref|ZP_05833682.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. 16M]
 gi|260567237|ref|ZP_05837707.1| Omp25c [Brucella suis bv. 4 str. 40]
 gi|260755976|ref|ZP_05868324.1| outer membrane protein [Brucella abortus bv. 6 str. 870]
 gi|260759200|ref|ZP_05871548.1| outer membrane protein [Brucella abortus bv. 4 str. 292]
 gi|260760488|ref|ZP_05872834.1| outer membrane protein [Brucella abortus bv. 2 str. 86/8/59]
 gi|260884997|ref|ZP_05896611.1| Omp25c [Brucella abortus bv. 9 str. C68]
 gi|261215251|ref|ZP_05929532.1| outer membrane protein [Brucella abortus bv. 3 str. Tulya]
 gi|261218122|ref|ZP_05932403.1| conserved hypothetical protein [Brucella ceti M13/05/1]
 gi|261221349|ref|ZP_05935630.1| Omp25c [Brucella ceti B1/94]
 gi|261314664|ref|ZP_05953861.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10]
 gi|261316778|ref|ZP_05955975.1| conserved hypothetical protein [Brucella pinnipedialis B2/94]
 gi|261321031|ref|ZP_05960228.1| conserved hypothetical protein [Brucella ceti M644/93/1]
 gi|261751447|ref|ZP_05995156.1| outer membrane protein [Brucella suis bv. 5 str. 513]
 gi|261756010|ref|ZP_05999719.1| outer membrane protein [Brucella suis bv. 3 str. 686]
 gi|265987849|ref|ZP_06100406.1| Omp25c [Brucella pinnipedialis M292/94/1]
 gi|265992323|ref|ZP_06104880.1| Omp25c [Brucella melitensis bv. 1 str. Rev.1]
 gi|265994065|ref|ZP_06106622.1| Omp25c [Brucella melitensis bv. 3 str. Ether]
 gi|265997309|ref|ZP_06109866.1| Omp25c [Brucella ceti M490/95/1]
 gi|297247516|ref|ZP_06931234.1| 22 kDa outer membrane protein precursor [Brucella abortus bv. 5
           str. B3196]
 gi|17983866|gb|AAL53010.1| 25 kDa outer-membrane immunogenic protein precursor [Brucella
           melitensis bv. 1 str. 16M]
 gi|23346897|gb|AAN29075.1| outer membrane protein, putative [Brucella suis 1330]
 gi|46251229|gb|AAS84585.1| Omp25c [Brucella abortus]
 gi|46251233|gb|AAS84587.1| Omp25c [Brucella canis]
 gi|46251237|gb|AAS84589.1| Omp25c [Brucella pinnipedialis]
 gi|46251239|gb|AAS84590.1| Omp25c [Brucella ceti]
 gi|46251241|gb|AAS84591.1| Omp25c [Brucella ceti]
 gi|46251243|gb|AAS84592.1| Omp25c [Brucella ceti]
 gi|62195232|gb|AAX73532.1| outer membrane protein, hypothetical [Brucella abortus bv. 1 str.
           9-941]
 gi|82615139|emb|CAJ10072.1| outer membrane protein, putative [Brucella melitensis biovar
           Abortus 2308]
 gi|161334918|gb|ABX61223.1| 22 kDa outer membrane protein precursor [Brucella canis ATCC 23365]
 gi|163673117|gb|ABY37228.1| 22 kDa outer membrane protein precursor [Brucella suis ATCC 23445]
 gi|189018947|gb|ACD71669.1| outer membrane protein, putative [Brucella abortus S19]
 gi|225640024|gb|ACN99937.1| outer membrane protein [Brucella melitensis ATCC 23457]
 gi|260096504|gb|EEW80380.1| conserved hypothetical protein [Brucella abortus NCTC 8038]
 gi|260153212|gb|EEW88304.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. 16M]
 gi|260156755|gb|EEW91835.1| Omp25c [Brucella suis bv. 4 str. 40]
 gi|260669518|gb|EEX56458.1| outer membrane protein [Brucella abortus bv. 4 str. 292]
 gi|260670923|gb|EEX57744.1| outer membrane protein [Brucella abortus bv. 2 str. 86/8/59]
 gi|260676084|gb|EEX62905.1| outer membrane protein [Brucella abortus bv. 6 str. 870]
 gi|260874525|gb|EEX81594.1| Omp25c [Brucella abortus bv. 9 str. C68]
 gi|260916858|gb|EEX83719.1| outer membrane protein [Brucella abortus bv. 3 str. Tulya]
 gi|260919933|gb|EEX86586.1| Omp25c [Brucella ceti B1/94]
 gi|260923211|gb|EEX89779.1| conserved hypothetical protein [Brucella ceti M13/05/1]
 gi|261293721|gb|EEX97217.1| conserved hypothetical protein [Brucella ceti M644/93/1]
 gi|261296001|gb|EEX99497.1| conserved hypothetical protein [Brucella pinnipedialis B2/94]
 gi|261303690|gb|EEY07187.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10]
 gi|261741200|gb|EEY29126.1| outer membrane protein [Brucella suis bv. 5 str. 513]
 gi|261745763|gb|EEY33689.1| outer membrane protein [Brucella suis bv. 3 str. 686]
 gi|262551777|gb|EEZ07767.1| Omp25c [Brucella ceti M490/95/1]
 gi|262765046|gb|EEZ10967.1| Omp25c [Brucella melitensis bv. 3 str. Ether]
 gi|263003389|gb|EEZ15682.1| Omp25c [Brucella melitensis bv. 1 str. Rev.1]
 gi|263095286|gb|EEZ18913.1| Omp25c [Brucella melitensis bv. 2 str. 63/9]
 gi|264660046|gb|EEZ30307.1| Omp25c [Brucella pinnipedialis M292/94/1]
 gi|289467873|gb|ADC95621.1| 25kDa outer membrane immunogenic protein precursor [Brucella
           melitensis bv. 1 str. M5]
 gi|297174685|gb|EFH34032.1| 22 kDa outer membrane protein precursor [Brucella abortus bv. 5
           str. B3196]
 gi|326408139|gb|ADZ65204.1| outer membrane protein, putative [Brucella melitensis M28]
 gi|326537850|gb|ADZ86065.1| outer membrane protein [Brucella melitensis M5-90]
          Length = 228

 Score =  126 bits (316), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 44/200 (22%), Positives = 71/200 (35%), Gaps = 38/200 (19%)

Query: 42  ATNRYVPIRHDFNGPYAGLSALYNGSFGEEAHHNAG----------GSIFAGYNVEDSC- 90
                V     +NG Y G    Y       ++ + G          G ++AGYN +    
Sbjct: 31  PAPVVVAPTFTWNGAYLGGQIGYAWGKSHFSYDSTGLGDIKPDGFLGGLYAGYNFDLGNS 90

Query: 91  IMYGVEGDVRYTVPVLADN----------IHSLHGIGGSLRIRGGYEVSDSLLLYATVGP 140
           ++ G++GDV Y       +            +     G++R R GY V D  L Y   G 
Sbjct: 91  VVLGIDGDVTYNDVSKNIDFLDENNAAATFENRLRWSGAVRARAGYAV-DRFLPYIAGGV 149

Query: 141 DVA----QKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFY-- 194
                  +    G     +    G T G G++    +++++ RLEYR + Y   +  +  
Sbjct: 150 AFGSLRNRGEFEGTGFSQSKTLTGWTIGAGMDYAA-TDNVILRLEYRYTDYGNKDYGFDD 208

Query: 195 ---------NTISLGVGMKF 205
                    N I  GV  KF
Sbjct: 209 AAVTNNFKTNDIRFGVAYKF 228


>gi|256368583|ref|YP_003106089.1| 25Kda outer membrane protein precursor [Brucella microti CCM 4915]
 gi|255998741|gb|ACU47140.1| 25Kda outer membrane protein precursor [Brucella microti CCM 4915]
          Length = 228

 Score =  126 bits (316), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 45/200 (22%), Positives = 71/200 (35%), Gaps = 38/200 (19%)

Query: 42  ATNRYVPIRHDFNGPYAGLSALYNGSFGEEAHHNAG----------GSIFAGYNVEDSC- 90
                V     +NG Y G    Y       ++ + G          G ++AGYN +    
Sbjct: 31  PAPVVVAPTFTWNGAYLGGQIGYAWGKSHFSYDSTGLGDIKPDGFLGGLYAGYNFDLGNS 90

Query: 91  IMYGVEGDVRYTV----------PVLADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGP 140
           ++ G++GDV Y               A    +     G++R R GY V D  L Y   G 
Sbjct: 91  VVLGIDGDVTYNDVSKNIDFLDENNAAAAFENRLRWSGAVRARAGYAV-DRFLPYIAGGV 149

Query: 141 DVA----QKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFY-- 194
                  +    G     +    G T G G++    +++++ RLEYR + Y   +  +  
Sbjct: 150 AFGSLRNRGEFEGTGFSQSKTLTGWTIGAGMDYAA-TDNVILRLEYRYTDYGNKDYGFDD 208

Query: 195 ---------NTISLGVGMKF 205
                    N I  GV  KF
Sbjct: 209 AAVTNNFKTNDIRFGVAYKF 228


>gi|225627449|ref|ZP_03785486.1| Porin subfamily protein [Brucella ceti str. Cudo]
 gi|260563986|ref|ZP_05834472.1| outer membrane protein 25b [Brucella melitensis bv. 1 str. 16M]
 gi|260566481|ref|ZP_05836951.1| outer membrane protein 25b [Brucella suis bv. 4 str. 40]
 gi|261758166|ref|ZP_06001875.1| outer membrane protein 25b [Brucella sp. F5/99]
 gi|265999479|ref|ZP_05466559.2| outer membrane protein 25b [Brucella melitensis bv. 2 str. 63/9]
 gi|294852320|ref|ZP_06792993.1| outer membrane protein [Brucella sp. NVSL 07-0026]
 gi|225617454|gb|EEH14499.1| Porin subfamily protein [Brucella ceti str. Cudo]
 gi|260154002|gb|EEW89094.1| outer membrane protein 25b [Brucella melitensis bv. 1 str. 16M]
 gi|260155999|gb|EEW91079.1| outer membrane protein 25b [Brucella suis bv. 4 str. 40]
 gi|261738150|gb|EEY26146.1| outer membrane protein 25b [Brucella sp. F5/99]
 gi|263094215|gb|EEZ18092.1| outer membrane protein 25b [Brucella melitensis bv. 2 str. 63/9]
 gi|294820909|gb|EFG37908.1| outer membrane protein [Brucella sp. NVSL 07-0026]
          Length = 243

 Score =  126 bits (316), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 41/208 (19%), Positives = 66/208 (31%), Gaps = 46/208 (22%)

Query: 42  ATNRYVPIRHDFNGPYAGLSALYNGSFGEEAHHNAG---------GSIFAGYNVEDSC-I 91
                V     +NG Y G    Y       +  +           G ++AGYN +     
Sbjct: 38  PAPVVVAPTFTWNGAYLGGQIGYGWGRSTLSDEDTSIRVKPDGFLGGLYAGYNFDMGNNF 97

Query: 92  MYGVEGDVRYTVPVLA-----------DNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGP 140
           + GV+GD+ Y     +             + S     G++R R G  + D  + Y   G 
Sbjct: 98  VLGVDGDITYNDLDASHSDTDPDLDLTTGVDSKLRWSGAVRARMGVAM-DRWMPYIAGGV 156

Query: 141 DVAQKY--------ETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVE- 191
                                 +    G  AG GV+    +++++ RLEYR + Y   + 
Sbjct: 157 AFGNVKNSVSLTDGIESIGVSQSKTMTGWAAGAGVDYAA-TDNVIVRLEYRYTDYGHKDF 215

Query: 192 --------------GFYNTISLGVGMKF 205
                            + I LGV  KF
Sbjct: 216 SVVDGDLSVEARNKFKTHDIRLGVAYKF 243


>gi|156739528|gb|ABU93424.1| Omp25 [Brucella melitensis]
          Length = 124

 Score =  125 bits (315), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 39/126 (30%), Positives = 62/126 (49%), Gaps = 12/126 (9%)

Query: 62  ALYNGSFGEEAHHNAGGSI---------FAGYNVEDSCIMYGVEGDVRYTVPVLA-DNIH 111
            LY G    +A  +  GSI         FAG+N +   I+YGVEGD  Y+    + D + 
Sbjct: 1   GLYLGYGWNKAKTSXVGSIKPDDWKAGAFAGWNFQQDQIVYGVEGDAGYSWAKKSKDGLE 60

Query: 112 SLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGG 171
              G  GSLR R GY++ + ++ Y T G   +Q        + +   +G TAG G+E   
Sbjct: 61  VKQGFEGSLRARVGYDL-NPVMPYLTAGIAGSQIKLNNGLDDESKFRVGWTAGAGLEA-K 118

Query: 172 LSESLV 177
           L+++++
Sbjct: 119 LTDNIL 124


>gi|156739520|gb|ABU93420.1| Omp25 [Brucella canis]
 gi|156739522|gb|ABU93421.1| Omp25 [Brucella canis]
          Length = 128

 Score =  125 bits (315), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 42/133 (31%), Positives = 65/133 (48%), Gaps = 15/133 (11%)

Query: 55  GPYAGLSALYNGSFGEEAHHNAGGSI---------FAGYNVEDSCIMYGVEGDVRYTVPV 105
           G Y GL   Y G    +A  +  GSI         FAG+N +   I+YGVEGD  Y+   
Sbjct: 1   GGYTGL---YLGYGWNKAKTSTVGSIKPDDWKAGAFAGWNFQKDQIVYGVEGDAGYSWAK 57

Query: 106 LA-DNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAG 164
            + D +    G  GSLR R GY++ + ++ Y T G   +Q        + +   +G TAG
Sbjct: 58  KSKDGLEVKQGFEGSLRARVGYDL-NPVMPYLTAGIAGSQIKLNNGLDDESKFRVGWTAG 116

Query: 165 VGVEVGGLSESLV 177
            G+E   L+++++
Sbjct: 117 AGLEA-KLTDNIL 128


>gi|182677110|ref|YP_001831256.1| porin [Beijerinckia indica subsp. indica ATCC 9039]
 gi|182632993|gb|ACB93767.1| porin [Beijerinckia indica subsp. indica ATCC 9039]
          Length = 244

 Score =  125 bits (315), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 54/221 (24%), Positives = 82/221 (37%), Gaps = 33/221 (14%)

Query: 3   KLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSA 62
            L   +  S + +AS  +A AAD   RA       +P             + G Y G   
Sbjct: 1   MLRTIIHSSIVIMASSVAALAADLPNRAAPPTVPYLPPSP-------AFSWTGVYLGGQI 53

Query: 63  LYNGSFGEEAH----------HNAGGSIFAGYNVEDSCIMYGVEGDVR---YTVPVLA-- 107
            Y                   +   G    G+N + S  + G EGDV    Y+  V    
Sbjct: 54  GYQFGRDSITAPGLFSVGHSPNGVVGGAHIGFNYQVSQFIVGFEGDVNGSSYSGSVFNPV 113

Query: 108 --DNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKY-------ETGKAGEITPIA 158
               + S   + GSLR R G    D +L+YAT G   A              +  +T   
Sbjct: 114 FRTQLTSRIPVDGSLRGRIGAAW-DRVLVYATGGAAFASIKHGYIGSSLVPGSATLTNDR 172

Query: 159 IGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFYNTISL 199
           +G T G GVE   ++++   R++YR + Y  +  F  TI++
Sbjct: 173 VGWTVGGGVEY-AMTDNWSVRVDYRYTDYGNISDFPGTITV 212


>gi|306842592|ref|ZP_07475241.1| outer membrane protein [Brucella sp. BO2]
 gi|306287237|gb|EFM58725.1| outer membrane protein [Brucella sp. BO2]
          Length = 228

 Score =  125 bits (314), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 45/200 (22%), Positives = 71/200 (35%), Gaps = 38/200 (19%)

Query: 42  ATNRYVPIRHDFNGPYAGLSALYNGSFGEEAHHNAG----------GSIFAGYNVEDSC- 90
                V     +NG Y G    Y       ++ + G          G ++AGYN +    
Sbjct: 31  PAPVVVAPTFTWNGAYLGGQIGYAWGKSHFSYDSTGLGDIKPDGFLGGLYAGYNFDLGNS 90

Query: 91  IMYGVEGDVRYTVPVL----------ADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGP 140
           ++ G++GDV Y               A    +     G++R R GY V D  L Y   G 
Sbjct: 91  VVLGIDGDVTYNDVSKKIDFLDENDAAATFENRLRWSGAVRARAGYAV-DRFLPYIAGGV 149

Query: 141 DVA----QKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFY-- 194
                  +    G     +    G T G G++    +++++ RLEYR + Y   +  +  
Sbjct: 150 AFGSLRNRGEFEGTGFSQSKTLTGWTIGAGMDYAA-TDNVILRLEYRYTDYGDKDYGFDD 208

Query: 195 ---------NTISLGVGMKF 205
                    N I  GV  KF
Sbjct: 209 AAVTNNFKTNDIRFGVAYKF 228


>gi|157310311|emb|CAN43867.1| outer membrane protein 25b [Brucella microti CCM 4915]
 gi|157310313|emb|CAN43868.1| outer membrane protein 25b [Brucella microti]
          Length = 245

 Score =  125 bits (314), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 41/208 (19%), Positives = 66/208 (31%), Gaps = 46/208 (22%)

Query: 42  ATNRYVPIRHDFNGPYAGLSALYNGSFGEEAHHNAG---------GSIFAGYNVEDSC-I 91
                V     +NG Y G    Y       +  +           G ++AGYN +     
Sbjct: 40  PAPVVVAPTFTWNGAYLGGQIGYGWGRSTLSDEDTSIRVKPDGFLGGLYAGYNFDMGNNF 99

Query: 92  MYGVEGDVRYTVPVLA-----------DNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGP 140
           + GV+GD+ Y     +             + S     G++R R G  + D  + Y   G 
Sbjct: 100 VLGVDGDITYNDLDASHSDTDPDLDLTTGVDSKLRWSGAVRARMGVAM-DRWMPYIAGGV 158

Query: 141 DVAQKY--------ETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVE- 191
                                 +    G  AG GV+    +++++ RLEYR + Y   + 
Sbjct: 159 AFGNVKNSVSLTDGIESIGVSQSKTMTGWAAGAGVDYAA-TDNVIVRLEYRYTDYGHKDF 217

Query: 192 --------------GFYNTISLGVGMKF 205
                            + I LGV  KF
Sbjct: 218 SVVDGDLSVEARNKFKTHDIRLGVAYKF 245


>gi|156739532|gb|ABU93426.1| Omp25 [Brucella suis]
 gi|156739566|gb|ABU93443.1| Omp25 [Brucella melitensis]
 gi|156739572|gb|ABU93446.1| Omp25 [Brucella melitensis]
 gi|156739576|gb|ABU93448.1| Omp25 [Brucella melitensis]
          Length = 106

 Score =  125 bits (313), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 32/105 (30%), Positives = 54/105 (51%), Gaps = 3/105 (2%)

Query: 74  HNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLA-DNIHSLHGIGGSLRIRGGYEVSDSL 132
            +     FAG+N +   I+YGVEGD  Y+    + D +    G  GSLR R GY++ + +
Sbjct: 4   DDWKAGAFAGWNFQQDQIVYGVEGDAGYSWAKKSKDGLEVKQGFEGSLRARVGYDL-NPV 62

Query: 133 LLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLV 177
           + Y T G   +Q        + +   +G TAG G+E   L+++++
Sbjct: 63  MPYLTAGIAGSQIKLNNGLDDESKFRVGWTAGAGLEA-KLTDNIL 106


>gi|260169699|ref|ZP_05756510.1| outer membrane protein [Brucella sp. F5/99]
 gi|261759235|ref|ZP_06002944.1| outer membrane protein [Brucella sp. F5/99]
 gi|261739219|gb|EEY27215.1| outer membrane protein [Brucella sp. F5/99]
          Length = 228

 Score =  124 bits (312), Expect = 6e-27,   Method: Composition-based stats.
 Identities = 44/200 (22%), Positives = 72/200 (36%), Gaps = 38/200 (19%)

Query: 42  ATNRYVPIRHDFNGPYAGLSALYNGSFGEEAHHNAG----------GSIFAGYNVEDSC- 90
                V +   +NG Y G    Y       ++ + G          G ++AGYN +    
Sbjct: 31  PAPVVVALTFTWNGAYLGGQIGYAWGKSHFSYDSTGLGDIKPDGFLGGLYAGYNFDLGNS 90

Query: 91  IMYGVEGDVRYTVPVLADNI----------HSLHGIGGSLRIRGGYEVSDSLLLYATVGP 140
           ++ G++GDV Y       +            +     G++R R GY V D  L Y   G 
Sbjct: 91  VVLGIDGDVTYNDVSKNIDFLDENNAAATFENRLRWSGAVRARAGYAV-DRFLPYIAGGV 149

Query: 141 DVA----QKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFY-- 194
                  +    G     +    G T G G++    +++++ RLEYR + Y   +  +  
Sbjct: 150 AFGSLRNRGEFEGTGFSQSKTLTGWTIGAGMDYAA-TDNVILRLEYRYTDYGNKDYGFDD 208

Query: 195 ---------NTISLGVGMKF 205
                    N I  GV  KF
Sbjct: 209 AAVTNNFKTNDIRFGVAYKF 228


>gi|156739546|gb|ABU93433.1| Omp25 [Brucella abortus]
          Length = 109

 Score =  124 bits (312), Expect = 6e-27,   Method: Composition-based stats.
 Identities = 33/110 (30%), Positives = 55/110 (50%), Gaps = 3/110 (2%)

Query: 69  GEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLA-DNIHSLHGIGGSLRIRGGYE 127
           G     +     FAG+N +   I+YGVEGD  Y+    + D +    G  GSLR R GY+
Sbjct: 2   GSIKPDDWKAGAFAGWNFQQDQIVYGVEGDAGYSWAKKSKDGLEVKQGFEGSLRARVGYD 61

Query: 128 VSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLV 177
           + + ++ Y T G   +Q        + +   +G TAG G+E   L+++++
Sbjct: 62  L-NPVMPYLTAGIAGSQIKLNNGLDDESKFRVGWTAGAGLEA-KLTDNIL 109


>gi|17987290|ref|NP_539924.1| 25 kDa outer-membrane immunogenic protein precursor [Brucella
           melitensis bv. 1 str. 16M]
 gi|23501854|ref|NP_697981.1| outer membrane protein [Brucella suis 1330]
 gi|163843239|ref|YP_001627643.1| 22 kDa outer membrane protein precursor [Brucella suis ATCC 23445]
 gi|225852477|ref|YP_002732710.1| porin [Brucella melitensis ATCC 23457]
 gi|254704272|ref|ZP_05166100.1| porin [Brucella suis bv. 3 str. 686]
 gi|254706827|ref|ZP_05168655.1| porin [Brucella pinnipedialis M163/99/10]
 gi|256061069|ref|ZP_05451225.1| porin [Brucella neotomae 5K33]
 gi|256369396|ref|YP_003106904.1| outer membrane protein, putative [Brucella microti CCM 4915]
 gi|260168691|ref|ZP_05755502.1| outer membrane protein, putative [Brucella sp. F5/99]
 gi|261314294|ref|ZP_05953491.1| outer membrane protein 25b [Brucella pinnipedialis M163/99/10]
 gi|261325071|ref|ZP_05964268.1| outer membrane protein 25b [Brucella neotomae 5K33]
 gi|261754939|ref|ZP_05998648.1| outer membrane protein 25b [Brucella suis bv. 3 str. 686]
 gi|265991062|ref|ZP_06103619.1| outer membrane protein 25b [Brucella melitensis bv. 1 str. Rev.1]
 gi|17982969|gb|AAL52188.1| 25 kDa outer-membrane immunogenic protein precursor [Brucella
           melitensis bv. 1 str. 16M]
 gi|23347791|gb|AAN29896.1| outer membrane protein, putative [Brucella suis 1330]
 gi|46251214|gb|AAS84578.1| Omp25b [Brucella neotomae]
 gi|163673962|gb|ABY38073.1| 22 kDa outer membrane protein precursor [Brucella suis ATCC 23445]
 gi|225640842|gb|ACO00756.1| porin [Brucella melitensis ATCC 23457]
 gi|255999556|gb|ACU47955.1| outer membrane protein, putative [Brucella microti CCM 4915]
 gi|261301051|gb|EEY04548.1| outer membrane protein 25b [Brucella neotomae 5K33]
 gi|261303320|gb|EEY06817.1| outer membrane protein 25b [Brucella pinnipedialis M163/99/10]
 gi|261744692|gb|EEY32618.1| outer membrane protein 25b [Brucella suis bv. 3 str. 686]
 gi|263001846|gb|EEZ14421.1| outer membrane protein 25b [Brucella melitensis bv. 1 str. Rev.1]
 gi|326408994|gb|ADZ66059.1| porin [Brucella melitensis M28]
          Length = 236

 Score =  124 bits (312), Expect = 6e-27,   Method: Composition-based stats.
 Identities = 41/208 (19%), Positives = 66/208 (31%), Gaps = 46/208 (22%)

Query: 42  ATNRYVPIRHDFNGPYAGLSALYNGSFGEEAHHNAG---------GSIFAGYNVEDSC-I 91
                V     +NG Y G    Y       +  +           G ++AGYN +     
Sbjct: 31  PAPVVVAPTFTWNGAYLGGQIGYGWGRSTLSDEDTSIRVKPDGFLGGLYAGYNFDMGNNF 90

Query: 92  MYGVEGDVRYTVPVLA-----------DNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGP 140
           + GV+GD+ Y     +             + S     G++R R G  + D  + Y   G 
Sbjct: 91  VLGVDGDITYNDLDASHSDTDPDLDLTTGVDSKLRWSGAVRARMGVAM-DRWMPYIAGGV 149

Query: 141 DVAQKY--------ETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVE- 191
                                 +    G  AG GV+    +++++ RLEYR + Y   + 
Sbjct: 150 AFGNVKNSVSLTDGIESIGVSQSKTMTGWAAGAGVDYAA-TDNVIVRLEYRYTDYGHKDF 208

Query: 192 --------------GFYNTISLGVGMKF 205
                            + I LGV  KF
Sbjct: 209 SVVDGDLSVEARNKFKTHDIRLGVAYKF 236


>gi|156739538|gb|ABU93429.1| Omp25 [Brucella abortus]
 gi|156739542|gb|ABU93431.1| Omp25 [Brucella abortus]
 gi|156739562|gb|ABU93441.1| Omp25 [Brucella melitensis]
 gi|156739574|gb|ABU93447.1| Omp25 [Brucella melitensis]
 gi|156739596|gb|ABU93458.1| Omp25 [Brucella suis]
 gi|156739600|gb|ABU93460.1| Omp25 [Brucella suis]
 gi|156739604|gb|ABU93462.1| Omp25 [Brucella suis]
 gi|156739616|gb|ABU93468.1| Omp25 [Brucella melitensis]
 gi|156739628|gb|ABU93474.1| Omp25 [Brucella abortus]
          Length = 108

 Score =  124 bits (312), Expect = 7e-27,   Method: Composition-based stats.
 Identities = 33/110 (30%), Positives = 55/110 (50%), Gaps = 3/110 (2%)

Query: 69  GEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLA-DNIHSLHGIGGSLRIRGGYE 127
           G     +     FAG+N +   I+YGVEGD  Y+    + D +    G  GSLR R GY+
Sbjct: 1   GSIKPDDWKAGAFAGWNFQQDQIVYGVEGDAGYSWAKKSKDGLEVKQGFEGSLRARVGYD 60

Query: 128 VSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLV 177
           + + ++ Y T G   +Q        + +   +G TAG G+E   L+++++
Sbjct: 61  L-NPVMPYLTAGIAGSQIKLNNGLDDESKFRVGWTAGAGLEA-KLTDNIL 108


>gi|118591879|ref|ZP_01549274.1| outer membrane protein, putative [Stappia aggregata IAM 12614]
 gi|118435522|gb|EAV42168.1| outer membrane protein, putative [Stappia aggregata IAM 12614]
          Length = 223

 Score =  124 bits (311), Expect = 7e-27,   Method: Composition-based stats.
 Identities = 54/232 (23%), Positives = 89/232 (38%), Gaps = 36/232 (15%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M++L LA    + A  +     AAD  +         VP    +       D+ G Y G 
Sbjct: 1   MKRLALAGMALTAAATASAPVLAADLPQS-PAPAYEAVPAPQQSI------DWTGLYVGG 53

Query: 61  SALYN-GSFGEEAHHNAG---------GSIFAGYNVE-DSCIMYGVEGDVRYTVPVLADN 109
           +  +  G F  +A +N G         G ++ GYN +    I+ G E D   T    + +
Sbjct: 54  NLGWAFGQFDNKAGNNTGLGVDANGIAGGLYTGYNFQVTPNIVVGAEADFSLTDLEKSKS 113

Query: 110 -----IHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAG 164
                + S      + R R GY   D  L+Y   G  +A    +G     +  A+G T G
Sbjct: 114 NGGLTLRSKSDWNSNFRGRVGYAF-DRYLVYGAGGLAIADLEVSGNGDTDSKTALGWTLG 172

Query: 165 VGVEVGGLSESLVARLEYRASKYSKVEGFYN-----------TISLGVGMKF 205
            G E   ++ ++ A+LEY    + + +   N            + +G+G KF
Sbjct: 173 AGGEA-AITNNVTAKLEYVYQDFGEQDFNLNGTGVSSDFNNSQVRMGIGYKF 223


>gi|265994897|ref|ZP_06107454.1| outer membrane protein 25b [Brucella melitensis bv. 3 str. Ether]
 gi|262766010|gb|EEZ11799.1| outer membrane protein 25b [Brucella melitensis bv. 3 str. Ether]
          Length = 236

 Score =  124 bits (311), Expect = 8e-27,   Method: Composition-based stats.
 Identities = 48/247 (19%), Positives = 79/247 (31%), Gaps = 56/247 (22%)

Query: 3   KLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSA 62
            +   +  S++ L +   A+AAD V                   V     +NG Y G   
Sbjct: 2   TIKSLLLASTVVLVAATGAKAADAVIEQE----------PAPVVVAPTFTWNGAYLGGQI 51

Query: 63  LYNGSFGEEAHHNAG---------GSIFAGYNVEDSC-IMYGVEGDVRYTVPVLA----- 107
            Y       +  +           G ++AGYN +     + GV+GD+ Y     +     
Sbjct: 52  GYGWGHSTLSDEDTSIRVKPDGFLGGLYAGYNFDMGNNFVLGVDGDITYNDLDASHSDTD 111

Query: 108 ------DNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKY--------ETGKAGE 153
                   + S     G++R R G  + D  + Y   G                      
Sbjct: 112 PDLDLTTGVDSKLRWSGAVRARMGVAM-DRWMPYIAGGVAFGNVKNSVSLTDGIESIGVS 170

Query: 154 ITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVE---------------GFYNTIS 198
            +    G  AG GV+    +++++ RLEYR + Y   +                  + I 
Sbjct: 171 QSKTMTGWAAGAGVDYAA-TDNVIVRLEYRYTDYGHKDFSVVDGDLSVEARNKFKTHDIR 229

Query: 199 LGVGMKF 205
           LGV  KF
Sbjct: 230 LGVAYKF 236


>gi|256044638|ref|ZP_05447542.1| porin [Brucella melitensis bv. 1 str. Rev.1]
 gi|326538706|gb|ADZ86921.1| porin [Brucella melitensis M5-90]
          Length = 240

 Score =  124 bits (311), Expect = 9e-27,   Method: Composition-based stats.
 Identities = 41/208 (19%), Positives = 66/208 (31%), Gaps = 46/208 (22%)

Query: 42  ATNRYVPIRHDFNGPYAGLSALYNGSFGEEAHHNAG---------GSIFAGYNVEDSC-I 91
                V     +NG Y G    Y       +  +           G ++AGYN +     
Sbjct: 35  PAPVVVAPTFTWNGAYLGGQIGYGWGRSTLSDEDTSIRVKPDGFLGGLYAGYNFDMGNNF 94

Query: 92  MYGVEGDVRYTVPVLA-----------DNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGP 140
           + GV+GD+ Y     +             + S     G++R R G  + D  + Y   G 
Sbjct: 95  VLGVDGDITYNDLDASHSDTDPDLDLTTGVDSKLRWSGAVRARMGVAM-DRWMPYIAGGV 153

Query: 141 DVAQKY--------ETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVE- 191
                                 +    G  AG GV+    +++++ RLEYR + Y   + 
Sbjct: 154 AFGNVKNSVSLTDGIESIGVSQSKTMTGWAAGAGVDYAA-TDNVIVRLEYRYTDYGHKDF 212

Query: 192 --------------GFYNTISLGVGMKF 205
                            + I LGV  KF
Sbjct: 213 SVVDGDLSVEARNKFKTHDIRLGVAYKF 240


>gi|156739524|gb|ABU93422.1| Omp25 [Brucella neotomae]
          Length = 128

 Score =  123 bits (310), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 42/133 (31%), Positives = 65/133 (48%), Gaps = 15/133 (11%)

Query: 55  GPYAGLSALYNGSFGEEAHHNAGGSI---------FAGYNVEDSCIMYGVEGDVRYTVPV 105
           G Y GL   Y G    +A  +  GSI         FAG+N +   I+YGVEGD  Y+   
Sbjct: 1   GGYTGL---YLGYGWNKAKTSTVGSIKPDDWKAGAFAGWNFQQDQIVYGVEGDAGYSWAK 57

Query: 106 LA-DNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAG 164
            + D +    G  GSLR R GY++ + ++ Y T G   +Q        + +   +G TAG
Sbjct: 58  KSKDGLEVKQGFEGSLRARVGYDL-NLVMPYLTAGIAGSQIKLNNGLDDESKFRVGWTAG 116

Query: 165 VGVEVGGLSESLV 177
            G+E   L+++++
Sbjct: 117 AGLEA-KLTDNIL 128


>gi|256113516|ref|ZP_05454350.1| porin [Brucella melitensis bv. 3 str. Ether]
          Length = 240

 Score =  123 bits (310), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 48/247 (19%), Positives = 79/247 (31%), Gaps = 56/247 (22%)

Query: 3   KLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSA 62
            +   +  S++ L +   A+AAD V                   V     +NG Y G   
Sbjct: 6   TIKSLLLASTVVLVAATGAKAADAVIEQE----------PAPVVVAPTFTWNGAYLGGQI 55

Query: 63  LYNGSFGEEAHHNAG---------GSIFAGYNVEDSC-IMYGVEGDVRYTVPVLA----- 107
            Y       +  +           G ++AGYN +     + GV+GD+ Y     +     
Sbjct: 56  GYGWGHSTLSDEDTSIRVKPDGFLGGLYAGYNFDMGNNFVLGVDGDITYNDLDASHSDTD 115

Query: 108 ------DNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKY--------ETGKAGE 153
                   + S     G++R R G  + D  + Y   G                      
Sbjct: 116 PDLDLTTGVDSKLRWSGAVRARMGVAM-DRWMPYIAGGVAFGNVKNSVSLTDGIESIGVS 174

Query: 154 ITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVE---------------GFYNTIS 198
            +    G  AG GV+    +++++ RLEYR + Y   +                  + I 
Sbjct: 175 QSKTMTGWAAGAGVDYAA-TDNVIVRLEYRYTDYGHKDFSVVDGDLSVEARNKFKTHDIR 233

Query: 199 LGVGMKF 205
           LGV  KF
Sbjct: 234 LGVAYKF 240


>gi|256809485|gb|ACV30843.1| 25 kDa outer membrane protein [Ochrobactrum cytisi]
          Length = 130

 Score =  123 bits (310), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 38/142 (26%), Positives = 60/142 (42%), Gaps = 22/142 (15%)

Query: 8   VGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGS 67
           V  S+  L    +A AAD ++          P +     +  ++ + G Y GL   Y G 
Sbjct: 1   VIASAALLPFSATAFAADAIQEQ--------PPVPAPVEMAPQYSWAGGYTGL---YLGY 49

Query: 68  FGEEAHHNAGG---------SIFAGYNVEDSCIMYGVEGDVRYTVPVLA-DNIHSLHGIG 117
              +A  +  G           +AG+N +    +YGVEGD  Y+      D +    G  
Sbjct: 50  GWNKAKTDTVGTIKPDDMKAGAYAGWNFQQDQFVYGVEGDAGYSWAKKTKDGLEVKQGFE 109

Query: 118 GSLRIRGGYEVSDSLLLYATVG 139
           GSLR R GY++ + ++ Y T G
Sbjct: 110 GSLRARLGYDL-NPVMPYITAG 130


>gi|156739536|gb|ABU93428.1| Omp25 [Brucella abortus]
          Length = 105

 Score =  123 bits (310), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 32/104 (30%), Positives = 53/104 (50%), Gaps = 3/104 (2%)

Query: 74  HNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLA-DNIHSLHGIGGSLRIRGGYEVSDSL 132
            +     FAG+N +   I+YGVEGD  Y+    + D +    G  GSLR R GY++ + +
Sbjct: 4   DDWKAGAFAGWNFQQDQIVYGVEGDAGYSWAKKSKDGLEVKQGFEGSLRARVGYDL-NPV 62

Query: 133 LLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESL 176
           + Y T G   +Q        + +   +G TAG G+E   L++++
Sbjct: 63  MPYLTAGIAGSQIKLNNGLDDESKFRVGWTAGAGLEA-KLTDNI 105


>gi|218517219|ref|ZP_03514059.1| outer membrane protein [Rhizobium etli 8C-3]
          Length = 153

 Score =  123 bits (309), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 40/150 (26%), Positives = 63/150 (42%), Gaps = 14/150 (9%)

Query: 68  FGEEAHHNAGGSIF---AGYNVEDSCIMYGVEGDVRYTVPVLAD-NIHSLHGIGGSLRIR 123
            G  A  +  G +F   AGYN +   I+ G+EG++ Y                 G++R R
Sbjct: 6   GGASASEDFNGGVFGGFAGYNFQFDNIVVGIEGNLEYNWNEEEALGADVGTDWAGAVRGR 65

Query: 124 GGYEVSDSLLLYATVGPDVAQKYETGKA-GEITPIAIGGTAGVGVEVGGLSESLVARLEY 182
            GY   D  L+Y   G    + Y       + T    G T G GV+   ++ ++ AR EY
Sbjct: 66  VGYAF-DKALIYGAAGWAATRGYVDAPGFDKETETFNGYTVGAGVDF-AITNNIFARGEY 123

Query: 183 RASKYS-------KVEGFYNTISLGVGMKF 205
           R + Y         V+   + +  G+G+KF
Sbjct: 124 RYNDYGERDILGVDVDLDQHELKFGIGVKF 153


>gi|256809411|gb|ACV30806.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
          Length = 130

 Score =  123 bits (309), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 38/142 (26%), Positives = 62/142 (43%), Gaps = 22/142 (15%)

Query: 8   VGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGS 67
           V  S+  L    +A AAD ++          P +     +  ++ + G Y GL   Y G 
Sbjct: 1   VIASAALLPFSATAFAADAIQEQ--------PPVPAPVEMAPQYSWAGGYTGL---YLGY 49

Query: 68  FGEEAHHNAGGSI---------FAGYNVEDSCIMYGVEGDVRYTVPVLA-DNIHSLHGIG 117
              +A  +  G++         +AG+N +    +YGVEGD  Y+      D +    G  
Sbjct: 50  GWNKAKTDTVGTVKPDDMKAGAYAGWNFQQDQFVYGVEGDAGYSWAKKTKDGLEVKQGFE 109

Query: 118 GSLRIRGGYEVSDSLLLYATVG 139
           GSLR R GY++ + ++ Y T G
Sbjct: 110 GSLRARLGYDL-NPIMPYITAG 130


>gi|256809513|gb|ACV30857.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
          Length = 130

 Score =  123 bits (309), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 39/142 (27%), Positives = 62/142 (43%), Gaps = 22/142 (15%)

Query: 8   VGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGS 67
           V  S+  L    +A AAD ++          P +     +  ++ + G Y GL   Y G 
Sbjct: 1   VIASAALLPFSATAFAADAIQEQ--------PPVPAPVEMAPQYSWAGGYTGL---YLGY 49

Query: 68  FGEEAHHNAGG---------SIFAGYNVEDSCIMYGVEGDVRYTVPVLA-DNIHSLHGIG 117
              +A  +A G           +AG+N +    +YGVEGD  Y+    + D +    G  
Sbjct: 50  GWNKAKTDAVGTIKPDDMKAGAYAGWNFQQDQFVYGVEGDAGYSWAKKSKDGLEVKQGFE 109

Query: 118 GSLRIRGGYEVSDSLLLYATVG 139
           GSLR R GY++ + ++ Y T G
Sbjct: 110 GSLRARLGYDL-NPVMPYITAG 130


>gi|256809429|gb|ACV30815.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809431|gb|ACV30816.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809433|gb|ACV30817.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809435|gb|ACV30818.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809437|gb|ACV30819.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809439|gb|ACV30820.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809441|gb|ACV30821.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809443|gb|ACV30822.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809445|gb|ACV30823.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809519|gb|ACV30860.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809521|gb|ACV30861.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809525|gb|ACV30863.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809539|gb|ACV30870.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
          Length = 130

 Score =  123 bits (309), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 36/139 (25%), Positives = 58/139 (41%), Gaps = 16/139 (11%)

Query: 8   VGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGS 67
           V  S+  L    +A AAD ++          P +     +  ++ + G Y GL   Y  +
Sbjct: 1   VIASAALLPFSATAFAADAIQEQ--------PPVPAPVEMAPQYSWAGGYTGLYLGYGWN 52

Query: 68  ------FGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLA-DNIHSLHGIGGSL 120
                  G     +     +AG+N +    +YGVEGD  Y+      D +    G  GSL
Sbjct: 53  KVKTDTVGTVKPDDMKAGAYAGWNFQQDQFVYGVEGDAGYSWAKKTKDGLEVKQGFEGSL 112

Query: 121 RIRGGYEVSDSLLLYATVG 139
           R R GY++ + ++ Y T G
Sbjct: 113 RARLGYDL-NPVMPYITAG 130


>gi|256809401|gb|ACV30801.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809403|gb|ACV30802.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809405|gb|ACV30803.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809407|gb|ACV30804.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809409|gb|ACV30805.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809413|gb|ACV30807.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809415|gb|ACV30808.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809417|gb|ACV30809.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809419|gb|ACV30810.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809421|gb|ACV30811.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809423|gb|ACV30812.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809425|gb|ACV30813.1| 25 kDa outer membrane protein [Ochrobactrum lupini]
 gi|256809427|gb|ACV30814.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809447|gb|ACV30824.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809449|gb|ACV30825.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809451|gb|ACV30826.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809453|gb|ACV30827.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809455|gb|ACV30828.1| 25 kDa outer membrane protein [Ochrobactrum anthropi ATCC 49188]
 gi|256809457|gb|ACV30829.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809459|gb|ACV30830.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809461|gb|ACV30831.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809463|gb|ACV30832.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809465|gb|ACV30833.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809467|gb|ACV30834.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809469|gb|ACV30835.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809471|gb|ACV30836.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809473|gb|ACV30837.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809475|gb|ACV30838.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809477|gb|ACV30839.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809479|gb|ACV30840.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809481|gb|ACV30841.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809483|gb|ACV30842.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809487|gb|ACV30844.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809489|gb|ACV30845.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809491|gb|ACV30846.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809493|gb|ACV30847.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809495|gb|ACV30848.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809497|gb|ACV30849.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809499|gb|ACV30850.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809501|gb|ACV30851.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809503|gb|ACV30852.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809505|gb|ACV30853.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809507|gb|ACV30854.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809509|gb|ACV30855.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809511|gb|ACV30856.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809515|gb|ACV30858.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809517|gb|ACV30859.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809523|gb|ACV30862.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809527|gb|ACV30864.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809529|gb|ACV30865.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809531|gb|ACV30866.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809533|gb|ACV30867.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809535|gb|ACV30868.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
          Length = 130

 Score =  123 bits (309), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 38/142 (26%), Positives = 62/142 (43%), Gaps = 22/142 (15%)

Query: 8   VGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGS 67
           V  S+  L    +A AAD ++          P +     +  ++ + G Y GL   Y G 
Sbjct: 1   VIASAALLPFSATAFAADAIQEQ--------PPVPAPVEMAPQYSWAGGYTGL---YLGY 49

Query: 68  FGEEAHHNAGGSI---------FAGYNVEDSCIMYGVEGDVRYTVPVLA-DNIHSLHGIG 117
              +A  +  G++         +AG+N +    +YGVEGD  Y+      D +    G  
Sbjct: 50  GWNKAKTDTVGTVKPDDMKAGAYAGWNFQQDQFVYGVEGDAGYSWAKKTKDGLEVKQGFE 109

Query: 118 GSLRIRGGYEVSDSLLLYATVG 139
           GSLR R GY++ + ++ Y T G
Sbjct: 110 GSLRARLGYDL-NPVMPYITAG 130


>gi|256254959|ref|ZP_05460495.1| porin [Brucella ceti B1/94]
 gi|261222144|ref|ZP_05936425.1| Omp25b [Brucella ceti B1/94]
 gi|265998108|ref|ZP_06110665.1| Omp25b [Brucella ceti M490/95/1]
 gi|46251220|gb|AAS84581.1| Omp25b [Brucella ceti]
 gi|46251222|gb|AAS84582.1| Omp25b [Brucella ceti]
 gi|260920728|gb|EEX87381.1| Omp25b [Brucella ceti B1/94]
 gi|262552576|gb|EEZ08566.1| Omp25b [Brucella ceti M490/95/1]
          Length = 236

 Score =  123 bits (308), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 35/179 (19%), Positives = 59/179 (32%), Gaps = 31/179 (17%)

Query: 42  ATNRYVPIRHDFNGPYAGLSALYNGSFGEEAHHNAG---------GSIFAGYNVEDSC-I 91
                V     +NG Y G    Y       +  +           G ++AGYN +     
Sbjct: 31  PAPVVVAPTFTWNGAYLGGQIGYGWGRSTLSDEDTSIRVKPDGFLGGLYAGYNFDMGNNF 90

Query: 92  MYGVEGDVRYTVPVLA-----------DNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGP 140
           + GV+GD+ Y     +             + S     G++R R G  + D  + Y   G 
Sbjct: 91  VLGVDGDITYNDLDASHSDTDPDLDLTTGVDSKLRWSGAVRARMGVAM-DRWMPYIAGGV 149

Query: 141 DVAQKY--------ETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVE 191
                                 +    G  AG GV+    +++++ RLEYR + Y   +
Sbjct: 150 AFGNVKNSVSLTDGIESIGVSQSKTMTGWAAGAGVDYAA-TDNVIVRLEYRYTDYGHKD 207


>gi|156739580|gb|ABU93450.1| Omp25 [Brucella canis]
          Length = 105

 Score =  123 bits (308), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 32/105 (30%), Positives = 54/105 (51%), Gaps = 3/105 (2%)

Query: 74  HNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLA-DNIHSLHGIGGSLRIRGGYEVSDSL 132
            +     FAG+N +   I+YGVEGD  Y+    + D +    G  GSLR R GY++ + +
Sbjct: 3   DDWKAGAFAGWNFQKDQIVYGVEGDAGYSWAKKSKDGLEVKQGFEGSLRARVGYDL-NPV 61

Query: 133 LLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLV 177
           + Y T G   +Q        + +   +G TAG G+E   L+++++
Sbjct: 62  MPYLTAGIAGSQIKLNNGLDDESKFRVGWTAGAGLEA-KLTDNIL 105


>gi|158425585|ref|YP_001526877.1| outer membrane protein Omp31 precursor [Azorhizobium caulinodans
           ORS 571]
 gi|158332474|dbj|BAF89959.1| outer membrane protein Omp31 precursor [Azorhizobium caulinodans
           ORS 571]
          Length = 212

 Score =  123 bits (308), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 55/217 (25%), Positives = 80/217 (36%), Gaps = 26/217 (11%)

Query: 6   LAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYN 65
           + V  +  +L     A AAD  R A           A+    P    + G Y G +  Y 
Sbjct: 5   VLVTGALASLLFAAPAMAADLSRPAPAM-------PASAVSAPPVFSWTGFYIGANTGYA 57

Query: 66  GSFGEEAHHNAG-------GSIFAGYNVE-DSCIMYGVEGDVRYTVPVLADN-IHSLHGI 116
              G+ +    G       G    GYN +  + ++ G+E DV+       +  + S    
Sbjct: 58  WGSGKGSADALGLDPDGWFGGGQVGYNYQFQNNMLVGLEADVQGGGISAGNGPVSSKLES 117

Query: 117 GGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESL 176
            G++R R GY V D +L Y T G        T      +    G T G GVE   L+ + 
Sbjct: 118 FGTVRARLGYAV-DRVLPYVTGGFAWGNNKITDFGTSQSQTLTGWTVGGGVEY-ALTNNW 175

Query: 177 VARLEYRASKYSKVEGF--------YNTISLGVGMKF 205
            AR EY  +   K +           +T  LGV  KF
Sbjct: 176 TARAEYLYTDLGKADYKALGEAGVAASTARLGVNYKF 212


>gi|256159691|ref|ZP_05457444.1| porin [Brucella ceti M490/95/1]
          Length = 240

 Score =  122 bits (307), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 35/179 (19%), Positives = 59/179 (32%), Gaps = 31/179 (17%)

Query: 42  ATNRYVPIRHDFNGPYAGLSALYNGSFGEEAHHNAG---------GSIFAGYNVEDSC-I 91
                V     +NG Y G    Y       +  +           G ++AGYN +     
Sbjct: 35  PAPVVVAPTFTWNGAYLGGQIGYGWGRSTLSDEDTSIRVKPDGFLGGLYAGYNFDMGNNF 94

Query: 92  MYGVEGDVRYTVPVLA-----------DNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGP 140
           + GV+GD+ Y     +             + S     G++R R G  + D  + Y   G 
Sbjct: 95  VLGVDGDITYNDLDASHSDTDPDLDLTTGVDSKLRWSGAVRARMGVAM-DRWMPYIAGGV 153

Query: 141 DVAQKY--------ETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVE 191
                                 +    G  AG GV+    +++++ RLEYR + Y   +
Sbjct: 154 AFGNVKNSVSLTDGIESIGVSQSKTMTGWAAGAGVDYAA-TDNVIVRLEYRYTDYGHKD 211


>gi|156739612|gb|ABU93466.1| Omp25 [Brucella canis]
          Length = 104

 Score =  122 bits (307), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 32/105 (30%), Positives = 54/105 (51%), Gaps = 3/105 (2%)

Query: 74  HNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLA-DNIHSLHGIGGSLRIRGGYEVSDSL 132
            +     FAG+N +   I+YGVEGD  Y+    + D +    G  GSLR R GY++ + +
Sbjct: 2   DDWKAGAFAGWNFQKDQIVYGVEGDAGYSWAKKSKDGLEVKQGFEGSLRARVGYDL-NPV 60

Query: 133 LLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLV 177
           + Y T G   +Q        + +   +G TAG G+E   L+++++
Sbjct: 61  MPYLTAGIAGSQIKLNNGLDDESKFRVGWTAGAGLEA-KLTDNIL 104


>gi|90422419|ref|YP_530789.1| putative outer-membrane immunogenic protein precursor
           [Rhodopseudomonas palustris BisB18]
 gi|90104433|gb|ABD86470.1| putative outer-membrane immunogenic protein precursor
           [Rhodopseudomonas palustris BisB18]
          Length = 207

 Score =  122 bits (306), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 52/197 (26%), Positives = 77/197 (39%), Gaps = 25/197 (12%)

Query: 17  SFCSAQAADPVRRAHHGGRGVVPTIATNRYVPI-RHDFNGPYAGLSALYNGSFGEEAHH- 74
              SAQAAD                    Y P+  H + GPY G +  Y       +   
Sbjct: 15  GLSSAQAADLPYGGSR--------APYTVYQPLNAHSWAGPYLGGNLGYAWGDVHNSATE 66

Query: 75  --NAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIG----GSLRIRGGYEV 128
                G + AGYN +    +YG+EGD+  T    AD+  +         G++R R GY  
Sbjct: 67  PSGVAGGVQAGYNWQSGQFVYGLEGDIAITG---ADDTFASWKFSNPWFGTVRGRAGYSF 123

Query: 129 SDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYS 188
            D+LL+YAT G    +          +    G T G G E  GL+++  A++EY      
Sbjct: 124 -DNLLVYATGGLAFGELKGERFGQSNSSTNAGWTIGAGAEF-GLNQNWSAKVEYLYVDLG 181

Query: 189 ----KVEGFYNTISLGV 201
                + G  N+   G+
Sbjct: 182 GSNFSITGVQNSYQFGI 198


>gi|254701730|ref|ZP_05163558.1| porin [Brucella suis bv. 5 str. 513]
 gi|261752281|ref|ZP_05995990.1| outer membrane protein 25b [Brucella suis bv. 5 str. 513]
 gi|261742034|gb|EEY29960.1| outer membrane protein 25b [Brucella suis bv. 5 str. 513]
          Length = 236

 Score =  122 bits (306), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 40/208 (19%), Positives = 65/208 (31%), Gaps = 46/208 (22%)

Query: 42  ATNRYVPIRHDFNGPYAGLSALYNGSFGEEAHHNAG---------GSIFAGYNVEDSC-I 91
                V     +NG Y G    Y       +  +           G ++AGYN +     
Sbjct: 31  PAPVVVAPTFTWNGAYLGGQIGYGWGRSTLSDEDTSIRVKPDGFLGGLYAGYNFDMGNNF 90

Query: 92  MYGVEGDVRYTVPVLA-----------DNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGP 140
           + GV+GD+ Y     +             + S     G++R R    + D  + Y   G 
Sbjct: 91  VLGVDGDITYNDLDASHSDTDPDLDLTTGVDSKLRWSGAVRARMSVAM-DRWMPYIAGGV 149

Query: 141 DVAQKY--------ETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVE- 191
                                 +    G  AG GV+    +++++ RLEYR + Y   + 
Sbjct: 150 AFGNVKNSVSLTDGIESIGVSQSKTMTGWAAGAGVDYAA-TDNVIVRLEYRYTDYGHKDF 208

Query: 192 --------------GFYNTISLGVGMKF 205
                            + I LGV  KF
Sbjct: 209 SVVDGDLSVEARNKFKTHDIRLGVAYKF 236


>gi|156739534|gb|ABU93427.1| Omp25 [Brucella suis]
 gi|156739618|gb|ABU93469.1| Omp25 [Brucella melitensis]
          Length = 98

 Score =  121 bits (304), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 32/100 (32%), Positives = 53/100 (53%), Gaps = 3/100 (3%)

Query: 79  SIFAGYNVEDSCIMYGVEGDVRYTVPVLA-DNIHSLHGIGGSLRIRGGYEVSDSLLLYAT 137
             FAG+N +   I+YGVEGD  Y+    + D +    G  GSLR R GY++ + ++ Y T
Sbjct: 1   GAFAGWNFQQDQIVYGVEGDAGYSWAKKSKDGLEVKQGFEGSLRARVGYDL-NPVMPYLT 59

Query: 138 VGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLV 177
            G   +Q        + +   +G TAG G+E   L+++++
Sbjct: 60  AGIAGSQIKLNNGLDDESKFRVGWTAGAGLEA-KLTDNIL 98


>gi|256809537|gb|ACV30869.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
          Length = 130

 Score =  120 bits (302), Expect = 9e-26,   Method: Composition-based stats.
 Identities = 37/142 (26%), Positives = 60/142 (42%), Gaps = 22/142 (15%)

Query: 8   VGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGS 67
           V   +  L    +A AAD ++          P +        ++ + G Y GL   Y G 
Sbjct: 1   VIALAALLPFSATAFAADAIQEQ--------PPVPAPVEKAPQYSWAGGYTGL---YLGY 49

Query: 68  FGEEAHHNAGGSI---------FAGYNVEDSCIMYGVEGDVRYTVPVLA-DNIHSLHGIG 117
              +A  +  G++         +AG+N +    +YGVEGD  Y+      D +    G  
Sbjct: 50  GWNKAKTDTVGTVKPDDMKAGAYAGWNFQQDQFVYGVEGDAGYSWAKKTKDGLEVKQGFE 109

Query: 118 GSLRIRGGYEVSDSLLLYATVG 139
           GSLR R GY++ + ++ Y T G
Sbjct: 110 GSLRARLGYDL-NPVMPYITAG 130


>gi|85716040|ref|ZP_01047017.1| putative outer-membrane immunogenic protein precursor [Nitrobacter
           sp. Nb-311A]
 gi|85697238|gb|EAQ35119.1| putative outer-membrane immunogenic protein precursor [Nitrobacter
           sp. Nb-311A]
          Length = 206

 Score =  119 bits (299), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 48/195 (24%), Positives = 79/195 (40%), Gaps = 16/195 (8%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M K  +A   +  + A   +AQAAD   RA +     +              + GPY G 
Sbjct: 1   MSKTLIAALATMASTALIGTAQAADFSYRAPYTVNQPL----------NAFSWAGPYLGG 50

Query: 61  SALYNGSFGEEA---HHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLA-DNIHSLHGI 116
           +  Y     + +        G + AGYN +   +++G+EGD++              +  
Sbjct: 51  NLGYAWGSVQNSLTKPDGVFGGVQAGYNWQSGSMVFGLEGDIQANAANDTFAAWKFSNPW 110

Query: 117 GGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESL 176
            G++R R GY  S+ +L+Y T G    +      A   +    G T GVG EV G+ ++ 
Sbjct: 111 FGTVRGRLGYAFSN-VLVYGTGGLAFGKLRAETFALSESHTNAGWTVGVGAEV-GIYQNW 168

Query: 177 VARLEYRASKYSKVE 191
            A++EY     S   
Sbjct: 169 TAKVEYLYVDLSSSN 183


>gi|153007477|ref|YP_001368692.1| porin [Ochrobactrum anthropi ATCC 49188]
 gi|151559365|gb|ABS12863.1| porin [Ochrobactrum anthropi ATCC 49188]
          Length = 229

 Score =  119 bits (298), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 49/241 (20%), Positives = 80/241 (33%), Gaps = 51/241 (21%)

Query: 3   KLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSA 62
           K  + +G S LA+ +   A AAD +                         + G Y G   
Sbjct: 2   KFRILLGASLLAVVASTGAYAADAIVSQEPAPM-----------AAPAFSWGGAYIGGEI 50

Query: 63  LYNGSFG-----------EEAHHNAGGSIFAGYNVEDS-CIMYGVEGDVRYTVPVLADN- 109
            +                E   +   G ++AGYN +    ++ GV+G+  Y     + + 
Sbjct: 51  GWGWGRAKLDDKSTDQSNEFKPNGFIGGVYAGYNFDMGNNVILGVDGNFDYNDLKKSHDY 110

Query: 110 ----------IHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAG----EIT 155
                       +     G++R R GY V D  + Y   G        +   G       
Sbjct: 111 ISNSNAVQTSAETKLQWSGAVRARAGYAV-DRFMPYIAGGVAFGGVKNSLNVGGSDYNND 169

Query: 156 PIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGF-----------YNTISLGVGMK 204
               G T G GV+    +++++ RLEYR + +   +              N I LGV  K
Sbjct: 170 KTLTGWTVGTGVDYAA-TDNVLLRLEYRYTDFGNKDFDLGNTATRGSFKTNDIRLGVAYK 228

Query: 205 F 205
           F
Sbjct: 229 F 229


>gi|306841014|ref|ZP_07473744.1| outer membrane protein Omp31 [Brucella sp. BO2]
 gi|306846349|ref|ZP_07478900.1| outer membrane protein Omp31 [Brucella sp. BO1]
 gi|306273192|gb|EFM55083.1| outer membrane protein Omp31 [Brucella sp. BO1]
 gi|306288964|gb|EFM60252.1| outer membrane protein Omp31 [Brucella sp. BO2]
          Length = 239

 Score =  118 bits (295), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 47/250 (18%), Positives = 82/250 (32%), Gaps = 64/250 (25%)

Query: 7   AVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNG 66
           +V ++S A+    SA AAD +                         + G Y G++A Y G
Sbjct: 3   SVLLASFAMLFASSAMAADAIVAE---------PAPVAVDT---FSWTGGYIGINAGYAG 50

Query: 67  SFG-------------------------EEAHHNAGGSIFAGYNVE-DSCIMYGVEGDVR 100
                                       +       G + AGYN + D+  + G E D +
Sbjct: 51  GKFKHPFSVAGLPTAGMNEEGGALSGSLDVTSSGFVGGVQAGYNWQLDNGFVLGAEADFQ 110

Query: 101 YT---------VPVLADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGK- 150
            +         +  L  N  +     G++R R GY  ++ LL+Y T G    +   +   
Sbjct: 111 GSTVKGDISAHLDDLDGNAETKVEWFGTVRARLGYTATERLLVYGTGGLAYGKVKSSLGI 170

Query: 151 ---AGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFY------------N 195
                  +    G T G G E   ++ +   + EY  +   K +               +
Sbjct: 171 EDWGVSSSKTKAGWTVGAGAEY-AINNNWTLKSEYLYTDLGKHDLINVNELSLKNDVKFH 229

Query: 196 TISLGVGMKF 205
           T+ +G+  KF
Sbjct: 230 TVRVGLNYKF 239


>gi|115522948|ref|YP_779859.1| putative outer-membrane immunogenic protein precursor
           [Rhodopseudomonas palustris BisA53]
 gi|115516895|gb|ABJ04879.1| putative outer-membrane immunogenic protein precursor
           [Rhodopseudomonas palustris BisA53]
          Length = 207

 Score =  115 bits (287), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 41/179 (22%), Positives = 65/179 (36%), Gaps = 13/179 (7%)

Query: 17  SFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSFGEEAH--- 73
              SAQAAD      +    V   +         + + GPY G +  Y            
Sbjct: 15  GLVSAQAADLSYGRSYAPYTVNQPLN-------AYSWAGPYLGGNLGYAWGDIHNNSAKP 67

Query: 74  HNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHG-IGGSLRIRGGYEVSDSL 132
               G I  GYN +   ++YG+EGD++ T        +       G++R R GY   +++
Sbjct: 68  SGLSGGIQGGYNWQSGQMVYGLEGDLQITGANDTFAQYKFSNPWFGTVRGRIGYAF-NNV 126

Query: 133 LLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVE 191
           + Y T G    +          +    G T G G E  GL  +  A++EY      +  
Sbjct: 127 MFYGTGGLAYGELTAEMGGLSQSHTNAGFTVGAGAEF-GLMPNWTAKIEYLYVDLGESN 184


>gi|148558438|ref|YP_001257410.1| outer membrane protein Omp31 [Brucella ovis ATCC 25840]
 gi|16611666|gb|AAL27291.1|AF366068_1 outer membrane protein Omp31 [Brucella ovis]
 gi|16611669|gb|AAL27292.1|AF366069_1 outer membrane protein Omp31 [Brucella ovis]
 gi|16611672|gb|AAL27293.1|AF366070_1 outer membrane protein Omp31 [Brucella ovis]
 gi|16611675|gb|AAL27294.1|AF366071_1 outer membrane protein Omp31 [Brucella ovis]
 gi|16611678|gb|AAL27295.1|AF366072_1 outer membrane protein Omp31 [Brucella ovis]
 gi|148369723|gb|ABQ62595.1| outer membrane protein Omp31 [Brucella ovis ATCC 25840]
          Length = 240

 Score =  114 bits (286), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 51/248 (20%), Positives = 83/248 (33%), Gaps = 59/248 (23%)

Query: 7   AVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNG 66
           +V ++S+A     SA AAD V           PT A          + G Y G++A Y G
Sbjct: 3   SVILASIAAMFATSAMAADVVVSEPSA-----PTAAPVD----TFSWTGGYIGINAGYAG 53

Query: 67  SFG-------------------EEAHHNAGGSIFAGYNVE-DSCIMYGVEGDVRY----- 101
                                 +       G + AGYN + D+ ++ G E D +      
Sbjct: 54  GKFKHPFSSFDKEDGEHVSGSPDVTAGGFVGGVQAGYNWQLDNGVVLGAETDFQGLSVTG 113

Query: 102 ----TVPVLADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEI--- 154
                   L  N  +     G++R R GY  ++ L++Y T G    +       G+    
Sbjct: 114 SISAGASSLEGNAETKVEWFGTVRARLGYTATERLMVYGTGGLAYGKVKSAFNLGDDAPA 173

Query: 155 -----TPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFY------------NTI 197
                     G T G G E   ++ +   + EY  +   K                 +T+
Sbjct: 174 LHTWSDKTKAGWTLGAGAEY-AINNNWTLKSEYLYTDLGKRNLVDVDNSFLESKVNFHTV 232

Query: 198 SLGVGMKF 205
            +G+  KF
Sbjct: 233 RVGLNYKF 240


>gi|163844591|ref|YP_001622246.1| hypothetical protein BSUIS_B0425 [Brucella suis ATCC 23445]
 gi|16611654|gb|AAL27287.1|AF366064_1 outer membrane protein Omp31 [Brucella suis ATCC 23445]
 gi|163675314|gb|ABY39424.1| Hypothetical protein, conserved [Brucella suis ATCC 23445]
          Length = 240

 Score =  114 bits (286), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 50/248 (20%), Positives = 83/248 (33%), Gaps = 59/248 (23%)

Query: 7   AVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNG 66
           +V ++S+A     SA AAD V           PT A          + G Y G++A Y G
Sbjct: 3   SVILASIAAMFATSAMAADVVVSEPSA-----PTAAPVD----TFSWTGGYIGINAGYAG 53

Query: 67  SFG-------------------EEAHHNAGGSIFAGYNVE-DSCIMYGVEGDVRYT---- 102
                                 +       G + AGYN + D+ ++ G E D + +    
Sbjct: 54  GKFKHPFSSFDKEDIEQVSGSLDVTAGGFVGGVQAGYNWQLDNGVVLGAETDFQGSSVTG 113

Query: 103 -----VPVLADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEI--- 154
                   L     +     G++R R GY  ++ L++Y T G    +       G+    
Sbjct: 114 SISAGASGLEGKAETKVEWFGTVRARLGYTATERLMVYGTGGLAYGKVKSAFNLGDDASA 173

Query: 155 -----TPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFY------------NTI 197
                     G T G G E   ++ +   + EY  +   K                 +T+
Sbjct: 174 LHTWPDKTKAGWTLGAGAEY-AINNNWTLKSEYLYTDLGKRNLVDVDNSFLESKVNFHTV 232

Query: 198 SLGVGMKF 205
            +G+  KF
Sbjct: 233 RVGLNYKF 240


>gi|161620493|ref|YP_001594379.1| porin [Brucella canis ATCC 23365]
 gi|16611681|gb|AAL27296.1|AF366073_1 outer membrane protein Omp31 [Brucella canis]
 gi|161337304|gb|ABX63608.1| porin [Brucella canis ATCC 23365]
          Length = 240

 Score =  114 bits (285), Expect = 9e-24,   Method: Composition-based stats.
 Identities = 50/248 (20%), Positives = 84/248 (33%), Gaps = 59/248 (23%)

Query: 7   AVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNG 66
           +V ++S+A     SA AAD V           P+  T   V     + G Y G++A Y G
Sbjct: 3   SVILASIAAMFATSAMAADVVVSE--------PSAPTAAPVDT-FSWTGGYIGINAGYAG 53

Query: 67  SFG-------------------EEAHHNAGGSIFAGYNVE-DSCIMYGVEGDVRYT---- 102
                                 +       G + AGYN + D+ ++ G E D + +    
Sbjct: 54  GKFKHPFSSFDKEDNEQVSGSLDVTAGGFVGGVQAGYNWQLDNGVVLGAETDFQGSSVTG 113

Query: 103 -----VPVLADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEI--- 154
                   L     +     G++R R GY  ++ L++Y T G    +       G+    
Sbjct: 114 PISAGASGLEGKAETKVEWFGTVRARLGYTATERLMVYGTGGLAYGKVKSAFNLGDDASA 173

Query: 155 -----TPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFY------------NTI 197
                     G T G G E   ++ +   + EY  +   K                 +T+
Sbjct: 174 LHTWSDKTKAGWTLGAGAEY-AINNNWTLKSEYLYTDLGKRNLVDVDNSFLESKVNFHTV 232

Query: 198 SLGVGMKF 205
            +G+  KF
Sbjct: 233 RVGLNYKF 240


>gi|256111680|ref|ZP_05452664.1| outer membrane protein Omp31 precursor [Brucella melitensis bv. 3
           str. Ether]
 gi|265993151|ref|ZP_06105708.1| outer membrane protein Omp31 [Brucella melitensis bv. 3 str. Ether]
 gi|16611648|gb|AAL27285.1|AF366062_1 outer membrane protein Omp31 [Brucella melitensis]
 gi|262764021|gb|EEZ10053.1| outer membrane protein Omp31 [Brucella melitensis bv. 3 str. Ether]
          Length = 240

 Score =  114 bits (285), Expect = 9e-24,   Method: Composition-based stats.
 Identities = 50/248 (20%), Positives = 84/248 (33%), Gaps = 59/248 (23%)

Query: 7   AVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNG 66
           +V ++S+A     SA AAD V           P+  T   V     + G Y G++A Y G
Sbjct: 3   SVILASIAAMFATSAMAADVVVSE--------PSAPTAAPVDT-FSWTGGYIGINAGYAG 53

Query: 67  SFG-------------------EEAHHNAGGSIFAGYNVE-DSCIMYGVEGDVRYT---- 102
                                 +       G + AGYN + D+ ++ G E D + +    
Sbjct: 54  GKFKHPFSSFDKEDNEQVSGSLDVTAGGFVGGVQAGYNWQLDNGVVLGAETDFQGSSVTG 113

Query: 103 -----VPVLADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEI--- 154
                   L     +     G++R R GY  ++ L++Y T G    +       G+    
Sbjct: 114 SISAGASGLEGKAETKVEWFGTVRARLGYTATERLMVYGTGGLAYGKVKSAFNLGDDASA 173

Query: 155 -----TPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFY------------NTI 197
                     G T G G E   ++ +   + EY  +   K                 +T+
Sbjct: 174 LHMWSDKTKAGWTLGAGAEY-AINNNWTLKSEYLYTDLGKRNLVDVDNSFLESKVNFHTV 232

Query: 198 SLGVGMKF 205
            +G+  KF
Sbjct: 233 RVGLNYKF 240


>gi|75676711|ref|YP_319132.1| putative outer-membrane immunogenic protein precursor [Nitrobacter
           winogradskyi Nb-255]
 gi|74421581|gb|ABA05780.1| putative outer-membrane immunogenic protein precursor [Nitrobacter
           winogradskyi Nb-255]
          Length = 206

 Score =  114 bits (285), Expect = 9e-24,   Method: Composition-based stats.
 Identities = 43/195 (22%), Positives = 79/195 (40%), Gaps = 16/195 (8%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M ++ +A   +  + A   +A AAD   RA +     +              + GPY G 
Sbjct: 1   MTRITIAALAAMASTALIGAAHAADFSYRAPYTVNQPL----------DAFSWAGPYLGG 50

Query: 61  SALYNGSFGEEA---HHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLA-DNIHSLHGI 116
           +  Y     + +        G + AG+N +   +++G+EGD++              +  
Sbjct: 51  NLGYAWGSVQNSLTRPDGVFGGVQAGFNWQSGPVVFGLEGDIQANAANDTFAAWKFSNPW 110

Query: 117 GGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESL 176
            G++R R GY   +++L+Y T G    +          +  + G T GVG EV G+ ++ 
Sbjct: 111 FGTVRGRIGYAF-NNVLVYGTGGLAFGKLRAETFGLSESHTSAGWTVGVGAEV-GIYQNW 168

Query: 177 VARLEYRASKYSKVE 191
            A++EY     S   
Sbjct: 169 TAKVEYLYVDLSSSS 183


>gi|254706065|ref|ZP_05167893.1| outer membrane protein Omp31 precursor [Brucella pinnipedialis
           M163/99/10]
 gi|261313502|ref|ZP_05952699.1| outer-membrane immunogenic protein [Brucella pinnipedialis
           M163/99/10]
 gi|261302528|gb|EEY06025.1| outer-membrane immunogenic protein [Brucella pinnipedialis
           M163/99/10]
          Length = 240

 Score =  113 bits (284), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 50/248 (20%), Positives = 84/248 (33%), Gaps = 59/248 (23%)

Query: 7   AVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNG 66
           +V ++S+A     SA AAD V           P+  T   V     + G Y G++A Y G
Sbjct: 3   SVILASIAAMFATSAMAADVVVSE--------PSAPTAAPVDT-FSWTGGYIGINAGYAG 53

Query: 67  SFG-------------------EEAHHNAGGSIFAGYNVE-DSCIMYGVEGDVRYT---- 102
                                 +       G + AGYN + D+ ++ G E D + +    
Sbjct: 54  GKFKHPFFSFDKEDNEQVSGSLDVTAGGFVGGVQAGYNWQLDNGVVLGAETDFQGSSVTG 113

Query: 103 -----VPVLADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEI--- 154
                   L     +     G++R R GY  ++ L++Y T G    +       G+    
Sbjct: 114 SISAGASGLEGKAETKVEWFGTVRARLGYTATERLMVYGTGGLAYGKVKSAFNLGDDASA 173

Query: 155 -----TPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFY------------NTI 197
                     G T G G E   ++ +   + EY  +   K                 +T+
Sbjct: 174 LHTWSDKTKAGWTLGAGAEY-AINNNWTLKSEYLYTDLGKRNLVDVDNSFLESKVNFHTV 232

Query: 198 SLGVGMKF 205
            +G+  KF
Sbjct: 233 RVGLNYKF 240


>gi|23500173|ref|NP_699613.1| outer membrane protein [Brucella suis 1330]
 gi|225628865|ref|ZP_03786899.1| Porin subfamily protein [Brucella ceti str. Cudo]
 gi|225686232|ref|YP_002734204.1| outer membrane protein Omp31 [Brucella melitensis ATCC 23457]
 gi|254699679|ref|ZP_05161507.1| outer membrane protein Omp31 precursor [Brucella suis bv. 5 str.
           513]
 gi|254702817|ref|ZP_05164645.1| outer membrane protein Omp31 precursor [Brucella suis bv. 3 str.
           686]
 gi|254711636|ref|ZP_05173447.1| outer membrane protein Omp31 precursor [Brucella pinnipedialis
           B2/94]
 gi|254712249|ref|ZP_05174060.1| outer membrane protein Omp31 precursor [Brucella ceti M644/93/1]
 gi|254715320|ref|ZP_05177131.1| outer membrane protein Omp31 precursor [Brucella ceti M13/05/1]
 gi|256015206|ref|YP_003105215.1| outer membrane protein, 31 kDa [Brucella microti CCM 4915]
 gi|256029730|ref|ZP_05443344.1| outer membrane protein Omp31 precursor [Brucella pinnipedialis
           M292/94/1]
 gi|256043319|ref|ZP_05446254.1| outer membrane protein Omp31 precursor [Brucella melitensis bv. 1
           str. Rev.1]
 gi|256059364|ref|ZP_05449566.1| outer membrane protein Omp31 precursor [Brucella neotomae 5K33]
 gi|256157882|ref|ZP_05455800.1| outer membrane protein Omp31 precursor [Brucella ceti M490/95/1]
 gi|256253156|ref|ZP_05458692.1| outer membrane protein Omp31 precursor [Brucella ceti B1/94]
 gi|256262636|ref|ZP_05465168.1| outer membrane protein Omp31 [Brucella melitensis bv. 2 str. 63/9]
 gi|260167181|ref|ZP_05753992.1| outer membrane protein, 31 kDa [Brucella sp. F5/99]
 gi|260564527|ref|ZP_05835012.1| outer membrane protein 31 [Brucella melitensis bv. 1 str. 16M]
 gi|261217050|ref|ZP_05931331.1| outer membrane immunogenic protein [Brucella ceti M13/05/1]
 gi|261220262|ref|ZP_05934543.1| outer-membrane immunogenic protein [Brucella ceti B1/94]
 gi|261319260|ref|ZP_05958457.1| outer-membrane immunogenic protein [Brucella pinnipedialis B2/94]
 gi|261319920|ref|ZP_05959117.1| outer-membrane immunogenic protein [Brucella ceti M644/93/1]
 gi|261323324|ref|ZP_05962521.1| outer-membrane immunogenic protein [Brucella neotomae 5K33]
 gi|261750144|ref|ZP_05993853.1| outer-membrane immunogenic protein [Brucella suis bv. 5 str. 513]
 gi|261753417|ref|ZP_05997126.1| outer-membrane immunogenic protein [Brucella suis bv. 3 str. 686]
 gi|261756585|ref|ZP_06000294.1| outer-membrane immunogenic protein [Brucella sp. F5/99]
 gi|265986741|ref|ZP_06099298.1| outer-membrane immunogenic protein [Brucella pinnipedialis
           M292/94/1]
 gi|265989742|ref|ZP_06102299.1| outer-membrane immunogenic protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|265996391|ref|ZP_06108948.1| outer-membrane immunogenic protein [Brucella ceti M490/95/1]
 gi|61229373|sp|P0A3U4|OM31_BRUME RecName: Full=31 kDa outer-membrane immunogenic protein; Flags:
           Precursor
 gi|61229374|sp|P0A3U5|OM31_BRUSU RecName: Full=31 kDa outer-membrane immunogenic protein; Flags:
           Precursor
 gi|16611645|gb|AAL27284.1|AF366061_1 outer membrane protein Omp31 [Brucella melitensis]
 gi|16611651|gb|AAL27286.1|AF366063_1 outer membrane protein Omp31 [Brucella suis 1330]
 gi|16611657|gb|AAL27288.1|AF366065_1 outer membrane protein Omp31 [Brucella suis]
 gi|16611663|gb|AAL27290.1|AF366067_1 outer membrane protein Omp31 [Brucella suis]
 gi|16611684|gb|AAL27297.1|AF366074_1 outer membrane protein Omp31 [Brucella neotomae]
 gi|1457933|gb|AAB36693.1| outer membrane protein [Brucella melitensis]
 gi|23463773|gb|AAN33618.1| outer membrane protein Omp31 [Brucella suis 1330]
 gi|46251186|gb|AAS84564.1| Omp31 [Brucella ceti]
 gi|46251188|gb|AAS84565.1| Omp31 [Brucella pinnipedialis]
 gi|46251190|gb|AAS84566.1| Omp31 [Brucella ceti]
 gi|46251192|gb|AAS84567.1| Omp31 [Brucella ceti]
 gi|157310315|emb|CAN43870.1| outer membrane protein 31 [Brucella microti CCM 4915]
 gi|157310317|emb|CAN43872.1| outer membrane protein 31 [Brucella microti]
 gi|225616711|gb|EEH13759.1| Porin subfamily protein [Brucella ceti str. Cudo]
 gi|225642337|gb|ACO02250.1| outer membrane protein Omp31 precursor [Brucella melitensis ATCC
           23457]
 gi|226433917|gb|ACO56077.1| Omp31 [Brucella melitensis]
 gi|240265888|gb|ACS50328.1| Omp31 [Brucella melitensis]
 gi|255997866|gb|ACU49553.1| outer membrane protein, 31 kDa [Brucella microti CCM 4915]
 gi|260152170|gb|EEW87263.1| outer membrane protein 31 [Brucella melitensis bv. 1 str. 16M]
 gi|260918846|gb|EEX85499.1| outer-membrane immunogenic protein [Brucella ceti B1/94]
 gi|260922139|gb|EEX88707.1| outer membrane immunogenic protein [Brucella ceti M13/05/1]
 gi|261292610|gb|EEX96106.1| outer-membrane immunogenic protein [Brucella ceti M644/93/1]
 gi|261298483|gb|EEY01980.1| outer-membrane immunogenic protein [Brucella pinnipedialis B2/94]
 gi|261299304|gb|EEY02801.1| outer-membrane immunogenic protein [Brucella neotomae 5K33]
 gi|261736569|gb|EEY24565.1| outer-membrane immunogenic protein [Brucella sp. F5/99]
 gi|261739897|gb|EEY27823.1| outer-membrane immunogenic protein [Brucella suis bv. 5 str. 513]
 gi|261743170|gb|EEY31096.1| outer-membrane immunogenic protein [Brucella suis bv. 3 str. 686]
 gi|262550688|gb|EEZ06849.1| outer-membrane immunogenic protein [Brucella ceti M490/95/1]
 gi|263000411|gb|EEZ13101.1| outer-membrane immunogenic protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|263092421|gb|EEZ16674.1| outer membrane protein Omp31 [Brucella melitensis bv. 2 str. 63/9]
 gi|264658938|gb|EEZ29199.1| outer-membrane immunogenic protein [Brucella pinnipedialis
           M292/94/1]
          Length = 240

 Score =  113 bits (284), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 50/248 (20%), Positives = 84/248 (33%), Gaps = 59/248 (23%)

Query: 7   AVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNG 66
           +V ++S+A     SA AAD V           P+  T   V     + G Y G++A Y G
Sbjct: 3   SVILASIAAMFATSAMAADVVVSE--------PSAPTAAPVDT-FSWTGGYIGINAGYAG 53

Query: 67  SFG-------------------EEAHHNAGGSIFAGYNVE-DSCIMYGVEGDVRYT---- 102
                                 +       G + AGYN + D+ ++ G E D + +    
Sbjct: 54  GKFKHPFSSFDKEDNEQVSGSLDVTAGGFVGGVQAGYNWQLDNGVVLGAETDFQGSSVTG 113

Query: 103 -----VPVLADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEI--- 154
                   L     +     G++R R GY  ++ L++Y T G    +       G+    
Sbjct: 114 SISAGASGLEGKAETKVEWFGTVRARLGYTATERLMVYGTGGLAYGKVKSAFNLGDDASA 173

Query: 155 -----TPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFY------------NTI 197
                     G T G G E   ++ +   + EY  +   K                 +T+
Sbjct: 174 LHTWSDKTKAGWTLGAGAEY-AINNNWTLKSEYLYTDLGKRNLVDVDNSFLESKVNFHTV 232

Query: 198 SLGVGMKF 205
            +G+  KF
Sbjct: 233 RVGLNYKF 240


>gi|260568272|ref|ZP_05838741.1| outer membrane protein Omp31 [Brucella suis bv. 4 str. 40]
 gi|16611660|gb|AAL27289.1|AF366066_1 outer membrane protein Omp31 [Brucella suis]
 gi|260154937|gb|EEW90018.1| outer membrane protein Omp31 [Brucella suis bv. 4 str. 40]
          Length = 240

 Score =  113 bits (283), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 50/248 (20%), Positives = 83/248 (33%), Gaps = 59/248 (23%)

Query: 7   AVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNG 66
           +V ++S+A     SA AAD V           PT A          + G Y G++A Y G
Sbjct: 3   SVILASIAAMFATSAMAADVVVSEPSA-----PTAAPVD----TFSWTGGYIGINAGYAG 53

Query: 67  SFG-------------------EEAHHNAGGSIFAGYNVE-DSCIMYGVEGDVRYT---- 102
                                 +       G + AGYN + D+ ++ G E D + +    
Sbjct: 54  GKFKHPFSSFDKEDNEQVSGSLDATAGGFVGGVQAGYNWQLDNGVVLGAETDFQGSSVTG 113

Query: 103 -----VPVLADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEI--- 154
                   L     +     G++R R GY  ++ L++Y T G    +       G+    
Sbjct: 114 SISAGASGLEGKAETKVEWFGTVRARLGYTATERLMVYGTGGLAYGKVKSAFNLGDDASA 173

Query: 155 -----TPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFY------------NTI 197
                     G T G G E   ++ +   + EY  +   K                 +T+
Sbjct: 174 LHTWSDKTKAGWTLGAGAEY-AINNNWTLKSEYLYTDLGKRNLVDVDNSFLESKVNFHTV 232

Query: 198 SLGVGMKF 205
            +G+  KF
Sbjct: 233 RVGLNYKF 240


>gi|256682107|gb|ACV07678.1| OMP31 [Brucella melitensis]
          Length = 240

 Score =  113 bits (282), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 49/248 (19%), Positives = 83/248 (33%), Gaps = 59/248 (23%)

Query: 7   AVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNG 66
           +V ++S+A     SA AAD V           PT A          + G Y G++A Y G
Sbjct: 3   SVILASIAAMFATSAMAADVVVSEPSA-----PTAAPVD----TFSWTGGYIGINAGYAG 53

Query: 67  SFG-------------------EEAHHNAGGSIFAGYNVE-DSCIMYGVEGDVRYT---- 102
                                 +       G + AGYN + D+ ++ G E D + +    
Sbjct: 54  GKFKHPFSSFDKEDNEQVSGSLDVTAGGFVGGVQAGYNWQLDNGVVLGAETDFQGSSVTG 113

Query: 103 -----VPVLADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEI--- 154
                   L     +     G++R R GY  ++ +++Y T G    +       G+    
Sbjct: 114 SISAGASGLEGKAETKVEWFGTVRARLGYTATERVMVYGTGGLAYGKVKSAFNLGDDASA 173

Query: 155 -----TPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFY------------NTI 197
                     G T G G E   ++ +   + EY  +   K                 +T+
Sbjct: 174 LHTWSDKTKAGWTLGAGAEY-AINNNWTLKSEYLYTDLGKRNLVDVDNSFLESKVNFHTV 232

Query: 198 SLGVGMKF 205
            +G+  KF
Sbjct: 233 RVGLNYKF 240


>gi|92118614|ref|YP_578343.1| putative outer-membrane immunogenic protein precursor [Nitrobacter
           hamburgensis X14]
 gi|91801508|gb|ABE63883.1| putative outer-membrane immunogenic protein precursor [Nitrobacter
           hamburgensis X14]
          Length = 206

 Score =  113 bits (282), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 43/179 (24%), Positives = 75/179 (41%), Gaps = 22/179 (12%)

Query: 20  SAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSFGEEAH---HNA 76
           +AQAAD   R+ +     +            + + GPY G +  Y     + +    +  
Sbjct: 20  TAQAADFSYRSPYTVNQPL----------NAYSWAGPYLGGNLGYAWGSVQNSATKPNGV 69

Query: 77  GGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIG----GSLRIRGGYEVSDSL 132
            G + AGYN +   +++G+EGD++      AD+I +         G++R R GY   +++
Sbjct: 70  FGGVQAGYNWQSGPLVFGLEGDIQAN---AADDIFARWKFSNPWFGTVRGRLGYAF-NNV 125

Query: 133 LLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVE 191
           L+Y T G               +    G T GVG E  G+ ++  A++EY     S   
Sbjct: 126 LIYGTGGLAFGALRAETFGLSESHTNAGWTVGVGAEF-GIYQNWTAKVEYLYVDLSSSN 183


>gi|306845687|ref|ZP_07478256.1| outer membrane protein Omp31 [Brucella sp. BO1]
 gi|206596728|emb|CAQ68394.1| outer membrane protein 31 [Brucella sp. BO1]
 gi|306274008|gb|EFM55835.1| outer membrane protein Omp31 [Brucella sp. BO1]
          Length = 240

 Score =  113 bits (282), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 49/248 (19%), Positives = 79/248 (31%), Gaps = 59/248 (23%)

Query: 7   AVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNG 66
           +V ++S+A     SA AAD V           PT A          + G Y G++A Y G
Sbjct: 3   SVILASIAAMFATSAMAADVVVSEPSA-----PTAAPVD----TFSWTGGYIGINAGYAG 53

Query: 67  SFG-------------------EEAHHNAGGSIFAGYNVEDSC-IMYGVEGDVRYT---- 102
                                         G + AGYN +    ++ G E D + +    
Sbjct: 54  GKFKHPFSAFDTDDNERVSGSLNITSGGFVGGVQAGYNWQFDNGVVLGAETDFQGSSVTG 113

Query: 103 -----VPVLADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEI--- 154
                   L     +     G++R R GY  ++ L++Y T G    +       G+    
Sbjct: 114 SISADAGGLEGKAETKVEWFGTVRARLGYTATERLMVYGTGGLAYGKVKSAFNLGDDVSA 173

Query: 155 -----TPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFY------------NTI 197
                     G T G G E   ++     + EY  +   K                 +T+
Sbjct: 174 LHTWSDKTKAGWTLGAGAEY-AINNHWTLKSEYLYTDLGKRNLINVDDSFLESKVNFHTV 232

Query: 198 SLGVGMKF 205
            +G+  KF
Sbjct: 233 RVGLNYKF 240


>gi|298292421|ref|YP_003694360.1| porin [Starkeya novella DSM 506]
 gi|296928932|gb|ADH89741.1| porin [Starkeya novella DSM 506]
          Length = 215

 Score =  112 bits (281), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 39/185 (21%), Positives = 59/185 (31%), Gaps = 22/185 (11%)

Query: 41  IATNRYVPIRHDFNGPYAGLSALYNGSFGEEAH-------HNAGGSIFAGYNVE-DSCIM 92
                       + G Y G +A Y    G+E             G    G+N + D+ ++
Sbjct: 33  APPAVIAEPVFSWTGFYLGANAGYAWGSGQEGAETLGLDPDGFLGGGQIGFNYQFDNNVV 92

Query: 93  YGVEGDVRYTVPVLAD-NIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGK- 150
            G E D + +          S     G++R R GY   + +L Y T G          K 
Sbjct: 93  LGAEADFQGSDIKDERLGFESKMDYFGTVRARLGYAFGN-VLPYVTGGLAWGHTEVNDKL 151

Query: 151 -AGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYS---------KVEGFYNTISLG 200
                   A+G T G GVE    + +   + EY               K     N +  G
Sbjct: 152 LGLTSDKTAVGWTVGGGVEY-AFTNNWTVKAEYLYMDLGDDYYASIGDKSGLTANVVRAG 210

Query: 201 VGMKF 205
           +  KF
Sbjct: 211 INYKF 215


>gi|27382580|ref|NP_774109.1| outer-membrane immunogenic protein [Bradyrhizobium japonicum USDA
           110]
 gi|27355752|dbj|BAC52734.1| bll7469 [Bradyrhizobium japonicum USDA 110]
          Length = 208

 Score =  111 bits (278), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 49/179 (27%), Positives = 71/179 (39%), Gaps = 20/179 (11%)

Query: 19  CSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSFGEE---AHHN 75
            SA+AAD             P  A        + + GPY G +  Y     +        
Sbjct: 19  ASAEAADLSYGQRAPYTVNQPLNA--------YSWAGPYLGGNIGYEWGSVDNNPSKPSG 70

Query: 76  AGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIG----GSLRIRGGYEVSDS 131
             G I AGYN ++   ++GVEGD++      AD+  +         G+LR R GY  S+ 
Sbjct: 71  FVGGIQAGYNFQNGPWVFGVEGDIQ---AAGADDTFAPWKFSNPWFGTLRGRVGYAFSN- 126

Query: 132 LLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKV 190
           +L Y T G    +          +  + G T G G EV GL+ +  A+LEY     S  
Sbjct: 127 VLFYGTAGLAFGELRAQTFGWTESHTSAGWTIGAGAEV-GLAPNWSAKLEYLYIDLSTS 184


>gi|148253259|ref|YP_001237844.1| putative outer membrane protein [Bradyrhizobium sp. BTAi1]
 gi|146405432|gb|ABQ33938.1| putative outer membrane protein precursor [Bradyrhizobium sp.
           BTAi1]
          Length = 206

 Score =  111 bits (278), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 50/202 (24%), Positives = 77/202 (38%), Gaps = 18/202 (8%)

Query: 8   VGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGS 67
           VG +  A     SAQAAD      + GR    T+         + + GPY G +  Y   
Sbjct: 6   VGAAVAAALGSVSAQAAD-----FNYGRQAPYTVNQPLN---AYSWAGPYLGGTLGYEWG 57

Query: 68  F---GEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNI-HSLHGIGGSLRIR 123
                        G + AGYN ++   ++G EGD+  T            +   G++R R
Sbjct: 58  SVGNNPTKPSGLVGGLTAGYNWQNGPWVFGAEGDINLTGANDTFAPWKFSNPWFGTVRGR 117

Query: 124 GGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYR 183
            GY   +++L Y T G               +  ++G T G G E  GL+++  A++EY 
Sbjct: 118 AGYAF-NNILFYGTGGLAFGGLRGETFGLSESHTSLGWTLGAGAEF-GLAQNWTAKIEYL 175

Query: 184 ASKYSK----VEGFYNTISLGV 201
                     + G  N    GV
Sbjct: 176 YIDLDSSNFVITGAKNDYRFGV 197


>gi|299134246|ref|ZP_07027439.1| outer membrane protein Omp31 [Afipia sp. 1NLS2]
 gi|298590993|gb|EFI51195.1| outer membrane protein Omp31 [Afipia sp. 1NLS2]
          Length = 209

 Score =  111 bits (277), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 42/174 (24%), Positives = 69/174 (39%), Gaps = 25/174 (14%)

Query: 51  HDFNGPYAGLSALYNGSFGEEAHHN-----AGGSIFAGYNVEDSC-IMYGVEGDVRYTVP 104
           + + GPY G +  YN  FG+ ++         G I  GYN +     + G+E D++ T  
Sbjct: 42  YSWAGPYLGANLGYN--FGDVSNSGTSPSGFSGGIQGGYNWQFGTPWVLGLEADLQATG- 98

Query: 105 VLADNIHSLHGIG----GSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIG 160
             AD+  +         G++R R GY ++ + ++Y T G    Q   T      T    G
Sbjct: 99  --ADDTFAAWKFSNPWYGTIRGRVGYAINPNFMIYGTGGLAFGQLKGTMPGLSETHTTAG 156

Query: 161 GTAGVGVEVGGLSESLVARLEYRASKYSKVEGF---------YNTISLGVGMKF 205
            T G G E   L+ +   + EY                    ++T+ +GV   F
Sbjct: 157 WTVGGGAEF-ALTNNWSLKAEYMYVDLDSSNFLITGLPNGYQFSTVRVGVNYHF 209


>gi|13471424|ref|NP_102990.1| outer membrane protein [Mesorhizobium loti MAFF303099]
 gi|14022166|dbj|BAB48776.1| outer membrane protein [Mesorhizobium loti MAFF303099]
          Length = 225

 Score =  111 bits (277), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 48/231 (20%), Positives = 78/231 (33%), Gaps = 55/231 (23%)

Query: 13  LALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGS----- 67
            A     +A AAD                     V   +++ G Y G       S     
Sbjct: 12  FAALMAGTALAADATVELP---------------VASSYNWTGGYIGAQIGGGWSKVDQP 56

Query: 68  ----------FGEEAHHNAG--GSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHS--- 112
                     F ++    +G  G + AGYN +    ++G E D+  T     D       
Sbjct: 57  WGFTEASPNIFDQDNADGSGVVGGLHAGYNWQSGSFVFGGEADINATGIDGDDGGSGGDI 116

Query: 113 ---LHGIGGSLRIRGGYEVSDSLLLYATVGPD----VAQKYETGKAGEITPIAIGGTAGV 165
                    S+R R G+   D +L+Y T G       A   + G+    +    G T G 
Sbjct: 117 NGFKARWVASVRARAGFAF-DRVLIYGTGGYAYLNGKADTRDVGRQESHSASFNGWTIGA 175

Query: 166 GVEVGGLSESLVARLEYRASKYS-----------KVEGFYNTISLGVGMKF 205
           G E   L++++  R EYR + +             +    +T+++GV  KF
Sbjct: 176 GAEY-ALTDNITVRGEYRYADFGSKTVVFNNYVEDISPALHTVTIGVSYKF 225


>gi|39934247|ref|NP_946523.1| outer membrane protein [Rhodopseudomonas palustris CGA009]
 gi|39648095|emb|CAE26615.1| possible outer membrane protein [Rhodopseudomonas palustris CGA009]
          Length = 226

 Score =  110 bits (276), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 47/199 (23%), Positives = 82/199 (41%), Gaps = 19/199 (9%)

Query: 2   QKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLS 61
           +   + +  +++  AS  +AQAAD      +    V   +           + GPY G +
Sbjct: 19  KMRKVTLAAAAVIAASVSTAQAADMGYYRSNAPYTVNQPLN-------AFSWAGPYLGGN 71

Query: 62  ALYNG---SFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIG- 117
             Y+    +          G +  GYN +   I++G+EGD++++    AD+  + +    
Sbjct: 72  LGYSWGNVTNNITKPSGFSGGVQGGYNWQSGNIVFGLEGDIQFS---TADDTFAQYKFSN 128

Query: 118 ---GSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSE 174
              G+ R R GY ++D +L+YAT G    Q          +  + G T G G E    + 
Sbjct: 129 PWFGTGRGRIGYAMND-VLIYATGGLAFGQLKGQNVFASESHSSAGWTVGAGAEF-AFAP 186

Query: 175 SLVARLEYRASKYSKVEGF 193
            L A++EY     S    F
Sbjct: 187 KLSAKVEYLYMSLSTSNFF 205


>gi|254720536|ref|ZP_05182347.1| outer membrane protein Omp31 precursor [Brucella sp. 83/13]
 gi|265985569|ref|ZP_06098304.1| outer-membrane immunogenic protein [Brucella sp. 83/13]
 gi|306838097|ref|ZP_07470954.1| outer membrane protein Omp31 [Brucella sp. NF 2653]
 gi|264664161|gb|EEZ34422.1| outer-membrane immunogenic protein [Brucella sp. 83/13]
 gi|306406834|gb|EFM63056.1| outer membrane protein Omp31 [Brucella sp. NF 2653]
          Length = 240

 Score =  110 bits (276), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 50/248 (20%), Positives = 82/248 (33%), Gaps = 59/248 (23%)

Query: 7   AVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNG 66
           +V ++S+A     SA AAD V           PT A          + G Y G++A Y G
Sbjct: 3   SVILASIAAMFATSAMAADVVVSEPSA-----PTAAPVD----TFSWTGGYIGINAGYAG 53

Query: 67  SFG-------------------EEAHHNAGGSIFAGYNVE-DSCIMYGVEGDVRYT---- 102
                                 +       G + AGYN + D+  + G E D + +    
Sbjct: 54  GKFKHPFSTFDTEDNEQVSGSLDVTAGGFVGGVQAGYNWQLDNGGVLGAETDFQGSSVTG 113

Query: 103 -----VPVLADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEI--- 154
                   L     +     G++R R GY  ++ L++Y T G    +       G+    
Sbjct: 114 SISAGASGLEGKAETKVEWFGTVRARLGYTATERLMVYGTGGLAYGKVKSAFNLGDDASA 173

Query: 155 -----TPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFY------------NTI 197
                     G T G G E   ++ +   + EY  +   K                 +T+
Sbjct: 174 LHTWSDKTKAGWTLGAGAEY-AINNNWTLKSEYLYTDLGKRNLVDVDNSFLESKVNFHTV 232

Query: 198 SLGVGMKF 205
            +G+  KF
Sbjct: 233 RIGLNYKF 240


>gi|86748303|ref|YP_484799.1| outer membrane protein [Rhodopseudomonas palustris HaA2]
 gi|86571331|gb|ABD05888.1| outer membrane protein [Rhodopseudomonas palustris HaA2]
          Length = 207

 Score =  110 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 51/195 (26%), Positives = 80/195 (41%), Gaps = 19/195 (9%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+KL +A      A     +AQAAD      + G     T+           + GPY G 
Sbjct: 1   MRKLAMAAATVIAATG--STAQAAD----MGYYGSRTPYTVNQPLN---AFSWAGPYLGG 51

Query: 61  SALYNGSFGEEAHH-----NAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHG 115
           +  Y  +FG   ++        G +  GYN +   I++G+EGD++++        +    
Sbjct: 52  NLGY--AFGNVTNNITKPSGFSGGVQGGYNWQSGNIVFGLEGDIQFSTANDTFASYKFSN 109

Query: 116 -IGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSE 174
              G+ R R GY ++D +LLYAT G    Q          +  + G T G G E    + 
Sbjct: 110 PWFGTARGRVGYAMND-ILLYATGGLAFGQLKGEYLLSSESHTSAGWTVGAGAEF-AFAP 167

Query: 175 SLVARLEYRASKYSK 189
            L A++EY     S 
Sbjct: 168 KLSAKVEYLYGSLST 182


>gi|209886326|ref|YP_002290183.1| outer membrane protein Omp31 [Oligotropha carboxidovorans OM5]
 gi|209874522|gb|ACI94318.1| outer membrane protein Omp31 [Oligotropha carboxidovorans OM5]
          Length = 208

 Score =  109 bits (273), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 41/170 (24%), Positives = 70/170 (41%), Gaps = 19/170 (11%)

Query: 51  HDFNGPYAGLSALYNGSFGEEAHHN---AGGSIFAGYNVEDSC-IMYGVEGDVRYTVPVL 106
             + GPY G +  YN      +  N     G +  GYN +     ++G+E D++ T    
Sbjct: 43  FSWAGPYLGANLGYNWGSVSNSGTNPTGFAGGVQGGYNWQFGSPWVFGLEADIQATG--- 99

Query: 107 ADNIHSLHGIG----GSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGT 162
           AD+  +         G++R R GY ++ + +LY T G    +   +      + ++ G T
Sbjct: 100 ADDTFAAWKFSNPWYGTVRGRVGYALNPNFMLYGTGGLAFGELKGSTPFYSASHVSAGWT 159

Query: 163 AGVGVEVGGLSESLVARLEYRASKY--SKVEGFYN-----TISLGVGMKF 205
            G G E   L+ +   + EY       S + G  N     T+ +GV   F
Sbjct: 160 VGAGAEF-ALNNAWSLKAEYLYVDLDSSNINGLPNGYNFSTVRVGVNYHF 208


>gi|192289773|ref|YP_001990378.1| outer-membrane immunogenic protein precursor [Rhodopseudomonas
           palustris TIE-1]
 gi|192283522|gb|ACE99902.1| putative outer-membrane immunogenic protein precursor
           [Rhodopseudomonas palustris TIE-1]
          Length = 207

 Score =  109 bits (272), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 47/196 (23%), Positives = 81/196 (41%), Gaps = 19/196 (9%)

Query: 5   FLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALY 64
            + +  +++  AS  +AQAAD      +    V   +           + GPY G +  Y
Sbjct: 3   KVTLAAAAVIAASVSTAQAADMGYYRSNAPYTVNQPLN-------AFSWAGPYLGGNLGY 55

Query: 65  NG---SFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIG---- 117
           +    +          G +  GYN +   I++G+EGD++++    AD+  + +       
Sbjct: 56  SWGNVTNNITKPSGFSGGVQGGYNWQSGNIVFGLEGDIQFS---TADDTFAQYKFSNPWF 112

Query: 118 GSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLV 177
           G+ R R GY ++D +L+YAT G    Q          +  + G T G G E    +  L 
Sbjct: 113 GTGRGRIGYAMND-VLIYATGGLAFGQLKGQNVFASESHSSAGWTVGAGAEF-AFAPKLS 170

Query: 178 ARLEYRASKYSKVEGF 193
           A++EY     S    F
Sbjct: 171 AKVEYLYMSLSTSNFF 186


>gi|316932716|ref|YP_004107698.1| putative outer-membrane immunogenic protein [Rhodopseudomonas
           palustris DX-1]
 gi|315600430|gb|ADU42965.1| putative outer-membrane immunogenic protein precursor
           [Rhodopseudomonas palustris DX-1]
          Length = 207

 Score =  109 bits (272), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 47/194 (24%), Positives = 82/194 (42%), Gaps = 23/194 (11%)

Query: 5   FLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALY 64
            + +  +++  A   +AQAAD      +    V   +           + GPY G +  Y
Sbjct: 3   KVTLAAAAMIAAGMSTAQAADMGYYRSNAPYTVNQPLN-------AFSWAGPYLGGNLGY 55

Query: 65  NGSFGEEAHH-----NAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIG-- 117
              +G   ++        G +  GYN +   I++G+EGD++++    AD+  + +     
Sbjct: 56  --GWGNVTNNITKPSGFSGGLQGGYNWQSGNIVFGLEGDIQFS---TADDTFAPYKFSNP 110

Query: 118 --GSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSES 175
             G+ R R GY ++D +L+YAT G    Q      A   +  + G T G G E    +  
Sbjct: 111 WFGTGRGRIGYAMND-VLIYATGGLAFGQLKGQNLAVSESHSSAGWTVGAGAEF-AFAPK 168

Query: 176 LVARLEYRASKYSK 189
           L A++EY     S 
Sbjct: 169 LSAKVEYLYMSLST 182


>gi|217977074|ref|YP_002361221.1| porin [Methylocella silvestris BL2]
 gi|217502450|gb|ACK49859.1| porin [Methylocella silvestris BL2]
          Length = 254

 Score =  109 bits (272), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 56/251 (22%), Positives = 84/251 (33%), Gaps = 59/251 (23%)

Query: 3   KLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSA 62
            L   +  S  A+A   +A AAD   RA          I           + G Y G   
Sbjct: 2   MLRRLLLASVGAVALAGTAFAADLPSRAPPPVYVPPAPI---------FTWTGVYIGGQI 52

Query: 63  LYN-------------GSFGEEAHHNAG--GSIFAGYNVEDSCIMYGVEGDVRYTVPVLA 107
            Y              G+ G  ++  +G  G    GYN++ S  + G+EG V  +    +
Sbjct: 53  GYAWGTQNANFGDSFIGTLGSVSYDTSGVLGGAHVGYNLQLSQFVVGLEGSVDGSSMSKS 112

Query: 108 D----------NIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKA----GE 153
                       + +   I GS+R R GY   D +LLYAT G   A              
Sbjct: 113 AFLTDEFGNSLTLSAQSNIQGSIRGRVGYAW-DRVLLYATGGVAFAGVKANFYGPFSYDS 171

Query: 154 ITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGF-------------------Y 194
            +   +G T G G+E   ++ +   R EYR S +     +                    
Sbjct: 172 ASSTRVGWTVGGGLEY-AVTNNWSVRAEYRYSDFGHSTFYPSNYGSVVLTSPFINRHFKE 230

Query: 195 NTISLGVGMKF 205
           N + +G   KF
Sbjct: 231 NQVQVGFSYKF 241


>gi|229620416|gb|ACQ84164.1| Omp31 [Brucella melitensis]
          Length = 240

 Score =  109 bits (272), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 49/248 (19%), Positives = 82/248 (33%), Gaps = 59/248 (23%)

Query: 7   AVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNG 66
           +V ++S+A     SA AAD V           PT A          + G Y G++A Y G
Sbjct: 3   SVILASIAAMFATSAMAADVVVSEPSA-----PTAAPVD----TFSWTGGYIGINAGYAG 53

Query: 67  SFG-------------------EEAHHNAGGSIFAGYNVE-DSCIMYGVEGDVRYT---- 102
                                 +       G + AGYN + D+ ++ G   D + +    
Sbjct: 54  GKFKHPFSSFDKEDNEQVSGSLDVTAGGFVGGVQAGYNWQLDNGVVLGAGTDFQGSSVTG 113

Query: 103 -----VPVLADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEI--- 154
                   L     +     G++R R GY  ++ L++Y T G    +       G+    
Sbjct: 114 SISAGASGLEGKAETKVEWFGTVRARLGYTATERLMVYGTGGLAYGKVKSAFNLGDDASA 173

Query: 155 -----TPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFY------------NTI 197
                     G T G G E   ++ +   + EY  +   K                 +T+
Sbjct: 174 LHTWSDKTKAGWTLGAGAEY-AINNNWTLKSEYLYTDLGKRNLVDVDNSFLESKVNFHTV 232

Query: 198 SLGVGMKF 205
            +G+  KF
Sbjct: 233 RVGLNYKF 240


>gi|265984654|ref|ZP_06097389.1| outer membrane protein 31b [Brucella sp. 83/13]
 gi|264663246|gb|EEZ33507.1| outer membrane protein 31b [Brucella sp. 83/13]
          Length = 261

 Score =  108 bits (271), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 45/268 (16%), Positives = 84/268 (31%), Gaps = 78/268 (29%)

Query: 3   KLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSA 62
            +     ++S+A+    SA AAD +                         + G Y G++A
Sbjct: 7   TVMKTALLASVAMLFTSSAMAADIIVAE---------PAPVAVDT---FSWTGGYIGINA 54

Query: 63  LYNGSFG-------------------EEAHHNAGGSIFAGYNVEDSC-IMYGVEGDVRYT 102
            Y G                      +       G + AGYN + +  I+ G E D + +
Sbjct: 55  GYAGGKFKHPFSDVEPDRGEDFSGSLDVTASGFVGGVQAGYNWQLANGIVLGGEADFQGS 114

Query: 103 VPVL---------------------ADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPD 141
                                    +  + +     G++R R G+  ++ L++Y T G  
Sbjct: 115 TVKSKLVDNGDLSDVGVAGNLSGDESFGLETKVQWFGTVRARLGFTPTERLMVYGTGGLA 174

Query: 142 VAQKYETGKAGEI--------TPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGF 193
             +   +  A +         +    G T G GVE   ++ +   + EY  +   K    
Sbjct: 175 YGKVKTSLSAYDDGESFSAGNSKTKAGWTLGAGVEY-AVTNNWTLKSEYLYTDLGKRSFN 233

Query: 194 Y----------------NTISLGVGMKF 205
           Y                +T+ +G+  KF
Sbjct: 234 YIDEENVNVNMENKVNFHTVRIGLNYKF 261


>gi|261218682|ref|ZP_05932963.1| outer membrane protein 25b [Brucella ceti M13/05/1]
 gi|261321820|ref|ZP_05961017.1| outer membrane protein 25b [Brucella ceti M644/93/1]
 gi|260923771|gb|EEX90339.1| outer membrane protein 25b [Brucella ceti M13/05/1]
 gi|261294510|gb|EEX98006.1| outer membrane protein 25b [Brucella ceti M644/93/1]
          Length = 229

 Score =  108 bits (270), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 35/167 (20%), Positives = 57/167 (34%), Gaps = 37/167 (22%)

Query: 74  HNAGGSIFAGYNVEDSC-IMYGVEGDVRYTVPVLA-----------DNIHSLHGIGGSLR 121
               G ++AGYN +     + GV+GD+ Y     +             + S     G++R
Sbjct: 65  DGFLGGLYAGYNFDMGNNFVLGVDGDITYNDLDASHSDTDPDLDLTTGVDSKLRWSGAVR 124

Query: 122 IRGGYEVSDSLLLYATVGPDVAQKY--------ETGKAGEITPIAIGGTAGVGVEVGGLS 173
            R G  + D  + Y   G                       +    G  AG GV+    +
Sbjct: 125 ARMGVAM-DRWMPYIAGGVAFGNVKNSVSLTDGIESIGVSQSKTMTGWAAGAGVDYAA-T 182

Query: 174 ESLVARLEYRASKYSKVE---------------GFYNTISLGVGMKF 205
           ++++ RLEYR + Y   +                  + I LGV  KF
Sbjct: 183 DNVIVRLEYRYTDYGHKDFSVVDGDLSVEARNKFKTHDIRLGVAYKF 229


>gi|332717300|ref|YP_004444766.1| 25 kDa outer-membrane immunogenic protein [Agrobacterium sp. H13-3]
 gi|325063985|gb|ADY67675.1| 25 kDa outer-membrane immunogenic protein [Agrobacterium sp. H13-3]
          Length = 219

 Score =  108 bits (270), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 41/184 (22%), Positives = 69/184 (37%), Gaps = 31/184 (16%)

Query: 51  HDFNGPYAGLSALYNGSFGEEA-----------HHNAGGSIFAGYNVEDSC-IMYGVEGD 98
             + G  AG+ A Y  +  + +              A    F G+N +     + G+E D
Sbjct: 38  FSWTGFTAGVQAGYGWNNNDASIVGLPGQTSADFDGALAGGFVGFNYDLGNSWVVGLEAD 97

Query: 99  VRYTV-----PVLADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKY-ETGKAG 152
                      +L           GS+R R GY   D  L+Y T G   A+ Y E     
Sbjct: 98  FEKNWGDDSATILGTGFDYGFDWQGSVRGRVGYAF-DRALVYGTAGWAYARGYAEVPGIA 156

Query: 153 EITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKV-----------EGFYNTISLGV 201
           ++     G T GVG++    ++ +  R+EYR + +              +   + I +G+
Sbjct: 157 DVKETFNGYTVGVGLDY-AFTDMVFGRVEYRYTDFGDKDFDFGGAAINADVDQHAIRVGL 215

Query: 202 GMKF 205
           G+KF
Sbjct: 216 GVKF 219


>gi|23502485|ref|NP_698612.1| outer membrane protein Omp31 [Brucella suis 1330]
 gi|163843871|ref|YP_001628275.1| 22 kDa outer membrane protein precursor [Brucella suis ATCC 23445]
 gi|225628052|ref|ZP_03786088.1| Porin subfamily protein [Brucella ceti str. Cudo]
 gi|256370036|ref|YP_003107547.1| outer membrane protein Omp31 [Brucella microti CCM 4915]
 gi|260169279|ref|ZP_05756090.1| outer membrane protein Omp31 [Brucella sp. F5/99]
 gi|260565895|ref|ZP_05836365.1| outer membrane protein 31b [Brucella suis bv. 4 str. 40]
 gi|261219740|ref|ZP_05934021.1| outer membrane protein 31b [Brucella ceti M13/05/1]
 gi|261222753|ref|ZP_05937034.1| outer membrane protein 31b [Brucella ceti B1/94]
 gi|261315779|ref|ZP_05954976.1| outer membrane protein 31b [Brucella pinnipedialis M163/99/10]
 gi|261318224|ref|ZP_05957421.1| outer membrane protein 31b [Brucella pinnipedialis B2/94]
 gi|261322630|ref|ZP_05961827.1| outer membrane protein 31b [Brucella ceti M644/93/1]
 gi|261325677|ref|ZP_05964874.1| outer membrane protein 31b [Brucella neotomae 5K33]
 gi|261752901|ref|ZP_05996610.1| outer membrane protein 31b [Brucella suis bv. 5 str. 513]
 gi|261755562|ref|ZP_05999271.1| outer membrane protein 31b [Brucella suis bv. 3 str. 686]
 gi|261758791|ref|ZP_06002500.1| outer membrane protein 31b [Brucella sp. F5/99]
 gi|265989255|ref|ZP_06101812.1| outer membrane protein 31b [Brucella pinnipedialis M292/94/1]
 gi|265998716|ref|ZP_06111273.1| outer membrane protein 31b [Brucella ceti M490/95/1]
 gi|294852932|ref|ZP_06793605.1| outer-membrane immunogenic protein [Brucella sp. NVSL 07-0026]
 gi|23348478|gb|AAN30527.1| outer membrane protein Omp31 [Brucella suis 1330]
 gi|46251200|gb|AAS84571.1| Omp31b [Brucella neotomae]
 gi|46251202|gb|AAS84572.1| Omp31b [Brucella pinnipedialis]
 gi|46251204|gb|AAS84573.1| Omp31b [Brucella ceti]
 gi|46251206|gb|AAS84574.1| Omp31b [Brucella ceti]
 gi|46251208|gb|AAS84575.1| Omp31b [Brucella ceti]
 gi|157310319|emb|CAN43873.1| outer membrane protein 31b [Brucella microti CCM 4915]
 gi|157310321|emb|CAN43874.1| outer membrane protein 31b [Brucella microti]
 gi|163674594|gb|ABY38705.1| 22 kDa outer membrane protein precursor [Brucella suis ATCC 23445]
 gi|225617215|gb|EEH14261.1| Porin subfamily protein [Brucella ceti str. Cudo]
 gi|256000199|gb|ACU48598.1| outer membrane protein Omp31 [Brucella microti CCM 4915]
 gi|260155413|gb|EEW90493.1| outer membrane protein 31b [Brucella suis bv. 4 str. 40]
 gi|260921337|gb|EEX87990.1| outer membrane protein 31b [Brucella ceti B1/94]
 gi|260924829|gb|EEX91397.1| outer membrane protein 31b [Brucella ceti M13/05/1]
 gi|261295320|gb|EEX98816.1| outer membrane protein 31b [Brucella ceti M644/93/1]
 gi|261297447|gb|EEY00944.1| outer membrane protein 31b [Brucella pinnipedialis B2/94]
 gi|261301657|gb|EEY05154.1| outer membrane protein 31b [Brucella neotomae 5K33]
 gi|261304805|gb|EEY08302.1| outer membrane protein 31b [Brucella pinnipedialis M163/99/10]
 gi|261738775|gb|EEY26771.1| outer membrane protein 31b [Brucella sp. F5/99]
 gi|261742654|gb|EEY30580.1| outer membrane protein 31b [Brucella suis bv. 5 str. 513]
 gi|261745315|gb|EEY33241.1| outer membrane protein 31b [Brucella suis bv. 3 str. 686]
 gi|262553340|gb|EEZ09174.1| outer membrane protein 31b [Brucella ceti M490/95/1]
 gi|264661452|gb|EEZ31713.1| outer membrane protein 31b [Brucella pinnipedialis M292/94/1]
 gi|294821521|gb|EFG38520.1| outer-membrane immunogenic protein [Brucella sp. NVSL 07-0026]
          Length = 261

 Score =  107 bits (268), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 45/268 (16%), Positives = 84/268 (31%), Gaps = 78/268 (29%)

Query: 3   KLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSA 62
            +     ++S+A+    SA AAD +                         + G Y G++A
Sbjct: 7   TVMKTALLASVAMLFTSSAMAADIIVAE---------PAPVAVDT---FSWTGGYIGINA 54

Query: 63  LYNGSFG-------------------EEAHHNAGGSIFAGYNVEDSC-IMYGVEGDVRYT 102
            Y G                      +       G + AGYN + +  ++ G E D + +
Sbjct: 55  GYAGGKFKHPFSGIEQDGAQDFSGSLDVTASGFVGGVQAGYNWQLANGLVLGGEADFQGS 114

Query: 103 VPVL---------------------ADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPD 141
                                    +  + +     G++R R G+  ++ L++Y T G  
Sbjct: 115 TVKSKLVDNGDLSDIGVAGNLSGDESFGLETKVQWFGTVRARLGFTPTERLMVYGTGGLA 174

Query: 142 VAQKYETGKAGEI--------TPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGF 193
             +   +  A +         +    G T G GVE   ++ +   + EY  +   K    
Sbjct: 175 YGKVKTSLSAYDDGESFSAGNSKTKAGWTLGAGVEY-AVTNNWTLKSEYLYTDLGKRSFN 233

Query: 194 Y----------------NTISLGVGMKF 205
           Y                +T+ LG+  KF
Sbjct: 234 YIDEENVNINMENKVNFHTVRLGLNYKF 261


>gi|62290498|ref|YP_222291.1| Omp31-1, outer membrane protein, 31 kDa [Brucella abortus bv. 1
           str. 9-941]
 gi|82700421|ref|YP_414995.1| OmpA-like transmembrane domain-containing protein [Brucella
           melitensis biovar Abortus 2308]
 gi|237816005|ref|ZP_04595002.1| OmpA-like transmembrane domain protein [Brucella abortus str. 2308
           A]
 gi|260547029|ref|ZP_05822768.1| conserved hypothetical protein [Brucella abortus NCTC 8038]
 gi|260755331|ref|ZP_05867679.1| outer membrane protein 31b [Brucella abortus bv. 6 str. 870]
 gi|260758554|ref|ZP_05870902.1| outer membrane protein 31b [Brucella abortus bv. 4 str. 292]
 gi|260762376|ref|ZP_05874719.1| outer membrane protein 31b [Brucella abortus bv. 2 str. 86/8/59]
 gi|260884349|ref|ZP_05895963.1| Omp31b [Brucella abortus bv. 9 str. C68]
 gi|261214598|ref|ZP_05928879.1| outer membrane protein 31b [Brucella abortus bv. 3 str. Tulya]
 gi|297248879|ref|ZP_06932597.1| Omp31b [Brucella abortus bv. 5 str. B3196]
 gi|46251194|gb|AAS84568.1| Omp31b [Brucella abortus]
 gi|62196630|gb|AAX74930.1| Omp31-1, outer membrane protein, 31 kDa [Brucella abortus bv. 1
           str. 9-941]
 gi|82616522|emb|CAJ11595.1| OmpA-like transmembrane domain [Brucella melitensis biovar Abortus
           2308]
 gi|237789303|gb|EEP63514.1| OmpA-like transmembrane domain protein [Brucella abortus str. 2308
           A]
 gi|260096079|gb|EEW79956.1| conserved hypothetical protein [Brucella abortus NCTC 8038]
 gi|260668872|gb|EEX55812.1| outer membrane protein 31b [Brucella abortus bv. 4 str. 292]
 gi|260672808|gb|EEX59629.1| outer membrane protein 31b [Brucella abortus bv. 2 str. 86/8/59]
 gi|260675439|gb|EEX62260.1| outer membrane protein 31b [Brucella abortus bv. 6 str. 870]
 gi|260873877|gb|EEX80946.1| Omp31b [Brucella abortus bv. 9 str. C68]
 gi|260916205|gb|EEX83066.1| outer membrane protein 31b [Brucella abortus bv. 3 str. Tulya]
 gi|297176048|gb|EFH35395.1| Omp31b [Brucella abortus bv. 5 str. B3196]
          Length = 261

 Score =  107 bits (268), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 46/268 (17%), Positives = 83/268 (30%), Gaps = 78/268 (29%)

Query: 3   KLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSA 62
            +     ++S+A+    SA AAD +                         + G Y G++A
Sbjct: 7   TVMKTALLASVAMLFTSSAMAADIIVAE---------PAPVAVDT---FSWTGGYIGINA 54

Query: 63  LYNGSFG-------------------EEAHHNAGGSIFAGYNVEDSC-IMYGVEGDV--- 99
            Y G                      +       G + AGYN + +  ++ G E D    
Sbjct: 55  GYAGGKFKHPFSGIEQDGAQDFSGSLDVTASGFVGGVQAGYNWQLANGLVLGGEADFQGS 114

Query: 100 ---------------RYTVPVLADN---IHSLHGIGGSLRIRGGYEVSDSLLLYATVGPD 141
                               +  D    + +     G++R R G+  ++ L++Y T G  
Sbjct: 115 TVKSKLVDNGDLSDIGVAGNLSGDESFVLETKVQWFGTVRARLGFTPTERLMVYGTGGLA 174

Query: 142 VAQKYETGKAGEI--------TPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGF 193
             +   +  A +         +    G T G GVE   ++ +   + EY  +   K    
Sbjct: 175 YGKVKTSLSAYDDGESFSAGNSKTKAGWTLGAGVEY-AVTNNWTLKSEYLYTDLGKRSFN 233

Query: 194 Y----------------NTISLGVGMKF 205
           Y                +T+ LG+  KF
Sbjct: 234 YIDEENVNINMENKVNFHTVRLGLNYKF 261


>gi|254719645|ref|ZP_05181456.1| 22 kDa outer membrane protein precursor [Brucella sp. 83/13]
 gi|306837721|ref|ZP_07470589.1| 22 kDa outer membrane protein precursor [Brucella sp. NF 2653]
 gi|306407177|gb|EFM63388.1| 22 kDa outer membrane protein precursor [Brucella sp. NF 2653]
          Length = 253

 Score =  107 bits (267), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 45/264 (17%), Positives = 83/264 (31%), Gaps = 78/264 (29%)

Query: 7   AVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNG 66
              ++S+A+    SA AAD +                         + G Y G++A Y G
Sbjct: 3   TALLASVAMLFTSSAMAADIIVAE---------PAPVAVDT---FSWTGGYIGINAGYAG 50

Query: 67  SFG-------------------EEAHHNAGGSIFAGYNVEDSC-IMYGVEGDVRYTVPVL 106
                                 +       G + AGYN + +  I+ G E D + +    
Sbjct: 51  GKFKHPFSDVEPDRGEDFSGSLDVTASGFVGGVQAGYNWQLANGIVLGGEADFQGSTVKS 110

Query: 107 ---------------------ADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQK 145
                                +  + +     G++R R G+  ++ L++Y T G    + 
Sbjct: 111 KLVDNGDLSDVGVAGNLSGDESFGLETKVQWFGTVRARLGFTPTERLMVYGTGGLAYGKV 170

Query: 146 YETGKAGEI--------TPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFY--- 194
             +  A +         +    G T G GVE   ++ +   + EY  +   K    Y   
Sbjct: 171 KTSLSAYDDGESFSAGNSKTKAGWTLGAGVEY-AVTNNWTLKSEYLYTDLGKRSFNYIDE 229

Query: 195 -------------NTISLGVGMKF 205
                        +T+ +G+  KF
Sbjct: 230 ENVNVNMENKVNFHTVRIGLNYKF 253


>gi|326410582|gb|ADZ67646.1| outer membrane protein Omp31 [Brucella melitensis M28]
          Length = 229

 Score =  107 bits (266), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 47/238 (19%), Positives = 76/238 (31%), Gaps = 59/238 (24%)

Query: 17  SFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSFG------- 69
              SA AAD V           PT A          + G Y G++A Y G          
Sbjct: 2   FATSAMAADVVVSEPSA-----PTAAPVD----TFSWTGGYIGINAGYAGGKFKHPFSSF 52

Query: 70  ------------EEAHHNAGGSIFAGYNVE-DSCIMYGVEGDVRYT---------VPVLA 107
                       +       G + AGYN + D+ ++ G E D + +            L 
Sbjct: 53  DKEDNEQVSGSLDVTAGGFVGGVQAGYNWQLDNGVVLGAETDFQGSSVTGSISAGASGLE 112

Query: 108 DNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEI--------TPIAI 159
               +     G++R R GY  ++ L++Y T G    +       G+              
Sbjct: 113 GKAETKVEWFGTVRARLGYTATERLMVYGTGGLAYGKVKSAFNLGDDASALHTWSDKTKA 172

Query: 160 GGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFY------------NTISLGVGMKF 205
           G T G G E   ++ +   + EY  +   K                 +T+ +G+  KF
Sbjct: 173 GWTLGAGAEY-AINNNWTLKSEYLYTDLGKRNLVDVDNSFLESKVNFHTVRVGLNYKF 229


>gi|158425351|ref|YP_001526643.1| outer membrane protein Omp31 precursor [Azorhizobium caulinodans
           ORS 571]
 gi|158332240|dbj|BAF89725.1| outer membrane protein Omp31 precursor [Azorhizobium caulinodans
           ORS 571]
          Length = 233

 Score =  107 bits (266), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 44/208 (21%), Positives = 71/208 (34%), Gaps = 43/208 (20%)

Query: 39  PTIATNRYVPIRHDFNGPYAGLSALYNGS------------FGEEAHHNAGGSIFAGYNV 86
           P  A    V     + G Y G +A Y G                            GYN 
Sbjct: 28  PVKAPVAPVAPVFSWTGFYIGANAGYGGDKYNYDFGVPTTATASTNSSGFFAGGQIGYNY 87

Query: 87  ED-SCIMYGVEGDVRYTV---------PVLADNIHSLHGIGGSLRIRGGYEVSDSLLLYA 136
           +  + ++ G+E D++++          P  + NI S     G++R R GY   D  L Y 
Sbjct: 88  QFANNVVLGLETDLQWSGIDGTLNTVTPGASTNIKSSLDYFGTVRARVGYAF-DRFLPYI 146

Query: 137 TVGPDVAQKYETG--------KAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYS 188
           T G    +    G           + +   +G T G GVE   ++ +   + EY+     
Sbjct: 147 TGGMAYGKTKTEGSQFSRTGFTTFDDSDTKVGWTIGGGVEY-AITNNWTFKTEYQYVDLG 205

Query: 189 K-----------VEGFYNTISLGVGMKF 205
                       V+  ++T+  GV  KF
Sbjct: 206 NSDYGIGTNAVSVDNKFHTVRAGVNYKF 233


>gi|13471933|ref|NP_103500.1| outer membrane protein [Mesorhizobium loti MAFF303099]
 gi|14022677|dbj|BAB49286.1| outer membrane protein [Mesorhizobium loti MAFF303099]
          Length = 220

 Score =  106 bits (265), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 51/216 (23%), Positives = 81/216 (37%), Gaps = 40/216 (18%)

Query: 4   LFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSAL 63
           + LA+  S   LA+     AAD V           P  A          + G Y G+ A 
Sbjct: 1   MKLALLCSVAFLAAASPVLAADIVE----------PVAAMP------FSWTGFYGGVQAG 44

Query: 64  -------YNGSFGEEAHHNAGGSIFAG---YNVEDSCIMYGVEGDVRYTVPV-------- 105
                  ++G+  +  + N  G IF G   YN + +  + G+EGD+  +           
Sbjct: 45  GGWNDSRWSGATFDSFNTNGSGGIFGGQIGYNYQINQFVIGIEGDLAGSTVKGDGQCSTA 104

Query: 106 LADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPI----AIGG 161
           L     +     GS+R R GY + D +L+Y   G    +       G          +G 
Sbjct: 105 LGTTCETKQDYLGSVRGRLGYAI-DRILIYGDAGVAFTKYKIAEVDGFHQSFGGGSRVGW 163

Query: 162 TAGVGVEVGGLSESLVARLEYRASKYSKVEGFYNTI 197
           TAG+G E   L++   A +E+    +    G  +TI
Sbjct: 164 TAGLGAEY-ALTDHWTAGVEWNYYDFGTKSGESDTI 198


>gi|254702337|ref|ZP_05164165.1| 22 kDa outer membrane protein precursor [Brucella suis bv. 5 str.
           513]
 gi|254704867|ref|ZP_05166695.1| 22 kDa outer membrane protein precursor [Brucella suis bv. 3 str.
           686]
 gi|254708278|ref|ZP_05170106.1| 22 kDa outer membrane protein precursor [Brucella pinnipedialis
           M163/99/10]
 gi|254710652|ref|ZP_05172463.1| 22 kDa outer membrane protein precursor [Brucella pinnipedialis
           B2/94]
 gi|254714835|ref|ZP_05176646.1| 22 kDa outer membrane protein precursor [Brucella ceti M644/93/1]
 gi|254717892|ref|ZP_05179703.1| 22 kDa outer membrane protein precursor [Brucella ceti M13/05/1]
 gi|256032146|ref|ZP_05445760.1| 22 kDa outer membrane protein precursor [Brucella pinnipedialis
           M292/94/1]
 gi|256061667|ref|ZP_05451806.1| 22 kDa outer membrane protein precursor [Brucella neotomae 5K33]
 gi|256160342|ref|ZP_05458035.1| 22 kDa outer membrane protein precursor [Brucella ceti M490/95/1]
 gi|256255546|ref|ZP_05461082.1| 22 kDa outer membrane protein precursor [Brucella ceti B1/94]
          Length = 253

 Score =  106 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 45/264 (17%), Positives = 83/264 (31%), Gaps = 78/264 (29%)

Query: 7   AVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNG 66
              ++S+A+    SA AAD +                         + G Y G++A Y G
Sbjct: 3   TALLASVAMLFTSSAMAADIIVAE---------PAPVAVDT---FSWTGGYIGINAGYAG 50

Query: 67  SFG-------------------EEAHHNAGGSIFAGYNVEDSC-IMYGVEGDVRYTVPVL 106
                                 +       G + AGYN + +  ++ G E D + +    
Sbjct: 51  GKFKHPFSGIEQDGAQDFSGSLDVTASGFVGGVQAGYNWQLANGLVLGGEADFQGSTVKS 110

Query: 107 ---------------------ADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQK 145
                                +  + +     G++R R G+  ++ L++Y T G    + 
Sbjct: 111 KLVDNGDLSDIGVAGNLSGDESFGLETKVQWFGTVRARLGFTPTERLMVYGTGGLAYGKV 170

Query: 146 YETGKAGEI--------TPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFY--- 194
             +  A +         +    G T G GVE   ++ +   + EY  +   K    Y   
Sbjct: 171 KTSLSAYDDGESFSAGNSKTKAGWTLGAGVEY-AVTNNWTLKSEYLYTDLGKRSFNYIDE 229

Query: 195 -------------NTISLGVGMKF 205
                        +T+ LG+  KF
Sbjct: 230 ENVNINMENKVNFHTVRLGLNYKF 253


>gi|319957414|ref|YP_004168677.1| porin [Nitratifractor salsuginis DSM 16511]
 gi|319419818|gb|ADV46928.1| porin [Nitratifractor salsuginis DSM 16511]
          Length = 220

 Score =  106 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 49/239 (20%), Positives = 89/239 (37%), Gaps = 53/239 (22%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+++  ++  +++AL+SF  A            G  +VP             ++G Y GL
Sbjct: 1   MRRVIFSL-TTAVALSSFAMA------------GGDIVPVAPAPAD-----SWSGFYVGL 42

Query: 61  SALYNGSFGEE-----------AHHNAGGSIFAGYNVE-DSCIMYGVE--------GDVR 100
            A       +                 GG ++AGYN   ++  + G+E         D  
Sbjct: 43  QAGGIWGNADVNIPAYPSNFSLDPDGFGGGVYAGYNWLLENDFLIGLEVAGNFISADDEG 102

Query: 101 YTVPVLADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYET----GKAGEITP 156
            +  +  +          ++ +R G  + D+ + Y T G    +   +    G  G    
Sbjct: 103 LSGGMGGEKYKVEQNWDAAILLRIGKVIDDTWMPYVTGGVAWTELETSYIPDGGWGSKKD 162

Query: 157 IAIGGTAGVGVEVGGLSESLVARLEYRASKY----------SKVEGFYNTISLGVGMKF 205
              G T G GVE   L+ ++ AR+EYR + Y          S V+   N + +G+  +F
Sbjct: 163 TVNGWTIGAGVE-MKLTTNIHARIEYRYTDYDTAQFVHAGPSNVDYNDNRVMVGISYRF 220


>gi|260466903|ref|ZP_05813086.1| porin [Mesorhizobium opportunistum WSM2075]
 gi|259029299|gb|EEW30592.1| porin [Mesorhizobium opportunistum WSM2075]
          Length = 234

 Score =  106 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 53/252 (21%), Positives = 81/252 (32%), Gaps = 68/252 (26%)

Query: 4   LFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSAL 63
           +   +  +   L     A AAD    +   G                +D++G YAG+ A 
Sbjct: 1   MKTLLLATVFILGPVGMACAADINEVSPVAG----------------YDWSGLYAGVDAG 44

Query: 64  YNGSFGEE-----------------AHHNAGGSIFAGYNVE-DSCIMYGVEGDVRYTVPV 105
           Y                              G I  G N +  +  + G E D+ Y+   
Sbjct: 45  YAAGKSNLFIAGGGFGGGSDLNVPLDPDGFVGGIHIGTNYQMANNFVIGAEADIAYSNAD 104

Query: 106 LADNIHSLHG-----------IGGSLRIRGGYEVSDSLLLYATVGPDVAQKYET----GK 150
               + +  G             GS R+R GY   D  L Y T G   A+   T    G 
Sbjct: 105 GLTPVDTGGGGVTTLLKSELKWQGSARLRAGYAF-DRTLPYITAGVAAAKYEVTAISAGP 163

Query: 151 AGE---ITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYS--------------KVEGF 193
            GE        +G T G G+E    ++  +AR EYR S +                V+  
Sbjct: 164 GGEIPFHDESHVGWTVGAGIE-HAFTDRWIARAEYRYSDFGSQDLSLAAGLPTVTSVDLQ 222

Query: 194 YNTISLGVGMKF 205
            + + +G+  KF
Sbjct: 223 THDVRVGLSYKF 234


>gi|240850131|ref|YP_002971524.1| hemin binding protein D [Bartonella grahamii as4aup]
 gi|240267254|gb|ACS50842.1| hemin binding protein D [Bartonella grahamii as4aup]
          Length = 272

 Score =  106 bits (264), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 46/279 (16%), Positives = 83/279 (29%), Gaps = 92/279 (32%)

Query: 7   AVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSAL--- 63
            V  S  +L S    QAAD V           P             + G Y G       
Sbjct: 6   LVSTSIFSLISISVVQAADMV----------TPEQPVPVIAAPAFSWTGFYLGGQIGSFS 55

Query: 64  --------------YNGSFGEEAHHNAG--GSIFAGYNVEDSC-IMYGVEGDVRYTVPVL 106
                         +N    E+    +G  G ++AG N++     + G++ D+ ++    
Sbjct: 56  GKTTASYLKDETGIWNPIGKEDLPKLSGFIGGVYAGSNIDIDNGFIIGIDTDIMWSDKKG 115

Query: 107 ADNIHS------------------------------------LHGIGGSLRIRGGYEVSD 130
             +I+                                          G+ R++ G+ +  
Sbjct: 116 TKDINRPKKSQTEEASSEETNLTRDSHEEDSTIPIEAVRHTLKQKWAGATRVKVGFAIE- 174

Query: 131 SLLLYATVGPDVAQKYETGKAG---------------EITPIAIGGTAGVGVEVGGLSES 175
            ++ Y + G    Q                       +     IG T G GV+   ++++
Sbjct: 175 RVMPYVSGGIAYTQLQNIFGLVADSNNRAVNFSDWLHDEKKTMIGYTLGGGVDF-AMTDN 233

Query: 176 LVARLEYRASKYSKVEGFY---------NTISLGVGMKF 205
           ++ R EYR S + K +  +         N   +GV  KF
Sbjct: 234 VIVRAEYRYSDFGKKKFVHDKFEMGYKTNDFRVGVAYKF 272


>gi|110634908|ref|YP_675116.1| hypothetical protein Meso_2567 [Mesorhizobium sp. BNC1]
 gi|110285892|gb|ABG63951.1| outer membrane protein, hypothetical [Chelativorans sp. BNC1]
          Length = 234

 Score =  105 bits (263), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 43/240 (17%), Positives = 83/240 (34%), Gaps = 44/240 (18%)

Query: 4   LFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSAL 63
           +   + ++ + L    +  AAD + +                     +D++G Y G+   
Sbjct: 1   MRSILSLAFIGLFGTSAGFAADAIIQRDDPVPVAP----VVAAPAKSYDWSGIYLGVDGG 56

Query: 64  YNGS----------------FGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLA 107
           Y  +                      ++  G ++ GYN +    + G EGD +       
Sbjct: 57  YKWNSLKFDPNSVAKKAGIKGDAFKMNSTFGGVYLGYNYQIDNWVIGAEGDAQLYFGGKD 116

Query: 108 DNIHSLHGI------GGSLRIRGGYEVSDSLLLYATVGPD-----VAQKYETGKAGEITP 156
               S +G        GS R+R GY + D  L Y T G       ++ K +         
Sbjct: 117 KAAASGNGRFAASRGFGSARVRLGYAM-DRFLPYVTGGAAFENLEISSKKDGKVVARDNK 175

Query: 157 IAIGGTAGVGVEVGGLSESLVARLEYRASKYSKV-----------EGFYNTISLGVGMKF 205
             +G T G G++   ++E  + ++EY+   + K                +T+ +G+  KF
Sbjct: 176 TRVGYTLGAGLDY-AITEKWIGKVEYQFMDFGKKSYDLDIGSADLSSHSHTMRVGLSYKF 234


>gi|306843011|ref|ZP_07475638.1| 22 kDa outer membrane protein precursor [Brucella sp. BO2]
 gi|306844622|ref|ZP_07477209.1| 22 kDa outer membrane protein precursor [Brucella sp. BO1]
 gi|306275066|gb|EFM56829.1| 22 kDa outer membrane protein precursor [Brucella sp. BO1]
 gi|306286803|gb|EFM58344.1| 22 kDa outer membrane protein precursor [Brucella sp. BO2]
          Length = 253

 Score =  105 bits (263), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 45/264 (17%), Positives = 83/264 (31%), Gaps = 78/264 (29%)

Query: 7   AVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNG 66
              ++S+A+    SA AAD +                         + G Y G++A Y G
Sbjct: 3   TALLASVAMLFTSSAMAADIIVAE---------PAPVAVDT---FSWTGGYIGINAGYAG 50

Query: 67  SFG-------------------EEAHHNAGGSIFAGYNVEDSC-IMYGVEGDVRYTVPVL 106
                                 +       G + AGYN + +  I+ G E D + +    
Sbjct: 51  GKFKHPFSGVEQDGGEDFSGSLDVTGSGFVGGVQAGYNWQLANGIVLGGEADFQGSTVKS 110

Query: 107 ---------------------ADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQK 145
                                +  + +     G++R R G+  ++ L++Y T G    + 
Sbjct: 111 KLVDKGDLSDIGVAGNLDGDESFGLETKVQWFGTVRARLGFTPTERLMVYGTGGLAYGKV 170

Query: 146 YETGKAGEI--------TPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFY--- 194
             +  A +         +    G T G GVE   ++ +   + EY  +   K    Y   
Sbjct: 171 KTSLSAYDDGESFSAGNSKTKAGWTLGAGVEY-AVTNNWTLKSEYLYTDLGKRSFNYIDE 229

Query: 195 -------------NTISLGVGMKF 205
                        +T+ +G+  KF
Sbjct: 230 ENVNVNMENKVNFHTVRIGLNYKF 253


>gi|189024724|ref|YP_001935492.1| OmpA-like transmembrane domain protein [Brucella abortus S19]
 gi|254689800|ref|ZP_05153054.1| OmpA-like transmembrane domain-containing protein [Brucella abortus
           bv. 6 str. 870]
 gi|254694291|ref|ZP_05156119.1| OmpA-like transmembrane domain-containing protein [Brucella abortus
           bv. 3 str. Tulya]
 gi|254697943|ref|ZP_05159771.1| OmpA-like transmembrane domain-containing protein [Brucella abortus
           bv. 2 str. 86/8/59]
 gi|254730834|ref|ZP_05189412.1| OmpA-like transmembrane domain-containing protein [Brucella abortus
           bv. 4 str. 292]
 gi|256258053|ref|ZP_05463589.1| OmpA-like transmembrane domain-containing protein [Brucella abortus
           bv. 9 str. C68]
 gi|189020296|gb|ACD73018.1| OmpA-like transmembrane domain protein [Brucella abortus S19]
          Length = 253

 Score =  105 bits (263), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 46/264 (17%), Positives = 82/264 (31%), Gaps = 78/264 (29%)

Query: 7   AVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNG 66
              ++S+A+    SA AAD +                         + G Y G++A Y G
Sbjct: 3   TALLASVAMLFTSSAMAADIIVAE---------PAPVAVDT---FSWTGGYIGINAGYAG 50

Query: 67  SFG-------------------EEAHHNAGGSIFAGYNVEDSC-IMYGVEGDV------- 99
                                 +       G + AGYN + +  ++ G E D        
Sbjct: 51  GKFKHPFSGIEQDGAQDFSGSLDVTASGFVGGVQAGYNWQLANGLVLGGEADFQGSTVKS 110

Query: 100 -----------RYTVPVLADN---IHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQK 145
                           +  D    + +     G++R R G+  ++ L++Y T G    + 
Sbjct: 111 KLVDNGDLSDIGVAGNLSGDESFVLETKVQWFGTVRARLGFTPTERLMVYGTGGLAYGKV 170

Query: 146 YETGKAGEI--------TPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFY--- 194
             +  A +         +    G T G GVE   ++ +   + EY  +   K    Y   
Sbjct: 171 KTSLSAYDDGESFSAGNSKTKAGWTLGAGVEY-AVTNNWTLKSEYLYTDLGKRSFNYIDE 229

Query: 195 -------------NTISLGVGMKF 205
                        +T+ LG+  KF
Sbjct: 230 ENVNINMENKVNFHTVRLGLNYKF 253


>gi|302319025|gb|ADL14702.1| outer membrane protein 31 [Brucella melitensis]
          Length = 240

 Score =  105 bits (263), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 50/248 (20%), Positives = 80/248 (32%), Gaps = 59/248 (23%)

Query: 7   AVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNG 66
           +V ++S+A     SA AAD V           PT+A          + G Y G++A Y G
Sbjct: 3   SVILASIAAMFATSAMAADVVVSEPSA-----PTVAPVD----TFSWTGGYIGINAGYAG 53

Query: 67  SFG-------------------EEAHHNAGGSIFAGYNVE-DSCIMYGVEGDVRYT---- 102
                                 +       G + AGYN + D+ ++ G E D + +    
Sbjct: 54  GKFKHPFSSFDKEDNEQVSGSLDVTAGGFVGGVQAGYNWQLDNGVVLGAETDFQGSSVTG 113

Query: 103 -----VPVLADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEI--- 154
                   L     +     G++R R GY  ++ L++Y T G    +       G+    
Sbjct: 114 SISAGASGLEGKAETKVEWFGTVRARLGYTATERLMVYGTGGLAYGKVKSAFNLGDDASA 173

Query: 155 -----TPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFY------------NTI 197
                     G T G G E    + +   + EY      K                 +T 
Sbjct: 174 LHTWSDKTKAGWTLGAGAEY-AFNNNWTLKSEYLYPYLGKRNLVDVDNSFLESKVNFHTD 232

Query: 198 SLGVGMKF 205
             G+  KF
Sbjct: 233 RFGLNYKF 240


>gi|217977075|ref|YP_002361222.1| porin [Methylocella silvestris BL2]
 gi|217502451|gb|ACK49860.1| porin [Methylocella silvestris BL2]
          Length = 255

 Score =  105 bits (262), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 52/223 (23%), Positives = 77/223 (34%), Gaps = 43/223 (19%)

Query: 3   KLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSA 62
            L   +  S  A+A   +A AAD   RA          I           + G Y G   
Sbjct: 1   MLRRVLLASVGAIALAGTALAADLPSRAPPPVYVPPAPI---------FTWTGVYIGGQI 51

Query: 63  LYNGSFGE--------------EAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYT------ 102
            Y    G                + +   G    GYN++ +  + G+EG V  T      
Sbjct: 52  GYAWGNGSANFGDANGNFVNFGNSGNGVIGGAHVGYNLQLNQFVVGLEGSVDGTSLSKTY 111

Query: 103 --------VPVLADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKA--- 151
                     V   N+H+   I GS+R R GY   D +L+YAT G   A    +      
Sbjct: 112 SGTAFVPGFGVAGINLHTSADIQGSIRGRVGYAW-DRVLVYATGGVAFAGVKASLSTPFS 170

Query: 152 -GEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGF 193
               +   +G T G G+E   ++ +   R EYR S +     +
Sbjct: 171 YDSSSTTKVGWTVGGGLEY-AVTNNWSIRAEYRYSNFGNATLY 212


>gi|306840766|ref|ZP_07473513.1| outer membrane protein Omp31 [Brucella sp. BO2]
 gi|306289161|gb|EFM60410.1| outer membrane protein Omp31 [Brucella sp. BO2]
          Length = 223

 Score =  105 bits (262), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 45/233 (19%), Positives = 74/233 (31%), Gaps = 59/233 (25%)

Query: 22  QAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSFG------------ 69
            AAD V           P+  T   V     + G Y G++A Y G               
Sbjct: 1   MAADVVVSE--------PSAPTTAPVDT-FSWTGGYIGINAGYAGGKFKHPFSAFDTDDN 51

Query: 70  -------EEAHHNAGGSIFAGYNVE-DSCIMYGVEGDVRYT---------VPVLADNIHS 112
                          G + AGYN + D+ ++ G E D + +            L     +
Sbjct: 52  ERVSGSLNITSGGFVGGVQAGYNWQLDNGVVLGAETDFQGSSVTGSISADAGGLEGKAET 111

Query: 113 LHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEI--------TPIAIGGTAG 164
                G++R R GY  ++ L++Y T G    +       G+              G T G
Sbjct: 112 KVEWFGTVRARLGYTATERLMVYGTGGLAYGKVKSAFNLGDDVSALHTWSDKTKAGWTLG 171

Query: 165 VGVEVGGLSESLVARLEYRASKYSKVEGFY------------NTISLGVGMKF 205
            G E   ++ +   + EY  +   K                 +T+ +G+  KF
Sbjct: 172 AGAEY-AINNNWTLKSEYLYTDLGKRNLIDVDDSFLESKVNFHTVRVGLNYKF 223


>gi|319403668|emb|CBI77253.1| Hemin binding protein d [Bartonella rochalimae ATCC BAA-1498]
          Length = 262

 Score =  105 bits (261), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 47/268 (17%), Positives = 88/268 (32%), Gaps = 74/268 (27%)

Query: 4   LFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSAL 63
           +   +   S         QAAD ++         VP I+++        + G Y G    
Sbjct: 3   IKHLLVACSWTFIPVSMVQAADIMKPHQSQSYQPVPVISSSN----NFSWTGFYVGAQIG 58

Query: 64  YNGSFGEEAHH------------------------NAGGSIFAGYNVE-DSCIMYGVEGD 98
             G  GE                               G I+AG N      ++ G++ D
Sbjct: 59  --GFSGEATLSPIQDSVEEDREGQGFSEIKSPKLSGFIGGIYAGSNFSLSKDLILGIDTD 116

Query: 99  VRYTVPVLAD---------NIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKY--- 146
           + ++               ++       G++R+R G+ + D ++ Y + G    Q     
Sbjct: 117 MVWSGKKNTKVFDVQDMSIDMSIKEKWAGAMRMRVGFAM-DRVMPYVSGGVSYVQLQNVF 175

Query: 147 --------------------ETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASK 186
                                  K  + T I +G + G GV+V  ++++++ R EYR S 
Sbjct: 176 TAKRLAKAVVRERRNTLPSDSEPKFLDETKILVGYSVGGGVDV-AMTDNVIMRAEYRYSD 234

Query: 187 YSKVEGFYNTI---------SLGVGMKF 205
           + K +   + +          +GV  KF
Sbjct: 235 FGKKKFAKDNVDLSYKTNDFRVGVAYKF 262


>gi|91975762|ref|YP_568421.1| putative outer membrane protein [Rhodopseudomonas palustris BisB5]
 gi|91682218|gb|ABE38520.1| putative outer membrane protein [Rhodopseudomonas palustris BisB5]
          Length = 207

 Score =  105 bits (261), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 41/149 (27%), Positives = 66/149 (44%), Gaps = 16/149 (10%)

Query: 50  RHDFNGPYAGLSALYNGSFGEEAHH-----NAGGSIFAGYNVEDSCIMYGVEGDVRYTVP 104
              + GPY G +  Y+  FG   +         G +  GYN +   I++G+EGD++++  
Sbjct: 41  AFSWAGPYLGGNLGYS--FGNVTNSITKPSGFNGGVQGGYNWQSGNIVFGLEGDIQFS-- 96

Query: 105 VLADNIHSLHGIG----GSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIG 160
             AD+  + +       G+ R R GY ++D LL+YAT G    Q          +  + G
Sbjct: 97  -TADDTFAPYKFSNPWFGTARGRVGYAMND-LLIYATGGFAFGQLKGERLLSTESHSSAG 154

Query: 161 GTAGVGVEVGGLSESLVARLEYRASKYSK 189
            T G G E    +  L A++EY     S 
Sbjct: 155 WTVGAGAEF-AFAPKLSAKVEYLYGSLST 182


>gi|13470965|ref|NP_102534.1| outer membrane protein [Mesorhizobium loti MAFF303099]
 gi|14021708|dbj|BAB48320.1| outer membrane protein [Mesorhizobium loti MAFF303099]
          Length = 226

 Score =  105 bits (261), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 42/206 (20%), Positives = 65/206 (31%), Gaps = 44/206 (21%)

Query: 42  ATNRYVPIRHDFNGPYAGLSALYNGSFGEEA----------------HHNAGGSIFAGYN 85
           A +      HD++G Y G    Y     +                       G +  GYN
Sbjct: 23  AISAEPATAHDWSGVYVGGQIGYGFGKTDATYNLPNTPTIRGSQDYDTDGFLGGVQIGYN 82

Query: 86  VEDSCIMYGVEGDVRYTVPV---------LADNIHSLHGIGGSLRIRGGYEVSDSLLLYA 136
            + +  + GVE DV               L D   +     G+LR R GY   D  L+Y 
Sbjct: 83  YQINSAVLGVEADVSGADIKGHSDEITSGLGDRYDTKVDWFGTLRARAGYAF-DRTLIYG 141

Query: 137 TVGPDVAQKYETGKAG-----EITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKV- 190
           T G            G           +G T G G+E   +++   A+ EY+        
Sbjct: 142 TGGLAFGSVENRYVDGPFDTFSEKNTKVGWTIGAGLE-QAITDHWSAKFEYQYVDLRDQT 200

Query: 191 -----------EGFYNTISLGVGMKF 205
                      +  +N + +G+  KF
Sbjct: 201 IDYAPNSNTTFDNTFNAVKIGMNYKF 226


>gi|319408049|emb|CBI81703.1| Hemin binding protein C [Bartonella schoenbuchensis R1]
          Length = 274

 Score =  104 bits (260), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 50/281 (17%), Positives = 87/281 (30%), Gaps = 88/281 (31%)

Query: 4   LFLAVGVSSLALASFCSAQAAD-PVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSA 62
           +   +  S  AL S  +AQAAD PV+           T+     V     + G Y G   
Sbjct: 3   MKCVITASIFALVSASAAQAADMPVQERPT-------TVLPQVVVAPAFSWTGFYLGGQI 55

Query: 63  L-------YNGSFGEEAH-----------HNAGGSIFAGYNVEDSC-IMYGVEGDVRYTV 103
                   +  + G+                  G ++AG NV+     + GV+ D+ ++ 
Sbjct: 56  GGFSSNSSWVRTSGDIQGILGHNKAFPKFSGFVGGLYAGSNVDFGNGFVLGVDTDIVWSG 115

Query: 104 PVL---------------------------------------ADNIHSLHGIGGSLRIRG 124
                                                      +++       G+ R+R 
Sbjct: 116 AKAKASRSSLRTGNGARLAARAGVSTRAPALFEGTDNNASRVTESVTFSDKWSGATRVRL 175

Query: 125 GYEVSDSLLLYATVGPDVAQKYETGKAG-----------EITPIAIGGTAGVGVEVGGLS 173
           G+   D ++ Y   G   +Q                     +   +G T G GV+   ++
Sbjct: 176 GFAF-DRIMPYVAGGIAYSQIKAVVAEERQGVETVIEQLSGSKTLVGYTLGAGVDF-AMT 233

Query: 174 ESLVARLEYRASKYSKV---------EGFYNTISLGVGMKF 205
           +S++ R EYR S + K          +   N   +GV  KF
Sbjct: 234 DSVILRAEYRYSDFGKKSFISNNAEIDLKTNDFRVGVAYKF 274


>gi|222082486|ref|YP_002541851.1| outer membrane protein [Agrobacterium radiobacter K84]
 gi|221727165|gb|ACM30254.1| outer membrane protein [Agrobacterium radiobacter K84]
          Length = 230

 Score =  104 bits (260), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 53/239 (22%), Positives = 74/239 (30%), Gaps = 50/239 (20%)

Query: 5   FLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSA-- 62
            L       A     +A  AD             P  A          + G Y GL+   
Sbjct: 4   VLGSAAFLFAFGMASAAYTADL--------SVSTPPAAPMEQ--PVFTWTGFYVGLNGGG 53

Query: 63  --------------LYNGSFGEEAHHNAGGSIFAGYNVE-DSCIMYGVEGDV---RYTVP 104
                          + G FG+       G    GYN + D   + G+E D         
Sbjct: 54  AFGGDDKFGLHSGDTFLGKFGKIEGSGFFGGGQIGYNYQVDPNWVIGLEADFQGANIHDS 113

Query: 105 VLADNIH--SLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAG-----EITPI 157
           V  D  H  S     G+LR R GY   D+ L Y T G         G             
Sbjct: 114 VTNDGAHGSSKINWFGTLRPRVGYAY-DNTLFYGTGGLAYGHIDYKGSLDGVGSFSEDKT 172

Query: 158 AIGGTAGVGVEVGGLSESLVARLEYRASKYS-----------KVEGFYNTISLGVGMKF 205
             G   G GVE    ++++ A+LEY+   +            K    +++I +GV  KF
Sbjct: 173 KAGWVLGAGVE-HAFTDNVTAKLEYQYVDFGSFTAGGDALSSKATADFHSIRVGVNYKF 230


>gi|240849915|ref|YP_002971304.1| hemin binding protein C [Bartonella grahamii as4aup]
 gi|240267038|gb|ACS50626.1| hemin binding protein C [Bartonella grahamii as4aup]
          Length = 277

 Score =  104 bits (260), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 53/289 (18%), Positives = 88/289 (30%), Gaps = 98/289 (33%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+ L  A   S+ A  S  +AQAAD +           PT      V     + G Y G 
Sbjct: 3   MKWLITA---SAFAFVSVSAAQAADVI-------VPPSPTPVAPVIVAPTFSWTGFYLGG 52

Query: 61  SALYNGSFGEEAHH-------------------NAGGSIFAGYNVEDSC-IMYGVEGDVR 100
                G  G+                          G ++AG NV+    ++ GV+ D+ 
Sbjct: 53  QLG--GFSGKTKMDILSNGKKIPAPDDLLPKLSGFMGGLYAGSNVDLGNGLILGVDTDIM 110

Query: 101 YT--VPVLADNIHS-------------------------------------LHGIGGSLR 121
           ++        N +                                           G+ R
Sbjct: 111 WSNKDDTKTGNTYVILPDHINYIKKILTESGINIGKDALEAGAKRTHSFTFKEKWAGATR 170

Query: 122 IRGGYEVSDSLLLYATVGPDVAQKYE----------------TGKAGEITPIAIGGTAGV 165
           +R G+  ++ ++ Y   G    Q  +                +G   + T   +G T G 
Sbjct: 171 VRIGFA-AERIMPYVAGGIAYTQLQDTASISITGKDSDKVIASGTLSDETKTLVGYTLGA 229

Query: 166 GVEVGGLSESLVARLEYRASKYSKV---------EGFYNTISLGVGMKF 205
           GV+   ++ +++ R EYR S + K              N   +GV  KF
Sbjct: 230 GVD-LAMTNNVIVRAEYRYSDFGKKKFSNDKYETSYKTNDFRVGVAYKF 277


>gi|17989189|ref|NP_541822.1| 31 kDa outer-membrane immunogenic protein precursor [Brucella
           melitensis bv. 1 str. 16M]
 gi|17985044|gb|AAL54086.1| 31 kDa outer-membrane immunogenic protein precursor [Brucella
           melitensis bv. 1 str. 16M]
          Length = 219

 Score =  104 bits (259), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 41/216 (18%), Positives = 71/216 (32%), Gaps = 51/216 (23%)

Query: 39  PTIATNRYVPIRHDFNGPYAGLSALYNGSFG-------------------EEAHHNAGGS 79
           P+  T   V     + G Y G++A Y G                      +       G 
Sbjct: 6   PSAPTAAPVDT-FSWTGGYIGINAGYAGGKFKHPFSSFDKEDNEQVSGSLDVTAGGFVGG 64

Query: 80  IFAGYNVE-DSCIMYGVEGDVRYT---------VPVLADNIHSLHGIGGSLRIRGGYEVS 129
           + AGYN + D+ ++ G E D + +            L     +     G++R R GY  +
Sbjct: 65  VQAGYNWQLDNGVVLGAETDFQGSSVTGSISAGASGLEGKAETKVEWFGTVRARLGYTAT 124

Query: 130 DSLLLYATVGPDVAQKYETGKAGEI--------TPIAIGGTAGVGVEVGGLSESLVARLE 181
           + L++Y T G    +       G+              G T G G E   ++ +   + E
Sbjct: 125 ERLMVYGTGGLAYGKVKSAFNLGDDASALHTWSDKTKAGWTLGAGAEY-AINNNWTLKSE 183

Query: 182 YRASKYSKVEGFY------------NTISLGVGMKF 205
           Y  +   K                 +T+ +G+  KF
Sbjct: 184 YLYTDLGKRNLVDVDNSFLESKVNFHTVRVGLNYKF 219


>gi|260545348|ref|ZP_05821089.1| LOW QUALITY PROTEIN: outer membrane protein [Brucella abortus NCTC
           8038]
 gi|260754712|ref|ZP_05867060.1| LOW QUALITY PROTEIN: outer membrane protein 25b [Brucella abortus
           bv. 6 str. 870]
 gi|260757935|ref|ZP_05870283.1| LOW QUALITY PROTEIN: outer membrane protein 25b [Brucella abortus
           bv. 4 str. 292]
 gi|260761758|ref|ZP_05874101.1| LOW QUALITY PROTEIN: outer membrane protein 25b [Brucella abortus
           bv. 2 str. 86/8/59]
 gi|260883735|ref|ZP_05895349.1| LOW QUALITY PROTEIN: outer membrane protein 25b [Brucella abortus
           bv. 9 str. C68]
 gi|260096755|gb|EEW80630.1| LOW QUALITY PROTEIN: outer membrane protein [Brucella abortus NCTC
           8038]
 gi|260668253|gb|EEX55193.1| LOW QUALITY PROTEIN: outer membrane protein 25b [Brucella abortus
           bv. 4 str. 292]
 gi|260672190|gb|EEX59011.1| LOW QUALITY PROTEIN: outer membrane protein 25b [Brucella abortus
           bv. 2 str. 86/8/59]
 gi|260674820|gb|EEX61641.1| LOW QUALITY PROTEIN: outer membrane protein 25b [Brucella abortus
           bv. 6 str. 870]
 gi|260873263|gb|EEX80332.1| LOW QUALITY PROTEIN: outer membrane protein 25b [Brucella abortus
           bv. 9 str. C68]
          Length = 173

 Score =  104 bits (259), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 35/167 (20%), Positives = 57/167 (34%), Gaps = 37/167 (22%)

Query: 74  HNAGGSIFAGYNVEDSC-IMYGVEGDVRYTVPVLA-----------DNIHSLHGIGGSLR 121
               G ++AGYN +     + GV+GD+ Y     +             + S     G++R
Sbjct: 9   DGFLGGLYAGYNFDMGNNFVLGVDGDITYNDLDASHSDTDPDLDLTTGVDSKLRWSGAVR 68

Query: 122 IRGGYEVSDSLLLYATVGPDVAQKY--------ETGKAGEITPIAIGGTAGVGVEVGGLS 173
            R G  + D  + Y   G                       +    G  AG GV+    +
Sbjct: 69  ARMGVAM-DRWMPYIAGGVAFGNVKNSVSLTDGIESIGVSQSKTMTGWAAGAGVDYAA-T 126

Query: 174 ESLVARLEYRASKYSKVE---------------GFYNTISLGVGMKF 205
           ++++ RLEYR + Y   +                  + I LGV  KF
Sbjct: 127 DNVIVRLEYRYTDYGHKDFSVVDGDLSVEARNKFKTHDIRLGVAYKF 173


>gi|294853764|ref|ZP_06794436.1| outer-membrane immunogenic protein [Brucella sp. NVSL 07-0026]
 gi|294819419|gb|EFG36419.1| outer-membrane immunogenic protein [Brucella sp. NVSL 07-0026]
 gi|326553873|gb|ADZ88512.1| outer membrane protein Omp31 [Brucella melitensis M5-90]
          Length = 223

 Score =  104 bits (259), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 45/233 (19%), Positives = 74/233 (31%), Gaps = 59/233 (25%)

Query: 22  QAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSFG------------ 69
            AAD V           PT A          + G Y G++A Y G               
Sbjct: 1   MAADVVVSEPSA-----PTAAPVD----TFSWTGGYIGINAGYAGGKFKHPFSSFDKEDN 51

Query: 70  -------EEAHHNAGGSIFAGYNVE-DSCIMYGVEGDVRYT---------VPVLADNIHS 112
                  +       G + AGYN + D+ ++ G E D + +            L     +
Sbjct: 52  EQVSGSLDVTAGGFVGGVQAGYNWQLDNGVVLGAETDFQGSSVTGSISAGASGLEGKAET 111

Query: 113 LHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEI--------TPIAIGGTAG 164
                G++R R GY  ++ L++Y T G    +       G+              G T G
Sbjct: 112 KVEWFGTVRARLGYTATERLMVYGTGGLAYGKVKSAFNLGDDASALHTWSDKTKAGWTLG 171

Query: 165 VGVEVGGLSESLVARLEYRASKYSKVEGFY------------NTISLGVGMKF 205
            G E   ++ +   + EY  +   K                 +T+ +G+  KF
Sbjct: 172 AGAEY-AINNNWTLKSEYLYTDLGKRNLVDVDNSFLESKVNFHTVRVGLNYKF 223


>gi|289467881|gb|ADC95625.1| 31kDa outer membrane immunogenic protein precursor [Brucella
           melitensis bv. 1 str. M5]
          Length = 219

 Score =  103 bits (258), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 41/216 (18%), Positives = 71/216 (32%), Gaps = 51/216 (23%)

Query: 39  PTIATNRYVPIRHDFNGPYAGLSALYNGSFG-------------------EEAHHNAGGS 79
           P+  T   V     + G Y G++A Y G                      +       G 
Sbjct: 6   PSAPTAAPVDT-FSWTGGYIGINAGYAGGKFKHPFSSFDKEDNEQVSGSLDVTAGGFVGG 64

Query: 80  IFAGYNVE-DSCIMYGVEGDVRYT---------VPVLADNIHSLHGIGGSLRIRGGYEVS 129
           + AGYN + D+ ++ G E D + +            L     +     G++R R GY  +
Sbjct: 65  VQAGYNWQLDNGVVLGAETDFQGSSVTGSISAGASGLEGKAETKVEWFGTVRARLGYTAT 124

Query: 130 DSLLLYATVGPDVAQKYETGKAGEI--------TPIAIGGTAGVGVEVGGLSESLVARLE 181
           + L++Y T G    +       G+              G T G G E   ++ +   + E
Sbjct: 125 ERLMVYGTGGLAYGKVKSAFNLGDDAGALHTWSDKTKAGWTLGAGAEY-AINNNWTLKSE 183

Query: 182 YRASKYSKVEGFY------------NTISLGVGMKF 205
           Y  +   K                 +T+ +G+  KF
Sbjct: 184 YLYTDLGKRNLVDVDNSFLESKVNFHTVRVGLNYKF 219


>gi|319782584|ref|YP_004142060.1| porin [Mesorhizobium ciceri biovar biserrulae WSM1271]
 gi|317168472|gb|ADV12010.1| porin [Mesorhizobium ciceri biovar biserrulae WSM1271]
          Length = 242

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 52/255 (20%), Positives = 83/255 (32%), Gaps = 70/255 (27%)

Query: 3   KLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSA 62
            + + +  +++ LA    A AAD    +                    +D++G YAG+  
Sbjct: 6   TMKILLLATAIILAPAGMACAADIAETSPT----------------SAYDWSGLYAGVDI 49

Query: 63  LYN----------GSFGEEAHHNAG-------GSIFAGYNVE-DSCIMYGVEGDVRY--- 101
            Y           G  G     N G       G +  G N + ++  + G E D+ Y   
Sbjct: 50  GYAAGKSNLFIAGGGLGGATDLNVGVDPNGFIGGVHIGANYQMENSFVIGAEADIAYGNI 109

Query: 102 ---------TVPVLADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQ---KYETG 149
                        +   + S     GS R+R GY   D  L Y T G   A+      + 
Sbjct: 110 DGLTALDAGGGGGVTTLLKSELKWSGSARLRAGYAF-DRTLPYITAGVAAAKYELIAVSA 168

Query: 150 KAGEITPIA-----IGGTAGVGVEVGGLSESLVARLEYRASKYSK--------------V 190
                         +G T G G+E    ++  +AR EYR S +                V
Sbjct: 169 GGPAAEVTLHSDSHVGWTVGAGIE-HAFTDRWIARAEYRYSDFGSQDLSVAAGLPTETHV 227

Query: 191 EGFYNTISLGVGMKF 205
           +     I +G+  KF
Sbjct: 228 DLQTQDIRVGLSYKF 242


>gi|254696546|ref|ZP_05158374.1| outer membrane protein, putative [Brucella abortus bv. 2 str.
           86/8/59]
 gi|254705298|ref|ZP_05167126.1| outer membrane protein, putative [Brucella suis bv. 3 str. 686]
 gi|260760923|ref|ZP_05873266.1| outer membrane protein [Brucella abortus bv. 2 str. 86/8/59]
 gi|261756008|ref|ZP_05999717.1| outer membrane protein [Brucella suis bv. 3 str. 686]
 gi|260671355|gb|EEX58176.1| outer membrane protein [Brucella abortus bv. 2 str. 86/8/59]
 gi|261745761|gb|EEY33687.1| outer membrane protein [Brucella suis bv. 3 str. 686]
          Length = 158

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 34/159 (21%), Positives = 60/159 (37%), Gaps = 29/159 (18%)

Query: 74  HNAGGSIFAGYNVEDSC-IMYGVEGDVRYTVPVLADNI-----------HSLHGIGGSLR 121
           +   G ++ GYN +     + G++ +V Y     + +             +     G++R
Sbjct: 2   NGFIGGLYTGYNFDTGNNFILGLDANVDYNNLKKSRDFITSGNPVQTTGETQLRWSGAVR 61

Query: 122 IRGGYEVSDSLLLYATVGPDVAQKYET----GKAGEITPIAIGGTAGVGVEVGGLSESLV 177
            R GY + D  + Y   G        +    G+    +    G T G G++    +++++
Sbjct: 62  ARAGYAI-DRFMPYIAGGVAFGGIKNSLRIGGEESSKSKTQTGWTVGAGIDYAA-TDNVL 119

Query: 178 ARLEYRASKYSKV-----------EGFYNTISLGVGMKF 205
            RLEYR + Y K                N I LGV  KF
Sbjct: 120 LRLEYRYTDYGKKNFGLNDLDTRGSFKTNDIRLGVAYKF 158


>gi|182679250|ref|YP_001833396.1| porin [Beijerinckia indica subsp. indica ATCC 9039]
 gi|182635133|gb|ACB95907.1| porin [Beijerinckia indica subsp. indica ATCC 9039]
          Length = 250

 Score =  102 bits (254), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 46/200 (23%), Positives = 64/200 (32%), Gaps = 47/200 (23%)

Query: 51  HDFNGPYAGLSALYNGS----------------FGEEAHHNAGGSIFAGYNVE------- 87
             + G Y G    Y                   FG  +     G    GYN +       
Sbjct: 40  FTWTGVYVGGDIGYAWGNTSYNSQIFSAPARFAFGSYSPDGVTGGAHVGYNFQAGPSFIG 99

Query: 88  DSCIMYGVEGDV---RYTVPVLADNIH---SLHGIGGSLRIRGGYEVSDSLLLYATVGPD 141
               + G+EGDV    Y+  V+        S   I GS+R R G    D  L+YAT G  
Sbjct: 100 TGNFVIGIEGDVQGSNYSKSVVGFANDIYTSKLDITGSIRGRLGIAF-DRALIYATGGAA 158

Query: 142 VAQKYE-----TGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGF--- 193
                       G        A+G T G G+E   ++ +   R +Y  S Y     F   
Sbjct: 159 FGGITNQLQLRNGAFFSNDRTAVGWTVGGGIEY-AVTNNWSVRAQYLYSDYGHTNSFFPN 217

Query: 194 --------YNTISLGVGMKF 205
                    N +++G   KF
Sbjct: 218 AQVHKHDTQNKVTVGFSYKF 237


>gi|254504423|ref|ZP_05116574.1| OmpA-like transmembrane domain, putative [Labrenzia alexandrii
           DFL-11]
 gi|222440494|gb|EEE47173.1| OmpA-like transmembrane domain, putative [Labrenzia alexandrii
           DFL-11]
          Length = 221

 Score =  102 bits (253), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 45/220 (20%), Positives = 78/220 (35%), Gaps = 29/220 (13%)

Query: 13  LALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRH-DFNGPYAGLSALYN------ 65
           LALA F    +A     A                   +  D+ G Y G    +       
Sbjct: 4   LALAGFALTASAAGALAADLPQSPAPAPAYDAVPAGQQSIDWTGFYVGTQLGWAFGNFDN 63

Query: 66  ---GSFGEEAHHNAGGSIFAGYNVE-DSCIMYGVEGDVRYTVPVLADNIH-----SLHGI 116
              G+    +++  GG  +AGYN +    ++ G+E D   T    +  ++     S    
Sbjct: 64  STGGASSSFSNNGVGGGAYAGYNFQVTPNVVVGLESDFSLTDLEKSGTVNGLSLKSSSDW 123

Query: 117 GGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESL 176
             + R R GY   D  ++Y   G  +A    T      +  A+G T G G E   +++++
Sbjct: 124 NANFRGRLGYAF-DRYMIYGAGGLAIADLEATANGVSDSKTALGWTLGAGAEA-AITQNV 181

Query: 177 VARLEYRASKYSKVE-----------GFYNTISLGVGMKF 205
           VAR +Y    +   +              + +  G+  KF
Sbjct: 182 VARFDYSYQDFGDQDFNLGGTGVSTEFNDHQVRAGIAYKF 221


>gi|319408047|emb|CBI81701.1| Hemin binding protein C [Bartonella schoenbuchensis R1]
          Length = 289

 Score =  102 bits (253), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 52/296 (17%), Positives = 87/296 (29%), Gaps = 103/296 (34%)

Query: 4   LFLAVGVSSLALASFCSAQAAD-PVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSA 62
           +   +  S  AL S  +AQAAD PV+           T+     V     + G Y G   
Sbjct: 3   MKCVITASIFALVSASAAQAADMPVQERPT-------TVLPQVVVAPAFSWTGFYLGGQI 55

Query: 63  L-----------YNGSFGEEAH-----------HNAGGSIFAGYNVEDSC-IMYGVEGDV 99
                       Y G    +                 G ++AG NV+     + GV+ D+
Sbjct: 56  GGFSSNSSSKRIYQGVSKGKEDILVDNKAFPKFSGFVGGLYAGSNVDFGNGFVLGVDTDI 115

Query: 100 RYTVPVL-----------------------------------------ADNIHSLHGIGG 118
            ++                                               N+       G
Sbjct: 116 VWSGDKAKTSKSYDLPQTSDVQEVATRAEVSTGVPTLVEGADNNASRVTRNVTFSDKWSG 175

Query: 119 SLRIRGGYEVSDSLLLYATVGPDVAQKYETGK--------------------AGEITPIA 158
           + R+R G    D ++ Y   G   +Q   + +                        +   
Sbjct: 176 ATRVRLGAAF-DRIMPYVAGGVAYSQLKASVENAKASGAQKAEGTSVEKPLEGLSDSKTM 234

Query: 159 IGGTAGVGVEVGGLSESLVARLEYRASKYSK---------VEGFYNTISLGVGMKF 205
           +G T G GV+   ++++++ R EYR S + K         V+   N   +GV  KF
Sbjct: 235 VGYTLGAGVDF-AMTDTVMLRAEYRYSDFGKKTFVKDKVEVDLKTNDFRVGVAYKF 289


>gi|296448558|ref|ZP_06890432.1| TonB-dependent receptor [Methylosinus trichosporium OB3b]
 gi|296253924|gb|EFH01077.1| TonB-dependent receptor [Methylosinus trichosporium OB3b]
          Length = 482

 Score =  102 bits (253), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 41/204 (20%), Positives = 68/204 (33%), Gaps = 35/204 (17%)

Query: 11  SSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSFGE 70
           +    A+   A  A  +  +    +   P          R+D+ G Y G    +      
Sbjct: 254 AKFPSAAGAPAFLASALPSSDLPSKKGPPG--------SRYDWRGVYVGFDVGHAWGHDR 305

Query: 71  EAHH---------------NAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLA------DN 109
              +                  G + AGYN + + ++ GVE +   T             
Sbjct: 306 FVPYYSVPNVGAPQSFDLTGVIGGLHAGYNWQLASVVLGVETEFDATSLNRTVQQDAVTT 365

Query: 110 IHSLHGIGGSLRIRGGYEVSDSLLLYATVG--PDVAQKY--ETGKAGEITPIAIGGTAGV 165
           + S   + GS+R R G+   D LL++ T G      Q      G     +        G 
Sbjct: 366 LRSSSALQGSIRARFGWAF-DRLLVFGTGGSQWAGVQNAYHIRGLGDSYSTNHHSWVVGG 424

Query: 166 GVEVGGLSESLVARLEYRASKYSK 189
           G+E   L++  + R EYR S + K
Sbjct: 425 GIEY-ALTDHWLGRAEYRFSDFGK 447


>gi|49473903|ref|YP_031945.1| hemin binding protein c [Bartonella quintana str. Toulouse]
 gi|21689903|gb|AAM68128.1| hemin-binding protein C [Bartonella quintana]
 gi|49239406|emb|CAF25744.1| Hemin binding protein c [Bartonella quintana str. Toulouse]
          Length = 277

 Score =  101 bits (252), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 52/287 (18%), Positives = 83/287 (28%), Gaps = 94/287 (32%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+ L  A   S+ A  S  + QAAD V           P       V     + G Y G 
Sbjct: 3   MKWLITA---SAFAFVSASTVQAADVV-----VPPRSTPIAPVI--VAPTFSWTGFYIGG 52

Query: 61  SAL-----------YNGSFGEEAHH------NAGGSIFAGYNVEDSC-IMYGVEGDVRYT 102
                          NG                 G I+ G NV+    ++ GV+ D+ ++
Sbjct: 53  QIGGFSSKTKMNILANGKTFPVKDDLLPKLSGFMGGIYVGSNVDLGNGLILGVDTDIIWS 112

Query: 103 VPVLADNIHS---------------------------------------LHGIGGSLRIR 123
                                                                 G+ R+R
Sbjct: 113 DKKYTKTGKVYEITEQHIPYIKKMLTEAGIAISNNDLKPGAKRVHSFTFKEKWAGATRVR 172

Query: 124 GGYEVSDSLLLYATVGPDVAQKYE----------------TGKAGEITPIAIGGTAGVGV 167
            G+  ++ ++ Y   G    Q  +                +G   + T   +G T G GV
Sbjct: 173 IGFA-AERIMPYVAGGIAYTQLQDIGSISIKNKDSSKVIASGNLSDETKTFVGYTLGAGV 231

Query: 168 EVGGLSESLVARLEYRASKYSKVEGFY---------NTISLGVGMKF 205
           +   ++ ++V R EYR S + K +            N   +GV  KF
Sbjct: 232 D-LAMTNNVVVRAEYRYSDFGKKKFTKGQLETSYKTNDFRVGVAYKF 277


>gi|49475067|ref|YP_033108.1| hemin binding protein a [Bartonella henselae str. Houston-1]
 gi|2150037|gb|AAC39274.1| Pap31 [Bartonella henselae phage 60457]
 gi|49237872|emb|CAF27068.1| Hemin binding protein a [Bartonella henselae str. Houston-1]
          Length = 279

 Score =  101 bits (251), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 53/287 (18%), Positives = 86/287 (29%), Gaps = 95/287 (33%)

Query: 4   LFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSAL 63
           +   +  S +AL S  +AQAAD +         V   +A          + G Y G    
Sbjct: 3   IKSLMTTSVIALISASAAQAADVI---------VPHEVAPTVISAPAFSWTGFYIGGQVG 53

Query: 64  YNGSFGEEAH----------------HNAGGSIFAGYNVEDSC-IMYGVEGDVRYTV--- 103
              S  E                       G I+AG N++    ++ GVE D  +     
Sbjct: 54  NFSSKVEITDPNKKDKLFSKDDTPKPSGFMGGIYAGSNMDLGNNMILGVETDAVWADRED 113

Query: 104 ----------------------------------------PVLADNIHSLHGIGGSLRIR 123
                                                       D++       G+ R+R
Sbjct: 114 AKTSSAEAIGQDELETFRDSLKKANAAFAQGKTSDNVAAVDKHTDSLALKEKWSGATRVR 173

Query: 124 GGYEVSDSLLLYATVGP------DVAQKYETGKAGE----------ITPIAIGGTAGVGV 167
            G+  +D ++ Y   G        V+    T  A +           T   +G T G GV
Sbjct: 174 IGFTAADRIMPYVAGGVSYAQVQAVSSTKVTQAADDAEIATAQLFDKTKTLVGFTLGGGV 233

Query: 168 EVGGLSESLVARLEYRASKYSKV---------EGFYNTISLGVGMKF 205
           +   ++++++ R EYR S + K              N   +GV  KF
Sbjct: 234 DF-AMTDNVLLRAEYRYSDFGKKKFEKEGSEFSYKTNDFRVGVAYKF 279


>gi|312112850|ref|YP_004010446.1| outer membrane protein [Rhodomicrobium vannielii ATCC 17100]
 gi|311217979|gb|ADP69347.1| outer membrane protein [Rhodomicrobium vannielii ATCC 17100]
          Length = 233

 Score =  101 bits (251), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 45/201 (22%), Positives = 74/201 (36%), Gaps = 21/201 (10%)

Query: 2   QKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLS 61
           + L+LA+  +++ +     A AAD  R          P I           + G Y G++
Sbjct: 7   RSLYLAIIGAAVTVPL--GANAADMYRAPAPTTYAPPPPIVQPN------TWAGFYVGIN 58

Query: 62  ALYNGSFGEEAHHNAG----GSIFAGYNVEDSCIMYGVEGDV---RYTVPVLADNIHSLH 114
             Y     +++         G    GYN +    +YG+E D+   R T            
Sbjct: 59  GGYGWGASDDSTRGDVNGGFGGGQIGYNFQSGNFVYGLETDLQAGRITGKSDDYASKETT 118

Query: 115 GIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGE----ITPIAIGGTAGVGVEVG 170
              G+LR R GY   ++ LLY T G       +     +          G TAG G+E  
Sbjct: 119 DWFGTLRGRLGYAFGNT-LLYGTGGFAYGGVNQKMNYADVLFSNDDTRTGWTAGAGIEY- 176

Query: 171 GLSESLVARLEYRASKYSKVE 191
            +S +   + EY+   + K +
Sbjct: 177 KVSGNWSLKGEYQYVDFGKED 197


>gi|163867545|ref|YP_001608744.1| hemin binding protein C [Bartonella tribocorum CIP 105476]
 gi|161017191|emb|CAK00749.1| hemin binding protein C [Bartonella tribocorum CIP 105476]
          Length = 277

 Score =  100 bits (250), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 51/289 (17%), Positives = 87/289 (30%), Gaps = 98/289 (33%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+ L  A   S+ A  S  +AQAAD +           PT      V     + G Y G 
Sbjct: 3   MKWLITA---SAFAFVSVSAAQAADVI-------VPPSPTPVAPVIVAPTFSWTGFYFGG 52

Query: 61  SALYNGSFGEEAHH-------------------NAGGSIFAGYNVEDSC-IMYGVEGDVR 100
                G  G+                          G ++AG N++    ++ GV+ D+ 
Sbjct: 53  QIG--GFSGKTKMDILAKGQKIPVSDDYLPKLSGFMGGLYAGSNIDLGNGLILGVDTDIM 110

Query: 101 YT--VPVLADNIHS-------------------------------------LHGIGGSLR 121
           ++          +                                           G+ R
Sbjct: 111 WSNKDDTKTGKTYVIAPGHINYINKILKDAAINIGKDALEAGAKRTHSFTFKEKWAGATR 170

Query: 122 IRGGYEVSDSLLLYATVGPDVAQKYE----------------TGKAGEITPIAIGGTAGV 165
           +R G+  ++ ++ Y   G    Q  +                +G   + T   +G T G 
Sbjct: 171 VRIGFA-AERIMPYVAGGIAYTQLQDTASISITEKDSDKVIASGTLSDETKTLVGYTLGA 229

Query: 166 GVEVGGLSESLVARLEYRASKYSKV---------EGFYNTISLGVGMKF 205
           GV+   ++ +++ R EYR S + K              N   +GV  KF
Sbjct: 230 GVD-LAMTNNIIVRAEYRYSDFGKKKFSNDKYETSYKTNDFRVGVAYKF 277


>gi|146343868|ref|YP_001208916.1| putative outer membrane protein [Bradyrhizobium sp. ORS278]
 gi|146196674|emb|CAL80701.1| putative outer membrane protein precursor [Bradyrhizobium sp.
           ORS278]
          Length = 278

 Score =  100 bits (249), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 49/248 (19%), Positives = 73/248 (29%), Gaps = 67/248 (27%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+ L  AV   SL +AS  S  AAD             P  A        +++ G Y G 
Sbjct: 6   MKTLASAV---SLLIASSLSTFAADL----SARYTKAPPPAAI-------YNWTGGYFGG 51

Query: 61  SALYNGSFGEEAHH-----------------------------NAGGSIFAGYNVEDSCI 91
           +  Y                                          G + AGYN +    
Sbjct: 52  NIGYGWGRSNLGTTLDQTSSWATEPVPFQNQFVAISNNRLNPSGVVGGLQAGYNWQAGPS 111

Query: 92  MYGVEGDVRYTVPVL-------------ADNIHSLHGIGGSLRIRGGYEVSDSLLLYATV 138
           ++G+E D+  +                   N    +    +LR R GY + D+ LLY T 
Sbjct: 112 VFGIEADINGSGVNKRVVYTGVNVPTTRTFNESIRNDWFMTLRGRAGYAI-DTTLLYVTG 170

Query: 139 GPDVAQKYET---------GKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSK 189
           G  V     +          K G       G T G GVE    + +   + EY  +    
Sbjct: 171 GLAVGNVKGSWDLTSGNGYNKTGSADQTRAGWTIGAGVE-HAFAPNWTVKAEYLYTDLGS 229

Query: 190 VEGFYNTI 197
           +      +
Sbjct: 230 INYTSGYV 237


>gi|150395644|ref|YP_001326111.1| porin [Sinorhizobium medicae WSM419]
 gi|150027159|gb|ABR59276.1| porin [Sinorhizobium medicae WSM419]
          Length = 225

 Score =  100 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 54/240 (22%), Positives = 84/240 (35%), Gaps = 50/240 (20%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M++ FL+   ++    +     AAD                      P   D+NG Y G 
Sbjct: 1   MKRYFLS---AAFLAGALSPVVAADL----------APVESPPAISAPAAFDWNGFYLGG 47

Query: 61  SALYNGS--------FGEEAHHN---AGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLAD- 108
           +     +        FGE AHH+     G + AGYN +    + G E D   +       
Sbjct: 48  NVGGGRADVDWTYQPFGETAHHDGKGFLGGVQAGYNWQIDGFVIGAEADFLGSSIDGDTP 107

Query: 109 ------NIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIA---- 158
                 +  S      ++R R GY   D+LL+YAT G  + +       G  T  +    
Sbjct: 108 CPNPAYSCTSDTKWLSTVRARAGYSF-DNLLVYATGGLGIGRFEIKTDDGAGTSGSTIRN 166

Query: 159 -IGGTAGVGVEVGGLSESLVARLEYRASKYS------------KVEGFYNTISLGVGMKF 205
             G  AG GVE  G S +   + EY    +               +  ++T  +GV  +F
Sbjct: 167 DTGWVAGAGVEY-GFSPNWSIKAEYMHHDFGERTYTVDGGNPVDADFRFDTGKIGVNYRF 225


>gi|158425586|ref|YP_001526878.1| outer membrane protein, 31 kDa precursor [Azorhizobium caulinodans
           ORS 571]
 gi|158332475|dbj|BAF89960.1| outer membrane protein, 31 kDa precursor [Azorhizobium caulinodans
           ORS 571]
          Length = 232

 Score = 99.7 bits (247), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 44/211 (20%), Positives = 68/211 (32%), Gaps = 38/211 (18%)

Query: 6   LAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYN 65
              GVS+LAL    +A AAD   +           +     V     + G Y G +  Y 
Sbjct: 5   ALAGVSALALLGCGAASAADLATK---------YPVKAIAPVVPVFSWTGFYIGANVGYA 55

Query: 66  GSFGEEA---------------HHNAGGSIFAGYNVED-SCIMYGVEGDVRY-------- 101
               +                   +  G    GYN +  + ++ G+E D+ +        
Sbjct: 56  WGSTDFHGNTRTGLPYSYSVGGQDDWLGGGQIGYNYQFANNVVVGIEADIDWTGIGSSGV 115

Query: 102 --TVPVLADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQK-YETGKAGEITPIA 158
               P+    I+      G++R R GY   D  L Y T G       Y        +   
Sbjct: 116 AVNGPLAGQTINGSLDYFGTVRARLGYAF-DKFLPYITGGAAWGHVDYGNIYGVGTSSTN 174

Query: 159 IGGTAGVGVEVGGLSESLVARLEYRASKYSK 189
            G T G G E   ++ ++ A LEY       
Sbjct: 175 WGWTIGAGFEY-AVTNNITAGLEYLYVDLGG 204


>gi|83308753|emb|CAJ01663.1| putative outer-membrane immunogenic protein precursor [Methylocapsa
           acidiphila]
          Length = 282

 Score = 99.7 bits (247), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 53/249 (21%), Positives = 77/249 (30%), Gaps = 70/249 (28%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+     +  S+ A+A   SA AAD   RA          I           + G Y G 
Sbjct: 1   MRTF---LLASAGAVALAGSAFAADLPSRAPPPAYVPPAPI---------FTWTGVYIGG 48

Query: 61  SALYNGSFGEEAHHNAG------------------------GSIFAGYNVEDSCIMYGVE 96
              Y  +     + +AG                        G    GYN++    + G+E
Sbjct: 49  QIGYAWTNPNVTYGDAGYTVGGFPLGYADSYNVGGNANGVIGGAHVGYNLQLGQWVLGLE 108

Query: 97  GDVR---------------YTVPVLADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPD 141
           GDV                Y    +    HS  GI GS+R R G    D  LLYAT G  
Sbjct: 109 GDVDGSSISKTVSVSPYSSYYADYIPTTFHSNLGIQGSIRGRVGIAW-DRALLYATGGVA 167

Query: 142 VAQ-----------------KYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRA 184
                                +        +   +G T G G+E   ++ +   R EYR 
Sbjct: 168 FGGFTSYVSTSYANPQGILSNFPFSGNDSFSQTRVGWTVGGGLEY-AITNNWSVRGEYRY 226

Query: 185 SKYSKVEGF 193
           + +     +
Sbjct: 227 TDFGHTSNY 235


>gi|49475276|ref|YP_033317.1| hemin binding protein d [Bartonella henselae str. Houston-1]
 gi|49238082|emb|CAF27289.1| Hemin binding protein d [Bartonella henselae str. Houston-1]
          Length = 274

 Score = 99.7 bits (247), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 45/267 (16%), Positives = 75/267 (28%), Gaps = 94/267 (35%)

Query: 21  AQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSAL---------YNGS---- 67
           AQAAD +          VP             + G Y G             Y G     
Sbjct: 20  AQAADVI----------VPEQPVPVVAVPAFSWAGFYLGGQVGNFSSKTALSYLGDEKTG 69

Query: 68  -FGEEAH------HNAGGSIFAGYNVEDSC-IMYGVEGDVRYTVPVLADNIH-------- 111
            +               G I+AG N + +   + G++ DV ++       I         
Sbjct: 70  KWTPVKKEFVPKLSGFVGGIYAGSNFDINNGFIIGIDTDVMWSGKKNTKIITWPEVPPEV 129

Query: 112 -----------------------------SLHGIGGSLRIRGGYEVSDSLLLYATVGPDV 142
                                              G+ R++ G+ V D ++ Y   G   
Sbjct: 130 SSEKKVERVSVGTNQDTSAEVTNGALSHTLKQKWFGATRVKVGF-VVDRMMPYIAGGVAY 188

Query: 143 AQKY---------------ETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKY 187
            Q                  +    +     +G T G G++   ++++++ R EYR S Y
Sbjct: 189 TQLQNIFEKEADKTKKAIDISNVIHDEKKTMVGYTLGGGIDF-AMTDNVIVRAEYRYSDY 247

Query: 188 SKVEGFY---------NTISLGVGMKF 205
            K +            N   +GV  KF
Sbjct: 248 GKKKFADEKIEMRYKTNDFRVGVAYKF 274


>gi|163867925|ref|YP_001609129.1| hemin binding protein D [Bartonella tribocorum CIP 105476]
 gi|161017576|emb|CAK01134.1| hemin binding protein D [Bartonella tribocorum CIP 105476]
          Length = 279

 Score = 99.7 bits (247), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 46/287 (16%), Positives = 81/287 (28%), Gaps = 101/287 (35%)

Query: 7   AVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNG 66
            +  S  +L S    QAAD V          V              + G Y G     N 
Sbjct: 6   LISTSIFSLISISVLQAADIV----------VSEQPVPVITVPSFSWTGFYLGGQIG-NF 54

Query: 67  SFGEEAHH--------------------NAGGSIFAGYNVEDSC-IMYGVEGDVRYTVPV 105
           S    A++                       G ++AG N++     + G++ DV ++   
Sbjct: 55  SGKTTANYLTKETGIWNPVEKEYLPKLSGFMGGVYAGSNIDIDNGFIIGIDTDVMWSNKK 114

Query: 106 LADNI-------------------------------------HSLHGIGGSLRIRGGYEV 128
              +I                                            G+ R++ G+  
Sbjct: 115 STKDILLPKKDETGEKKSLEKTSHTRDSHEDASTTLVEGVSHTLKQKWSGATRVKVGFAF 174

Query: 129 SDSLLLYATVGPDVAQKYETGKAG---------------------EITPIAIGGTAGVGV 167
              ++ Y + G    Q      A                      +     IG T G GV
Sbjct: 175 E-RMMPYVSGGIAYTQLQNILSAVVDSATVADSESRAIDSSDWLHDEKKTMIGYTLGGGV 233

Query: 168 EVGGLSESLVARLEYRASKYSKVEGFYNTI---------SLGVGMKF 205
           +   ++++++ R EYR S + K +   + +          +GV  KF
Sbjct: 234 DF-AMTDNVIVRAEYRYSDFGKKKFVQDKVEMSYKTNDFRVGVAYKF 279


>gi|146342874|ref|YP_001207922.1| putative outer membrane protein [Bradyrhizobium sp. ORS278]
 gi|146195680|emb|CAL79707.1| putative outer membrane protein precursor [Bradyrhizobium sp.
           ORS278]
          Length = 214

 Score = 99.0 bits (245), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 49/175 (28%), Positives = 74/175 (42%), Gaps = 13/175 (7%)

Query: 17  SFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSF-GEEAHHN 75
              SAQAAD        GRG   T+         + + GPY G +  Y     G  A   
Sbjct: 20  GSGSAQAADLGY---GYGRGAPYTVNQPLN---AYSWAGPYLGGTLGYQWGTVGNSATKP 73

Query: 76  AG--GSIFAGYNVEDSC-IMYGVEGDVRYTVPVLADNI-HSLHGIGGSLRIRGGYEVSDS 131
           +G  G + AGYN ++    + G+EGD+  +            +   G+LR R GY   ++
Sbjct: 74  SGLVGGVTAGYNWQNGSPWVLGIEGDINLSGANDTFAPWKFSNPWFGTLRGRVGYAF-NN 132

Query: 132 LLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASK 186
           +L Y T G  +            +  A+G T GVG E  GL+++  A++EY    
Sbjct: 133 ILFYGTGGLALGGLRAETFGLSESHTAVGWTLGVGTEF-GLAQNWTAKIEYLYVD 186


>gi|27378846|ref|NP_770375.1| outer-membrane immunogenic protein [Bradyrhizobium japonicum USDA
           110]
 gi|27351995|dbj|BAC49000.1| bll3735 [Bradyrhizobium japonicum USDA 110]
          Length = 223

 Score = 98.6 bits (244), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 51/216 (23%), Positives = 81/216 (37%), Gaps = 29/216 (13%)

Query: 12  SLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSFGEE 71
           ++    F +  AA     A    R   P  A     P+ + + G YAG +A Y  S G++
Sbjct: 11  TMCALPFAAVFAAGSACAADLSPRYAAPASAYTAPQPV-YSWTGLYAGFNAGYAES-GDD 68

Query: 72  AHHNAGGSIFA-----------GYNVE-DSCIMYGVEGDVRYTVPVLADNIHSLH---GI 116
           A +N  G+              GYN +     + G+E D         D ++S       
Sbjct: 69  AFNNLAGATGGKVKGAVGGVQIGYNYQLSPMFVVGIENDFEGGDIKNHDALNSAAVSLPW 128

Query: 117 GGSLRIRGGYE-VSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSES 175
             + R R G   +   LL + T G    +  +    G I  + +G TAG GVE   L   
Sbjct: 129 YMTGRARAGIATMDSRLLFFGTAGLAAGEFKD----GPINKMKMGWTAGGGVEWAFL-PK 183

Query: 176 LVARLEYRASKYSKVEGFY------NTISLGVGMKF 205
             A+ EY  +++   +         +T  +GV   F
Sbjct: 184 WSAKAEYLYTEFKHDDLPDWNAAKFHTFRVGVNYHF 219


>gi|75674930|ref|YP_317351.1| outer membrane protein [Nitrobacter winogradskyi Nb-255]
 gi|74419800|gb|ABA03999.1| possible outer membrane protein [Nitrobacter winogradskyi Nb-255]
          Length = 209

 Score = 98.2 bits (243), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 41/210 (19%), Positives = 79/210 (37%), Gaps = 23/210 (10%)

Query: 4   LFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSAL 63
           +   + +++  L S  +A AAD   R +      VP           +++ G Y G    
Sbjct: 1   MKKILLITAAVLVSVPAASAADLAPRPYTKAPPYVPA--------PIYNWTGFYLGGHIG 52

Query: 64  YNGSFGEEAHHNAGGSIFAGYNVED-SCIMYGVEGDVRYTVPVLADNIHSLHGIGGSLRI 122
             G+F         G + +G++++     ++G+EG    +   L   I   +   GS   
Sbjct: 53  --GAFSNGRDGVFLGGVQSGWDLQFAPNWVFGLEG----SYSFLDSGIAGANLGLGSATA 106

Query: 123 RGGYEVSDSLLLYATVGP--DVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARL 180
           R GY      L Y   G    V +               G T G G+E    +++   ++
Sbjct: 107 RLGYTWGGPALFYVKGGYGTAVLRGNNAIFGINPNIGLDGYTVGAGLEY-MFTQNWAGKV 165

Query: 181 EYRASKYSKVEGFY-----NTISLGVGMKF 205
           EY+   + ++ G       +T+ +G+  +F
Sbjct: 166 EYQYFDFGRIAGTNINLDTHTVKVGLNYRF 195


>gi|154246285|ref|YP_001417243.1| porin [Xanthobacter autotrophicus Py2]
 gi|154160370|gb|ABS67586.1| porin [Xanthobacter autotrophicus Py2]
          Length = 207

 Score = 97.8 bits (242), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 37/161 (22%), Positives = 52/161 (32%), Gaps = 7/161 (4%)

Query: 31  HHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSFGEEAH-HNAGGSIFAGYNVEDS 89
              GR   P             + G Y G +A Y       +      G   AGYN + +
Sbjct: 25  DLSGRYPAPYAQPYVQPVAAFTWTGFYIGANAGYGWGSTVNSDPGGFIGGFQAGYNYQFA 84

Query: 90  C-IMYGVEGDVRYTVPVLADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYET 148
              + GVE D  ++               G++R R G+   D +L+Y T G    Q    
Sbjct: 85  SPFVLGVETDFNFSGLSAGG---YSLDYLGTVRARLGWSF-DRVLVYGTGGFAYGQGSLD 140

Query: 149 GKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSK 189
                 +    G T G G EV     +  AR EY       
Sbjct: 141 VLGLSSSSTQTGWTIGAGAEV-AFDRNWSARAEYLYVDLGS 180


>gi|298292293|ref|YP_003694232.1| porin [Starkeya novella DSM 506]
 gi|296928804|gb|ADH89613.1| porin [Starkeya novella DSM 506]
          Length = 257

 Score = 97.8 bits (242), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 46/232 (19%), Positives = 72/232 (31%), Gaps = 67/232 (28%)

Query: 39  PTIATNRYVPIRHDFNGPYAGLSALYNGSFGE--------------EAHHNAG------- 77
           P  A    V     + G Y G +A Y    G               + +  +G       
Sbjct: 28  PVKAPPMMVVPAFTWTGLYLGGNAGYGWGEGSAPWLGYLDYYYGALDQYGYSGGSDPQGW 87

Query: 78  -GSIFAGYNVE-DSCIMYGVEGDVRYTVPVLA-----------------DNIHSLHGIGG 118
            G +  GYN + D+ ++ G+E D ++     +                   I +     G
Sbjct: 88  FGGVQVGYNYQFDNNVVLGIEADAQFGELKDSLSYYGTDLFSGVPDLDLGGIETKIEAFG 147

Query: 119 SLRIRGGYEVSDSLLLYATVGPDVAQKYET---------------GKAGEITPIAIGGTA 163
           ++R R GY V D LL Y T G        +                          G T 
Sbjct: 148 TVRARLGYAV-DRLLPYVTGGLAWGNVKMSERWDTYMGGVFQPGLTGTASADETLWGWTV 206

Query: 164 GVGVEVGGLSESLVARLEYRASKYS----------KVEGFYNTISLGVGMKF 205
           G GVE    +++   + EY  +             KV+    T+ LG+  KF
Sbjct: 207 GGGVEY-AFTDNWTVKAEYLYADLGDINWDGDAGTKVDVKLQTVKLGINYKF 257


>gi|49475066|ref|YP_033107.1| hemin binding protein c [Bartonella henselae str. Houston-1]
 gi|49237871|emb|CAF27067.1| Hemin binding protein c [Bartonella henselae str. Houston-1]
          Length = 276

 Score = 97.8 bits (242), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 49/283 (17%), Positives = 82/283 (28%), Gaps = 98/283 (34%)

Query: 9   GVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSF 68
            +++ A      AQAAD V           PT      V     + G Y G      G F
Sbjct: 6   LITASAFTFVSVAQAADIV-------VPPSPTPVAPVIVAPTFSWTGFYIGGQI---GGF 55

Query: 69  GEEAH--------------------HNAGGSIFAGYNVEDSC-IMYGVEGDVRYTVPVLA 107
             +                          G ++AG NV+    ++ GV+ D+ +T     
Sbjct: 56  SSKTKMDILSKGKTIPVSDDFLPKLSGFMGGLYAGSNVDLGNGLILGVDTDIIWTDKDDT 115

Query: 108 DNI----------------------------------------HSLHGIGGSLRIRGGYE 127
             +                                               G+ R+R G+ 
Sbjct: 116 KTVPPYEIAENHVNYVNKMLKDAGINIGDNKLEAGKYTRALGFTFKEKWAGATRVRIGFA 175

Query: 128 VSDSLLLYATVGPDVAQKYE----------------TGKAGEITPIAIGGTAGVGVEVGG 171
            ++ ++ Y   G    Q  +                +G   + T   +G T G GV+   
Sbjct: 176 -AERIMPYVAGGIAYTQLQDITSISITKKETGKVIASGNLSDETKTLVGYTLGAGVD-LA 233

Query: 172 LSESLVARLEYRASKYSKV---------EGFYNTISLGVGMKF 205
           ++ +++ R EYR S + K              N   +GV  KF
Sbjct: 234 MTNNVIVRAEYRYSDFGKKKFSNDKYETSYKTNDFRVGVAYKF 276


>gi|312115998|ref|YP_004013594.1| porin [Rhodomicrobium vannielii ATCC 17100]
 gi|311221127|gb|ADP72495.1| porin [Rhodomicrobium vannielii ATCC 17100]
          Length = 203

 Score = 97.8 bits (242), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 50/212 (23%), Positives = 85/212 (40%), Gaps = 25/212 (11%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+ L    G++  ++ +  SA +AD  R    G +           V     + G YAGL
Sbjct: 1   MKLLSGIAGLTLASVVAIASANSADLYRGQAGGYKDGP-------IVAPVATWTGFYAGL 53

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVE----DSCIMYGVEGDVRYTVPVLADNIHSLHGI 116
           +  Y  +   +A     G    GYN +     S ++ GVE D++ +     ++       
Sbjct: 54  NVGYGWNDDADA-DGIIGGGQIGYNWQGAFGTSPLVLGVETDIQGSDIKNDNDD--KLNY 110

Query: 117 GGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESL 176
            G++R R GY + +S L+YAT G    +             + G T G GVE    + +L
Sbjct: 111 FGTVRGRLGYALGNS-LVYATGGFAYGE------FDGADKTSTGYTVGGGVE-HKFTPNL 162

Query: 177 VARLEYRASKYSKVEGFY---NTISLGVGMKF 205
             + EY  +     +      NT+ +G+   F
Sbjct: 163 SVKAEYLYTDLGDNDSDNADFNTVRVGLNYHF 194


>gi|319898374|ref|YP_004158467.1| Pap31 [Bartonella clarridgeiae 73]
 gi|319402338|emb|CBI75877.1| Pap31 [Bartonella clarridgeiae 73]
          Length = 292

 Score = 97.0 bits (240), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 50/301 (16%), Positives = 86/301 (28%), Gaps = 110/301 (36%)

Query: 4   LFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSAL 63
           +   +  S +AL +  +AQAAD       G   V         V     + G Y G    
Sbjct: 3   MKCLMTASVVALMTAYAAQAADITVPQETGETIV---------VAPAFSWTGFYVGGQIG 53

Query: 64  -------YNGSFGEEAHH-------------NAGGSIFAGYNVEDSC-IMYGVEGDVRYT 102
                  ++   G+++                  G  + G NV+    ++ GV+ DV ++
Sbjct: 54  GFSSKTSFSSRDGDDSKKWLPLHKDLWSKPSGFTGGFYTGSNVDLGNGLILGVDTDVIWS 113

Query: 103 VPVLADNIHS-----------------------------------------LHGIGGSLR 121
                                                                   G+ R
Sbjct: 114 GRKDEKTHEVTVELEDKDKNKHQEKSVSRSPVVFADGEEKEVEITKYGHTLKEKWAGATR 173

Query: 122 IRGGYEVSDSLLLYATVGPDVAQKYETGKAG----------------------------E 153
           IR G+  +D ++ Y   G    Q  ++                                +
Sbjct: 174 IRIGFA-ADRIMPYVAGGVAYTQLQDSFSTSVSRQKVSGAKAERADKEPSAEPNTVNTVD 232

Query: 154 ITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFY---------NTISLGVGMK 204
            +   IG T G GV+   +++++V R EYR S + K +            N   +GV  K
Sbjct: 233 ESKTMIGYTLGAGVDF-AMTDNVVLRAEYRYSDFGKKKLHNDKLEVNYKANDFRVGVAYK 291

Query: 205 F 205
           F
Sbjct: 292 F 292


>gi|22852215|dbj|BAC16222.1| hypothetical protein [Bartonella henselae]
          Length = 265

 Score = 97.0 bits (240), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 48/258 (18%), Positives = 79/258 (30%), Gaps = 92/258 (35%)

Query: 11  SSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSFGE 70
           S +AL S  +AQAAD +         V   +A          + G Y G      G+F  
Sbjct: 2   SVIALISASAAQAADVI---------VPHEVAPTVISAPAFSWTGFYIGGQV---GNFSS 49

Query: 71  EAH-------------------HNAGGSIFAGYNVEDSC-IMYGVEGDVRYTVP------ 104
           +                         G I+AG N+     ++ GVE D  +         
Sbjct: 50  KVEITDPNKKDKLFSKDDTPKPSGFMGGIYAGSNMSLGNNMILGVETDAVWADREDAKTS 109

Query: 105 -------------------------------------VLADNIHSLHGIGGSLRIRGGYE 127
                                                   D++       G+ R+R G+ 
Sbjct: 110 SAKVIREDELANFKDSLKNANAVFAKDKTMDDVKQDEKHTDSLALKEKWSGATRVRIGFT 169

Query: 128 VSDSLLLYATVGP------DVAQKYETGKAGE----------ITPIAIGGTAGVGVEVGG 171
            +D ++ Y   G        V+    T  A +           T   +G T G GV+   
Sbjct: 170 AADRIMPYVAGGVSYAQVQAVSSTKVTQAADDAEIASAQLFDKTKTLVGFTLGGGVDF-A 228

Query: 172 LSESLVARLEYRASKYSK 189
           ++++++ R EYR S + K
Sbjct: 229 MTDNVLLRAEYRYSDFGK 246


>gi|240851183|ref|YP_002972586.1| hemin binding protein C [Bartonella grahamii as4aup]
 gi|240268306|gb|ACS51894.1| hemin binding protein C [Bartonella grahamii as4aup]
          Length = 296

 Score = 97.0 bits (240), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 44/299 (14%), Positives = 86/299 (28%), Gaps = 97/299 (32%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPV---RRAHHGGRGVVPTIA-TNRYVPIRHDFNGP 56
           M+     + +S     +  +AQAAD V   +           +   T   V     ++G 
Sbjct: 1   MKT-KCLIALSIFTFITTSTAQAADTVIFEQSKPKVSLQNDSSSRITPVTVSAPFSWSGF 59

Query: 57  YAGLSALY--------------NGSF-GEEAH-----HNAGGSIFAGYNVEDSC-IMYGV 95
           Y G    Y              +G +   + +           ++AG N++    +++G 
Sbjct: 60  YFGGQIGYFSSKNTLDYAQEARDGKWAWVDRNLSPKPSGLRAGLYAGSNIDLGDDLVFGF 119

Query: 96  EGDVRYTVPVLADNIHSL------------------------------------------ 113
           + D+ ++        +                                            
Sbjct: 120 DTDIVWSGRKSTQTDNGKKILNELDSINIAFKEAGIPIIKPAAQDETIPNYGDIVVSSVT 179

Query: 114 --HGIGGSLRIRGGYEVSDSLLLYATVGPDVAQ----------------KYETGKAGEIT 155
                 G+ R R G+  S  L+ Y   G    Q                 + +G   + T
Sbjct: 180 LKEKWSGAARARIGFA-SHRLMPYIAGGIAYTQMQYIMSLLSKSQEDSTVFASGNVLDKT 238

Query: 156 PIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKV---------EGFYNTISLGVGMKF 205
               G T G G +   ++++++ R EYR S + K              + +  G+  KF
Sbjct: 239 KTLFGYTVGGGFD-LAMTDNIIMRTEYRYSDFFKKKFANDDLKISSQTHDVRFGIAYKF 296


>gi|254470997|ref|ZP_05084400.1| outer membrane protein [Pseudovibrio sp. JE062]
 gi|211960139|gb|EEA95336.1| outer membrane protein [Pseudovibrio sp. JE062]
          Length = 201

 Score = 96.6 bits (239), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 47/192 (24%), Positives = 77/192 (40%), Gaps = 25/192 (13%)

Query: 37  VVPTIATNRYVPIRHDFNGPYAGLSALYNGSFGEEAHHNAGG------SIFAGYNVEDSC 90
             P +A    +     ++G Y GL   +    G++   + G         F GYN     
Sbjct: 12  SFPCVAFADDMSSVGKWDGFYLGLKGGFGQLTGKDTLGSKGTLDSGVVGAFGGYNHSFDR 71

Query: 91  IMYGVEGDV---RYTVPVLADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYE 147
           I+ GVE D+    YT    +    S      S  +R GY+ +   L Y + G  +A+   
Sbjct: 72  IVVGVEADLNATNYTSVSDSGVSRSRSKWNTSATVRLGYD-AGMFLPYLSAGVGLAEYEV 130

Query: 148 TGKAG--EITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSK------------VEGF 193
              A   +     IG   G G+E   ++E++ ARL+Y+  + SK            +EG 
Sbjct: 131 KRFADGQKSENTHIGLVVGAGLEA-MITENVSARLDYKHMEMSKEKYKFQGFNAFHIEGR 189

Query: 194 YNTISLGVGMKF 205
            + ++LGV   F
Sbjct: 190 QDLVTLGVAYNF 201


>gi|154246089|ref|YP_001417047.1| porin [Xanthobacter autotrophicus Py2]
 gi|154160174|gb|ABS67390.1| porin [Xanthobacter autotrophicus Py2]
          Length = 255

 Score = 96.3 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 37/201 (18%), Positives = 61/201 (30%), Gaps = 46/201 (22%)

Query: 41  IATNRYVPIRHDFNGPYAGLSALYNG-------------SFGEEAHHNAGGSIFA---GY 84
                 V     + G Y G    Y               ++  +A +   G +     GY
Sbjct: 30  PVKAAPVAPAFSWTGFYIGAQGGYAWADNSFSNTHDLYNTYANDASYTLDGGLVGGVIGY 89

Query: 85  NVEDSCIMYGVEGDVRYTVPVLADNI-----------------HSLHGIGGSLRIRGGYE 127
           N + + I+ GVE D  +     + ++                  S     G++  R G  
Sbjct: 90  NYQINNIVLGVEADANWADISGSGSVLRAGELATNCIVSNNPCSSKIDALGTITARLGVA 149

Query: 128 VSDSLLLYATVGPDVAQKYETGK-----------AGEITPIAIGGTAGVGVEVGGLSESL 176
             D +LLYA  G   A    T             +   +    G T G GVE      + 
Sbjct: 150 F-DRVLLYAKGGAAWANVKHTAGSTDYEYPEFSYSASNSNTRWGWTVGAGVEWAFF-NNW 207

Query: 177 VARLEYRASKYSKVEGFYNTI 197
            A++EY        +  +N +
Sbjct: 208 SAKVEYNYIDLGSNDVTFNFV 228


>gi|83308662|emb|CAJ01570.1| outer membrane protein [uncultured bacterium]
          Length = 238

 Score = 96.3 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 40/191 (20%), Positives = 63/191 (32%), Gaps = 38/191 (19%)

Query: 51  HDFNGPYAGLSALY-----------NGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDV 99
             + G Y G    Y            G       +   G    GYN++ +  + G+EGDV
Sbjct: 38  FTWAGLYLGGQIGYGWGTDTLTVFPRGFGTNFTPNGVVGGAHIGYNLQFNQFVAGLEGDV 97

Query: 100 -----RYTVPVLADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYET----GK 150
                  +         +   + GS+R R G    D  LLYAT G + A    +      
Sbjct: 98  EGTSIDSSFSPGGVLYSTRIPVQGSIRGRVGVAF-DRALLYATGGAEFAGFNTSENGFPG 156

Query: 151 AGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEG----------------FY 194
             + +    G T G G+E   ++ +   R EYR + +  +                    
Sbjct: 157 FDQNSTTRTGWTVGGGIEY-AVTGNWSIRAEYRYADFGHLTDPTPFTFGFGSFVIHHETE 215

Query: 195 NTISLGVGMKF 205
           N +  G   KF
Sbjct: 216 NAVRAGFSYKF 226


>gi|217979266|ref|YP_002363413.1| OmpA domain protein transmembrane region-containing protein
           [Methylocella silvestris BL2]
 gi|217504642|gb|ACK52051.1| OmpA domain protein transmembrane region-containing protein
           [Methylocella silvestris BL2]
          Length = 240

 Score = 95.9 bits (237), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 37/168 (22%), Positives = 55/168 (32%), Gaps = 33/168 (19%)

Query: 52  DFNGPYAGLSALYNGSF-------------------GEEAHHNAGGSIFAGYNVEDSCIM 92
            + G Y G    Y                              A G    G N +    +
Sbjct: 32  TWAGFYLGGQVGYGWGSDSGNVTGGFPLSPTIQTASTSTQTQGAIGGAHIGNNWQIQNFV 91

Query: 93  YGVEGDVRYTVPVLADN--------IHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVA- 143
            G+EGDV  T                ++   + G++R R GY + D  LLYAT G     
Sbjct: 92  IGLEGDVNGTTLSKMSTPLFNNLYFPYTQSPVQGTVRGRLGYAL-DRTLLYATGGLAYGW 150

Query: 144 ---QKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYS 188
                   G     +    G T G GVE   ++++   R EYR +++ 
Sbjct: 151 IHNDYNIFGSRSSFSTTKAGWTIGGGVEF-AVNDNWSVRAEYRYTRFG 197


>gi|49474039|ref|YP_032081.1| hemin binding protein d [Bartonella quintana str. Toulouse]
 gi|21689907|gb|AAM68131.1| hemin-binding protein D [Bartonella quintana]
 gi|49239543|emb|CAF25900.1| Hemin binding protein d [Bartonella quintana str. Toulouse]
          Length = 294

 Score = 95.5 bits (236), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 48/300 (16%), Positives = 80/300 (26%), Gaps = 112/300 (37%)

Query: 7   AVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSAL--- 63
            +  S  +L S   AQAAD +          +P    +        + G Y G       
Sbjct: 6   LITTSIFSLISISVAQAADVI----------IPEQPESVVAVPAFSWTGFYLGGQIGNFS 55

Query: 64  ------YNGSFGEE--------------AHHNAGGSIFAGYNVEDSC-IMYGVEGDVRYT 102
                 Y     ++                    G I+ G+N +     + GV+ DV ++
Sbjct: 56  SKVDLNYLRDLRDQEVGKWASVKKELLPKPSGFVGGIYGGFNFDFGKGFVIGVDTDVIWS 115

Query: 103 VPVLADN------------IHSLHGIGGSL------RIRGGYEVSDSL------------ 132
               + N                 G   S          GG E  D +            
Sbjct: 116 NKKESKNFNEPMKRRPEILSEEQAGTSKSGIEIPGTEFPGGVEFPDPVPGPERPPFEYDR 175

Query: 133 -------------------------LLYATVGPDVAQKYETGKAG-------------EI 154
                                    + Y   G    Q   T  A              + 
Sbjct: 176 IIQATLKQKWSGATRVRVGFSGERLMPYIAGGVAYTQIQNTFVAPPNFVVIDFSRFLHDE 235

Query: 155 TPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFYNTI---------SLGVGMKF 205
               +G T G GV+   ++++++ R EYR S + K +   + +          +GV  KF
Sbjct: 236 KKTFVGYTLGGGVDF-AMTDNVIMRAEYRYSDFGKKKFGQDRVEIGYKTNDFRVGVAYKF 294


>gi|319405138|emb|CBI78744.1| Pap31 [Bartonella sp. AR 15-3]
          Length = 278

 Score = 95.5 bits (236), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 49/287 (17%), Positives = 82/287 (28%), Gaps = 96/287 (33%)

Query: 4   LFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSAL 63
           +   +  S +AL +  + QAAD       G   V         V     + G Y G    
Sbjct: 3   IKCLMTASVVALMTASAVQAADITVPQEVGETIV---------VAPAFSWTGFYFGGQIG 53

Query: 64  YNGSFGEEAHHN--------------------AGGSIFAGYNVEDSC-IMYGVEGDVRYT 102
              S    +  +                      G  +AG NV+    ++ GV+ D+  +
Sbjct: 54  GFSSKTSFSSRDAEDLNKWDSLNKALWSKPSGFMGGFYAGSNVDLGNGLILGVDTDIVLS 113

Query: 103 VPVLAD--------------------------------NIHSLHGIGGSLRIRGGYEVSD 130
                                                 N        G+ R+R G+  +D
Sbjct: 114 GQKDTKEHTVAVELKDQNAKQQREEQPENAKEAEITKYNHTLKEKWAGATRVRIGFA-AD 172

Query: 131 SLLLYATVGPDVAQKYET-----------------------GKAGEITPIAIGGTAGVGV 167
            ++ Y   G    Q  +T                           + +   IG T   GV
Sbjct: 173 RIMPYVAGGVAYTQLQDTLETSVSQGKMPVQRNDETETSSQTNTVDESKTMIGYTLAAGV 232

Query: 168 EVGGLSESLVARLEYRASKYSK---------VEGFYNTISLGVGMKF 205
           +   ++++++ R EYR S + K         V    N   +GV  KF
Sbjct: 233 DF-AMTDNVMLRAEYRYSDFGKKKLHNDKLEVSYKANDFRVGVAYKF 278


>gi|319783214|ref|YP_004142690.1| porin [Mesorhizobium ciceri biovar biserrulae WSM1271]
 gi|317169102|gb|ADV12640.1| porin [Mesorhizobium ciceri biovar biserrulae WSM1271]
          Length = 221

 Score = 95.5 bits (236), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 47/211 (22%), Positives = 70/211 (33%), Gaps = 41/211 (19%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M++L   V  +         A AADP                         D+ G YAGL
Sbjct: 1   MRRLM--VASAGFLAVLAVPAFAADPAVDVPM--------------TAPGFDWTGYYAGL 44

Query: 61  SALYNGSFGE-------------EAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYT----- 102
            A Y     +             +      G   AG   +    + G E D+ Y+     
Sbjct: 45  QAGYGWGQSDISVTEGAPFSIAPDIDGGFVGGHVAGL-WQFDQAVLGAEADLNYSSVGGT 103

Query: 103 -VPVLADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAG---EITPIA 158
            V  L     +     GS+  + GY + D LL+Y   G   A    +  AG   + T   
Sbjct: 104 TVSALGSTFGTDIKWFGSVNAKAGYAM-DRLLVYGIGGVAFAGIETSQVAGPAFDSTRTN 162

Query: 159 IGGTAGVGVEVGGLSESLVARLEYRASKYSK 189
           +G T G GV+   L++  V   +YR   +  
Sbjct: 163 VGWTVGAGVDY-ALTDKFVVGAQYRYYDFGS 192


>gi|319406585|emb|CBI80227.1| Hemin binding protein D [Bartonella sp. 1-1C]
          Length = 274

 Score = 95.5 bits (236), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 52/280 (18%), Positives = 90/280 (32%), Gaps = 86/280 (30%)

Query: 4   LFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSAL 63
           +   +   S         QAAD +R         VP I+++        + G Y G    
Sbjct: 3   IKHLLVACSWTFIPVSMVQAADIMRPHQSQSYQPVPVISSSN----NFSWTGFYVGAQIG 58

Query: 64  YNGSFGEEAHH------------------------NAGGSIFAGYNVEDSC-IMYGVEGD 98
             G  GE                               G I+AG NV  +  ++ G++ D
Sbjct: 59  --GFSGEATRSPTQDSVEEDSEGQEFSKIKSPKLSGFIGGIYAGSNVSLNKGLILGIDAD 116

Query: 99  VRYTVPVLADNIHSLH----------------------GIGGSLRIRGGYEVSDSLLLYA 136
           V ++                                     G+ R+R G+ V D ++ Y 
Sbjct: 117 VVWSGKKNTKVFDVQDMNILERSSTDVSSISISHSLQEKWAGATRMRVGFAV-DRVVPYV 175

Query: 137 TVGP----------------DVAQKYETGKAG------EITPIAIGGTAGVGVEVGGLSE 174
           + G                  +AQ      +G      + T I +G + G GV+V  +++
Sbjct: 176 SGGVSYVQLQNVFTAKGLARALAQARSASPSGSETKVLDETKILVGYSVGGGVDV-AMTD 234

Query: 175 SLVARLEYRASKYSKVEGFYNTI---------SLGVGMKF 205
           +++ R EYR S + K +   + +          +GV  KF
Sbjct: 235 NVIMRAEYRYSDFGKKKFAKDNVDLSYKTNDFRVGVAYKF 274


>gi|7514148|pir||JC6528 31K major protein, Pap31 - Bartonella henselae phage
          Length = 281

 Score = 95.5 bits (236), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 53/289 (18%), Positives = 86/289 (29%), Gaps = 97/289 (33%)

Query: 4   LFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNG--PYAGLS 61
           +   +  S +AL S  +AQAAD +         V   +A          + G   Y G  
Sbjct: 3   IKSLMTTSVIALISASAAQAADVI---------VPHEVAPTVISAPAFSWTGTGFYIGGQ 53

Query: 62  ALYNGSFGEEAH----------------HNAGGSIFAGYNVEDSC-IMYGVEGDVRYTV- 103
                S  E                       G I+AG N++    ++ GVE D  +   
Sbjct: 54  VGNFSSKVEITDPNKKDKLFSKDDTPKPSGFMGGIYAGSNMDLGNNMILGVETDAVWADR 113

Query: 104 ------------------------------------------PVLADNIHSLHGIGGSLR 121
                                                         D++       G+ R
Sbjct: 114 EDAKTSSAEAIGQDELETFRDSLKKANAAFAQGKTSDNVAAVDKHTDSLALKEKWSGATR 173

Query: 122 IRGGYEVSDSLLLYATVGP------DVAQKYETGKAGE----------ITPIAIGGTAGV 165
           +R G+  +D ++ Y   G        V+    T  A +           T   +G T G 
Sbjct: 174 VRIGFTAADRIMPYVAGGVSYAQVQAVSSTKVTQAADDAEIATAQLFDKTKTLVGFTLGG 233

Query: 166 GVEVGGLSESLVARLEYRASKYSKV---------EGFYNTISLGVGMKF 205
           GV+   ++++++ R EYR S + K              N   +GV  KF
Sbjct: 234 GVDF-AMTDNVLLRAEYRYSDFGKKKFEKEGSEFSYKTNDFRVGVAYKF 281


>gi|319408048|emb|CBI81702.1| Hemin binding protein C [Bartonella schoenbuchensis R1]
          Length = 296

 Score = 95.1 bits (235), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 50/303 (16%), Positives = 91/303 (30%), Gaps = 110/303 (36%)

Query: 4   LFLAVGVSSLALASFCSAQAAD-PVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLS- 61
           +   +  S  AL S  +AQAAD PV+           T+     V     + G Y G   
Sbjct: 3   MKCVITASIFALVSASAAQAADMPVQERPT-------TVLPQVVVAPAFSWTGFYLGGQI 55

Query: 62  ALYNGSFGEEAHHN---------------------AGGSIFAGYNVEDSC-IMYGVEGDV 99
             ++ +   +  +N                       G ++AG NV+     + GV+ D+
Sbjct: 56  GGFSSNSSSKGTYNNVPNGTKEILVDNKAFPKFSGFVGGLYAGSNVDFGNGFVLGVDTDI 115

Query: 100 RYTVPVLA------------------------------------------------DNIH 111
            ++    +                                                 ++ 
Sbjct: 116 VWSGDKASKSKSYEVAAKPDTPIGDFNPADGVSGGGYLGVATRAKDEGSQIAKPAKGDVT 175

Query: 112 SLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGK--------------------A 151
                 G+ R+R G    D ++ Y   G   +Q   + +                     
Sbjct: 176 FSDKWSGATRVRLGAAF-DRVMPYVAGGVAYSQLKASVENAKASGAQKAEGTSVEKPLEG 234

Query: 152 GEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSK---------VEGFYNTISLGVG 202
              +   +G T G GV+   ++++++ R EYR S + K         V+   N   +GV 
Sbjct: 235 LSDSKTMVGYTLGAGVDF-AMTDTVMLRAEYRYSDFGKKKFVKDKVEVDLKTNDFRVGVA 293

Query: 203 MKF 205
            KF
Sbjct: 294 YKF 296


>gi|110632458|ref|YP_672666.1| outer membrane protein, 31 kDa [Mesorhizobium sp. BNC1]
 gi|110283442|gb|ABG61501.1| outer membrane protein, 31 kDa [Chelativorans sp. BNC1]
          Length = 237

 Score = 95.1 bits (235), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 41/223 (18%), Positives = 70/223 (31%), Gaps = 42/223 (18%)

Query: 7   AVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAG------- 59
            +  ++ A     SA AAD +  A                 P   ++ GPY G       
Sbjct: 3   LLVATAAACVISSSAFAADILYDAPPAPPAP-------PPPPAPFNWTGPYVGVYGGIAA 55

Query: 60  ----------LSALYNGSFGEEAH-HNAGGSIFAGYNVEDSCIMYGVEGDVR-------- 100
                      +  + G   E +    A G I  GY+ + +  + G   D+         
Sbjct: 56  GDIKHNLNVLGNVPFTGLLTERSRAGGAIGGIQVGYDWQVNNWVLGAVADIAATNYEVKN 115

Query: 101 --YTVPVLADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKY-----ETGKAGE 153
             Y +        S     G++R R GY   D  L+Y   G    +             +
Sbjct: 116 SYYVLGTRIAKDSSKLSYLGTVRARAGYAW-DRTLVYGHGGFAYGKTKQTSDFIGTDTLK 174

Query: 154 ITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFYNT 196
            +    G T G GVE   +++ +    EY    + K + + + 
Sbjct: 175 QSQTRTGWTIGAGVEY-AVTDRISLGSEYSYVDFGKKDIYKDA 216


>gi|319405139|emb|CBI78745.1| Hemin binding protein d [Bartonella sp. AR 15-3]
          Length = 262

 Score = 94.7 bits (234), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 46/254 (18%), Positives = 86/254 (33%), Gaps = 70/254 (27%)

Query: 16  ASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLS-ALYNGSFGEEAHH 74
                 QAAD ++         VP IA+         + G Y G     ++G    +  +
Sbjct: 15  IPVSIVQAADIMKPHQSQSYQPVPLIAS----SSSFSWTGFYFGGQIGGFSGEATLKDKN 70

Query: 75  NAG--------------GSIFAGYNVEDS-CIMYGVEGDVRYTVPVLADNIHS------- 112
           +A               G ++AG NV     ++ G++ D+ ++       ++        
Sbjct: 71  DASEDSKLLSPELSGFIGGVYAGSNVGLGKDLILGIDTDMVWSGKKYTKVVNVPGDIEKV 130

Query: 113 ----------------LHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKY---------- 146
                                G+ R+R G+ + D ++ Y + G    Q            
Sbjct: 131 TYRFIKRPNDRFDYVLKEKWAGATRMRVGF-IVDRVMPYVSGGVSYVQLQSVFEVKSSNT 189

Query: 147 ------ETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFY------ 194
                       + T I +G + G G++V  +++++V R EYR S + K +         
Sbjct: 190 QKQNVGINEVKLDETKILVGYSIGGGIDV-AMTDNVVMRAEYRYSDFGKKKFAEEDGELS 248

Query: 195 ---NTISLGVGMKF 205
              N   +GV  KF
Sbjct: 249 YKTNDFRVGVAYKF 262


>gi|154246283|ref|YP_001417241.1| porin [Xanthobacter autotrophicus Py2]
 gi|154160368|gb|ABS67584.1| porin [Xanthobacter autotrophicus Py2]
          Length = 236

 Score = 94.7 bits (234), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 41/183 (22%), Positives = 64/183 (34%), Gaps = 30/183 (16%)

Query: 51  HDFNGPYAGLSALYNGSFGEEAHHNAG-------GSIFAGYNVE-DSCIMYGVEGDVR-- 100
             + G Y G +A Y    G++    AG       G   AGYN +  + I+ G+E D++  
Sbjct: 56  FSWTGFYIGGNAGYGWGSGQDELGVAGVDPKGWFGGGQAGYNYQFSNNIVAGIEADIQGG 115

Query: 101 ---------YTVPVLADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKA 151
                        +    + S     G++R R GY     +L Y T G            
Sbjct: 116 DIGASASGPLGGQLGVLGLSSTLDSFGTVRGRLGYAF-GPILPYVTGGFAWGNNSIDYLG 174

Query: 152 GEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKV---------EGFYNTISLGVG 202
              +    G TAG G+E   L++   A+ EY  +                   T  +G+ 
Sbjct: 175 ASQSQTHTGWTAGAGIEY-ALTDHWTAKTEYLYTDLGSKFYDTLGASAGVTAQTARIGIN 233

Query: 203 MKF 205
            KF
Sbjct: 234 YKF 236


>gi|209883207|ref|YP_002287064.1| carbohydrate-selective porin OprB [Oligotropha carboxidovorans OM5]
 gi|209871403|gb|ACI91199.1| carbohydrate-selective porin OprB [Oligotropha carboxidovorans OM5]
          Length = 644

 Score = 94.7 bits (234), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 54/216 (25%), Positives = 74/216 (34%), Gaps = 46/216 (21%)

Query: 9   GVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSF 68
            V + A  +   AQAAD                         +D+NG Y G    Y+   
Sbjct: 1   MVMTAAFPALS-AQAADL---------------PLKAPAIPAYDWNGAYVGAHIGYSFGT 44

Query: 69  GEE---------AHHNAGG---SIFAGYNVEDSC-IMYGVEGDVRY-----------TVP 104
                        HH+ GG      AGYNV     I+ G E D+ +           T P
Sbjct: 45  AHGEVIDGSAFPTHHHFGGAMAGFHAGYNVLLPSRILLGAEADISFPSYFESNALIATTP 104

Query: 105 VLADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVA----QKYETGKAGEITPIAIG 160
              + +       GSLR R GY  +   LLY T G   A    +        +      G
Sbjct: 105 TAGNMLTERLDYAGSLRARLGYA-TPQWLLYVTGGFAFAGERFENELAPFKDKRIAYRTG 163

Query: 161 GTAGVGVEVGGLSESLVARLEYRASKYSKVEGFYNT 196
            TAG G+E   ++    ARLEY  S + +     N+
Sbjct: 164 WTAGAGIEY-AIAPLWSARLEYLYSDFGRTSVVMNS 198


>gi|297248917|ref|ZP_06932626.1| Omp31b [Brucella abortus bv. 5 str. B3196]
 gi|297174251|gb|EFH33607.1| Omp31b [Brucella abortus bv. 5 str. B3196]
          Length = 176

 Score = 94.3 bits (233), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 32/166 (19%), Positives = 58/166 (34%), Gaps = 31/166 (18%)

Query: 70  EEAHHNAGGSIFAGYNVE-DSCIMYGVEGDVRYT---------VPVLADNIHSLHGIGGS 119
           +       G + AGYN + D+ ++ G E D + +            L     +     G+
Sbjct: 12  DATAGGFVGGVQAGYNWQLDNGVVLGAETDFQGSSVTGSISAGASGLEGKAETKVEWFGT 71

Query: 120 LRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEI--------TPIAIGGTAGVGVEVGG 171
           +R R GY  ++ L++Y T G    +       G+              G T G G E   
Sbjct: 72  VRARLGYTATERLMVYGTGGLAYGKVKSAFNLGDDASALHTWSDKTKAGWTLGAGAEY-A 130

Query: 172 LSESLVARLEYRASKYSKVEGFY------------NTISLGVGMKF 205
           ++ +   + EY  +   K                 +T+ +G+  KF
Sbjct: 131 INNNWTLKSEYLYTDLGKRNLVDVDNSFLESKVNFHTVRVGLNYKF 176


>gi|217977073|ref|YP_002361220.1| porin [Methylocella silvestris BL2]
 gi|217502449|gb|ACK49858.1| porin [Methylocella silvestris BL2]
          Length = 239

 Score = 94.3 bits (233), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 43/196 (21%), Positives = 61/196 (31%), Gaps = 40/196 (20%)

Query: 48  PIRHDFNGPYAGLSALYNG--------------SFGEEAHHNAGGSIFAGYNVEDSCIMY 93
                ++G Y G    Y                S          G    GYN++ + I+ 
Sbjct: 36  APIFTWSGLYLGGQIGYGWANNALSGWGPFFVFSGASYNPSGVLGGAHVGYNLQFNQIVL 95

Query: 94  GVEGDVRYTVPVLADNI-----HSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYET 148
           G+EGDV  T              +   + GS+R R G+ V D  L Y T G   A     
Sbjct: 96  GLEGDVEATGVDKTYAFGPTVYTTQIPVQGSIRARFGFAV-DRALFYVTGGAAFASVTNQ 154

Query: 149 G----KAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGF----------- 193
                    +     G T G G+E   L+ +   R EYR S +     +           
Sbjct: 155 YQSYLGYNSLNRSFAGWTIGGGLEY-ALTNNWSVRAEYRYSDFGTATDYTFTAGPGGNVA 213

Query: 194 ----YNTISLGVGMKF 205
                N   +G   KF
Sbjct: 214 RHLTENAARVGFSYKF 229


>gi|115525004|ref|YP_781915.1| putative outer-membrane immunogenic protein precursor
           [Rhodopseudomonas palustris BisA53]
 gi|115518951|gb|ABJ06935.1| putative outer-membrane immunogenic protein precursor
           [Rhodopseudomonas palustris BisA53]
          Length = 219

 Score = 93.9 bits (232), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 46/222 (20%), Positives = 77/222 (34%), Gaps = 31/222 (13%)

Query: 4   LFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSAL 63
           +   +  ++  LA   ++ AAD   R +               V    +++G YAG+   
Sbjct: 1   MKKILLATTALLAMGATSFAADLPARVYTK---------APVLVAPGVNWSGFYAGVFGG 51

Query: 64  YNGSFGEEAH---------HNAGGSIFAGYNVEDS--CIMYGVEGDV-RYTVPVLADNIH 111
           Y  S   +           +   G    GYN +      ++G+E D    ++        
Sbjct: 52  YGWSQDIKVDGLAIATDEINGGFGGGTVGYNWQAPGSQWVFGIEVDAAGSSLKYTTVGFE 111

Query: 112 SLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGG 171
                 GS+  R GY V D+ L YA  G   A    T      + +  G T G G+E   
Sbjct: 112 DKIDAFGSVTGRVGYAV-DAALFYAKGGFAWADNKVTVPGFSESKLHTGWTVGGGLEY-M 169

Query: 172 LSESLVARLEYRASKYSK--------VEGFYNTISLGVGMKF 205
            + +   + EY  + Y K        +    +T+  GV   F
Sbjct: 170 FAPAWSVKGEYMYADYGKETYGNIVDIGATVHTVKAGVNYHF 211


>gi|92115870|ref|YP_575599.1| putative outer membrane protein [Nitrobacter hamburgensis X14]
 gi|91798764|gb|ABE61139.1| putative outer membrane protein [Nitrobacter hamburgensis X14]
          Length = 452

 Score = 93.6 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 37/181 (20%), Positives = 55/181 (30%), Gaps = 33/181 (18%)

Query: 45  RYVPIR-HDFNGPYAGLSALYNGSFGEE---------------AHHNAGGSIFAGYNVED 88
            Y P+   ++NG Y G +                         A     G + AGYN + 
Sbjct: 235 TYAPVATANWNGFYLGGNVGSGTGRDRTTVTNLATGESAAFNLAPDGFIGGVQAGYNWQA 294

Query: 89  SCIMYGVEGDVRYTVPVLAD-----------NIHSLHGIGGSLRIRGGYEVSDSLLLYAT 137
             I+YG+E D + +                 N ++     G++R R GY V    L YAT
Sbjct: 295 GNIVYGLETDFQGSTMEDNKTCIGCEPGASLNFNAKLQWLGTVRGRLGYAV-GPSLFYAT 353

Query: 138 VGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGG-----LSESLVARLEYRASKYSKVEG 192
            G               +    G T G G+E           +  +  EY      K   
Sbjct: 354 GGFAYGNVKTAINEVNFSDTRTGWTVGGGIETPFTLFGLFGPNWTSTTEYLYVDLGKSTN 413

Query: 193 F 193
            
Sbjct: 414 G 414



 Score = 84.3 bits (207), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 45/223 (20%), Positives = 72/223 (32%), Gaps = 44/223 (19%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+++ L V ++  A+    SAQAAD   R                 +   +D+ G Y G+
Sbjct: 1   MKRILLGVLLAGTAM----SAQAADLAPR----------PYTKAPVMAPVYDWTGFYLGV 46

Query: 61  SALYNGSFGEEAHH--------------NAGGSIFAGYNVEDSCI----MYGVEGDVRYT 102
           +A          +                A G    GYN + +      + GVE D++  
Sbjct: 47  NAGLGLGRDRTVNDFGDGTGNSTYLQPLGAIGGGQIGYNWQTNSFLGPLVLGVEADIQGA 106

Query: 103 V------PVLADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAG---- 152
                   +     +      G+ R R G  V+   L Y T G         G A     
Sbjct: 107 DMTDNRTNINGVQYNQKLDWFGTARGRIGL-VNGPTLTYLTGGYAYGNVSTRGVADGVPF 165

Query: 153 EITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFYN 195
             +    G T G GVE   L  +   ++EY           ++
Sbjct: 166 AFSGNRSGWTWGSGVEA-ALGGNWTGKIEYLYVDLGNRTDVFD 207


>gi|13470446|ref|NP_102014.1| outer membrane protein [Mesorhizobium loti MAFF303099]
 gi|14021187|dbj|BAB47800.1| outer membrane protein [Mesorhizobium loti MAFF303099]
          Length = 221

 Score = 93.6 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 49/235 (20%), Positives = 76/235 (32%), Gaps = 52/235 (22%)

Query: 6   LAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYN 65
           L V  + L       A AADP                         D+ G YAGL A Y 
Sbjct: 4   LVVASAGLLAVLSVPALAADPTVDVPM--------------TAPGFDWTGYYAGLQAGYG 49

Query: 66  GSFGE-------------EAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVL------ 106
               +             + +    G   AG   +    + G E D+ Y+          
Sbjct: 50  WGQSDISGTEGEPFSVSPDINGGFVGGHIAGL-WQFDQAVIGAEADLNYSSVNGTAEAEP 108

Query: 107 ADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAG---EITPIAIGGTA 163
            +N  +     GS+  + GY + D +L+Y   G   A    +  AG     T   +G T 
Sbjct: 109 GNNFGTDIKWFGSVNAKAGYAM-DRVLVYGIGGVAFAGIETSQSAGSAFSETRANVGWTL 167

Query: 164 GVGVEVGGLSESLVARLEYRASKYS-------------KVEGFYNTISLGVGMKF 205
           G GV+   L++  V   +YR   +                +   NT+ + +  KF
Sbjct: 168 GAGVDY-ALTDKFVVGAQYRYYDFGSEHYDGSSDFVGRDQDTKLNTVGINLSYKF 221


>gi|319783284|ref|YP_004142760.1| OmpA-like transmembrane domain-containing protein [Mesorhizobium
           ciceri biovar biserrulae WSM1271]
 gi|317169172|gb|ADV12710.1| OmpA-like transmembrane domain-containing protein [Mesorhizobium
           ciceri biovar biserrulae WSM1271]
          Length = 217

 Score = 93.6 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 48/190 (25%), Positives = 77/190 (40%), Gaps = 35/190 (18%)

Query: 49  IRHDFNGPYAGLSA--------LYNGSFGEEAHHNAGG---SIFAGYNVEDSCIMYGVEG 97
               + GPYAG+          +Y       A HN G      FAGYN++   I+YGVEG
Sbjct: 30  PEWTWQGPYAGVFGAGTLEHYKIYGPGAQAGATHNVGSATVGGFAGYNLQSGKIVYGVEG 89

Query: 98  DVRYTVPVLADN-------IHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGK 150
           ++ Y       +       + +  G+ GS++ R G ++    + + T G   A+      
Sbjct: 90  ELGYRFKKNTFDDIPGPGVLDASTGLFGSVKGRVGMDMGA-YMPFVTAGVTAAKLKTFYP 148

Query: 151 AG--EITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFY-------------N 195
            G  E     +GG  G G++V  L+ ++  R EY  S + K    Y             +
Sbjct: 149 GGNAERDATLVGGVVGAGIDV-ALTHNVFLRGEYDFSFFGKKSLEYCGGGCTLEHTLQTH 207

Query: 196 TISLGVGMKF 205
              +G+ MKF
Sbjct: 208 DFRVGIAMKF 217


>gi|319403667|emb|CBI77252.1| Hemin binding protein d [Bartonella rochalimae ATCC BAA-1498]
          Length = 295

 Score = 93.6 bits (231), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 50/306 (16%), Positives = 86/306 (28%), Gaps = 112/306 (36%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M  +   +  S +AL +  + QAAD       G   V         V     + G Y G 
Sbjct: 1   MNNMKCLITTSVVALITASAVQAADIRVPQEIGETIV---------VAPAFSWTGFYLGA 51

Query: 61  SAL-------YNGSFGEEAHH-------------NAGGSIFAGYNVEDSC-IMYGVEGDV 99
                     ++G   +++                  G  +AG NV+    ++ GV+ DV
Sbjct: 52  QIGGFSSKTSFSGPADDDSKKWLPLDKKLSPKPSGFIGGFYAGSNVDLGNGLILGVDTDV 111

Query: 100 RYTVPVLADNIHS----------------------------------------------L 113
            ++      N                                                  
Sbjct: 112 VFSGQKDTKNDKVTSELDKDNNNNNAPAGAKDKDNGKPEPEKEPEKEKDVKFTQYDHTLK 171

Query: 114 HGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYE-------------------------T 148
               G+ RIR G+  +D ++ Y   G    Q  +                          
Sbjct: 172 AKWAGATRIRIGFA-ADRIMPYVAGGVAYTQLQDTFTTLTGIKKVPAQKAEGTDKETSGK 230

Query: 149 GKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFY---------NTISL 199
               + +   IG T   GV+   ++++++ R EYR S + K +            N   +
Sbjct: 231 SNTVDESKTMIGYTLAAGVDF-AMTDNVLLRAEYRYSDFGKKKLHNDKFEVNYKANDFRV 289

Query: 200 GVGMKF 205
           GV  KF
Sbjct: 290 GVAYKF 295


>gi|27379811|ref|NP_771340.1| outer-membrane immunogenic protein [Bradyrhizobium japonicum USDA
           110]
 gi|27352964|dbj|BAC49965.1| blr4700 [Bradyrhizobium japonicum USDA 110]
          Length = 229

 Score = 92.8 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 43/197 (21%), Positives = 66/197 (33%), Gaps = 32/197 (16%)

Query: 39  PTIATNRYVPIRHDFNGPYAGLSALYNGSFGEEAHHNAGGSI--FAGYNVEDSCIMYGVE 96
           P       V   +++ G Y G+        G       GG +   AGYN +   +++GVE
Sbjct: 27  PYTKAPVAVASVYNWTGFYLGIVGGGAWENGSGDPKMKGGFVGGTAGYNWQTGNVVFGVE 86

Query: 97  GDVRYT--------------VPVLADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDV 142
            D  +                 V    + S     G++R R GY V +++L Y T G   
Sbjct: 87  ADGTWADVSASATGATVVPGFGVATATVSSKTDAMGTVRGRIGYAV-NNVLFYGTGGYAW 145

Query: 143 AQKYET----GKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFY---- 194
                T    G +   +    G T G GVE    +     + EY          F     
Sbjct: 146 IDNKITLSALGVSVSDSKFHSGWTVGAGVEA-FFAPQWSVKGEYLYRSLGGETYFSGALP 204

Query: 195 ------NTISLGVGMKF 205
                 +T+ +GV   F
Sbjct: 205 TGTLNFHTVQVGVNYHF 221


>gi|15420174|gb|AAK97309.1|AF308167_1 Pap31 [Bartonella henselae phage 60457]
          Length = 241

 Score = 92.8 bits (229), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 46/254 (18%), Positives = 78/254 (30%), Gaps = 92/254 (36%)

Query: 13  LALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSFGEEA 72
           +AL S  +AQAAD +         V   +A          + G Y G      G+F  + 
Sbjct: 1   IALISXSAAQAADVI---------VPHEVAPTVISAPAFSWTGFYIGGQV---GNFSSKV 48

Query: 73  H-------------------HNAGGSIFAGYNVEDSC-IMYGVEGDVRYTVP-------- 104
                                   G I+AG N++    ++ GVE D  +           
Sbjct: 49  EITDPNKKDKLFSKDDTPKPSGFMGGIYAGSNMDLGNNMILGVETDAVWADREDAKTSSA 108

Query: 105 -----------------------------------VLADNIHSLHGIGGSLRIRGGYEVS 129
                                                 D++       G+ R+R G+  +
Sbjct: 109 KVIREDELVNFKDSLKNANAVFAKDKTMDDVKQDEKHTDSLALKEKWSGATRVRIGFTAA 168

Query: 130 DSLLLYATVGP------DVAQKYETGKAG----------EITPIAIGGTAGVGVEVGGLS 173
           D ++ Y   G        V+    T  A           + T   +G T G GV+   ++
Sbjct: 169 DRIMPYVAGGVSYAQVQAVSSTKVTKAADDAEIASAQLFDKTKTLVGFTLGGGVDF-AMT 227

Query: 174 ESLVARLEYRASKY 187
           ++++ R EYR S +
Sbjct: 228 DNVLLRAEYRYSDF 241


>gi|49473904|ref|YP_031946.1| hemin binding protein a [Bartonella quintana str. Toulouse]
 gi|8575707|gb|AAF78059.1|AF266281_1 hemin-binding surface protein A precursor [Bartonella quintana]
 gi|21689904|gb|AAM68129.1| hemin-binding protein A [Bartonella quintana]
 gi|49239407|emb|CAF25745.1| Hemin binding protein a [Bartonella quintana str. Toulouse]
          Length = 272

 Score = 92.8 bits (229), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 52/284 (18%), Positives = 84/284 (29%), Gaps = 96/284 (33%)

Query: 4   LFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSAL 63
           +   +  S +AL S  +AQAAD +              A          + G Y G    
Sbjct: 3   IKSLITTSVIALVSASAAQAADVIATHE----------AAPVITTPNFSWTGFYIGGQI- 51

Query: 64  YNGSFGEEAH-------------------HNAGGSIFAGYNVEDSC-IMYGVEGDVRYTV 103
             G+F  +                         G I+AG N++    ++ GVE D  +  
Sbjct: 52  --GNFTSDNKIKGLGKETSIFTKELTPQLSGIVGGIYAGSNIDLGSGLILGVETDAIWAD 109

Query: 104 --------------------------------------PVLADNIHSLHGIGGSLRIRGG 125
                                                   ++D+        G+ R R G
Sbjct: 110 CEATKTSAIRTLSVPQANSLNDEFKAAGITLKDKFSENDTMSDHYTYKAKWSGATRARIG 169

Query: 126 YEVSDSLLLYATVGP---------------DVAQKYETGKAGEITPIAIGGTAGVGVEVG 170
           +   D ++ Y   G                    K   G   + T + +G T   GV+V 
Sbjct: 170 FSAFDRVMPYFAGGVAYARMQGMKSVSGMNAAKNKKLGGGLYDETKMMVGFTVSGGVDV- 228

Query: 171 GLSESLVARLEYRASKYSKVEGFYNT---------ISLGVGMKF 205
            ++ +++ R EYR S + K +   NT            GV  KF
Sbjct: 229 AMTGNVLLRGEYRYSDFGKKKFLNNTQEFNYKTNDFRFGVAYKF 272


>gi|170750202|ref|YP_001756462.1| carbohydrate-selective porin OprB [Methylobacterium radiotolerans
           JCM 2831]
 gi|170656724|gb|ACB25779.1| Carbohydrate-selective porin OprB [Methylobacterium radiotolerans
           JCM 2831]
          Length = 708

 Score = 92.8 bits (229), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 49/243 (20%), Positives = 78/243 (32%), Gaps = 69/243 (28%)

Query: 6   LAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYN 65
            A  V +  L +  +A+AAD                      P   D++G Y GL     
Sbjct: 11  TAALVLTAPLLAPVAARAADLF------------APRPTAQAPAYTDWSGGYVGLEGSAG 58

Query: 66  GSFGE----------------EAHHNAG------------GSIFAGYNVEDSCIMYGVEG 97
           GS+G                 ++  + G            G +F G+N +    +YG+E 
Sbjct: 59  GSYGAYSFGPTTIGGRPVPPFKSGDSTGRSDQGKNATTATGGLFGGWNWQAGPWVYGIEA 118

Query: 98  D----------------VRYTVPVLADN-IHSLHGIGGSLRIRGGYEVSDSLLLYATVGP 140
                              Y     A N + +   + G+LR R GY   D  L+Y T G 
Sbjct: 119 SLDAANLKRPVPSTIAGFGYADTTPAFNIVRAKTDLYGALRARLGYSF-DRYLIYGTFGL 177

Query: 141 DVAQKYETGKAGEITP----------IAIGGTAGVGVEVGGLSESLVARLEYRASKYSKV 190
             A         ++              +G T G GV+   +++SL   ++YR       
Sbjct: 178 AGANARILANYPDLDAGGQTAARRDLDYVGFTLGAGVQY-AITDSLALGIDYRYIDLGGS 236

Query: 191 EGF 193
             F
Sbjct: 237 RRF 239


>gi|27375206|ref|NP_766735.1| hypothetical protein blr0095 [Bradyrhizobium japonicum USDA 110]
 gi|27348342|dbj|BAC45360.1| blr0095 [Bradyrhizobium japonicum USDA 110]
          Length = 675

 Score = 92.8 bits (229), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 50/219 (22%), Positives = 75/219 (34%), Gaps = 45/219 (20%)

Query: 2   QKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLS 61
           + L  A  ++S  +    +++AAD   +A                +   +D+ G Y G  
Sbjct: 20  RYLRTAAAIASGVMVLPAASRAADLPLKAPA--------------LKTVYDWTGLYIGAH 65

Query: 62  ALYNGSFGEEA------------HHNAGGSIFAGYNVE-DSCIMYGVEGDVRY------- 101
                                     A G + AGYN   +S ++ GVEGD+ +       
Sbjct: 66  VGVTRGTSSATLIDPTLATDDHVFTGATGGVQAGYNWRLNSGLLLGVEGDISFPNYLPSN 125

Query: 102 ----TVPVLADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVA--QKYETGKAGEIT 155
               +   +  +         SLR R GY  + + L YAT G      +   T   G   
Sbjct: 126 HVVSSAATVLSSAEERWDYVASLRARLGYT-TGNWLFYATGGAAFTGERFLSTPTGGTEE 184

Query: 156 P---IAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVE 191
                  G TAG GVE    +    ARLEY  SK+    
Sbjct: 185 KVLHTRFGWTAGGGVEY-AFAPHWSARLEYLYSKFDNAN 222


>gi|90422268|ref|YP_530638.1| putative outer membrane protein [Rhodopseudomonas palustris BisB18]
 gi|90104282|gb|ABD86319.1| putative outer membrane protein [Rhodopseudomonas palustris BisB18]
          Length = 447

 Score = 92.4 bits (228), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 34/176 (19%), Positives = 53/176 (30%), Gaps = 31/176 (17%)

Query: 48  PIRHDFNGPYAGLSALYNGSFGEEAH-------------HNAGGSIFAGYNVEDSCIMYG 94
               ++ G Y G +     +                       G    GYN + S  +YG
Sbjct: 240 APVANWTGFYLGGNFGSAFARNRTTASIGPFSEQFNLGLDGFAGGGQVGYNWQASNWVYG 299

Query: 95  VEGDVRYTVPVLAD--------NIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKY 146
           +E D + +     D           +     G++R R GY +  S L Y T G       
Sbjct: 300 LEADFQGSTQRDNDTAVLFGLAAYDAKLPWFGTVRGRLGYSL-GSTLFYGTGGYAYGNVK 358

Query: 147 --ETGKAGEI--TPIAIGGTAGVGVEVGG-----LSESLVARLEYRASKYSKVEGF 193
              T   G    +  A G TAG G+E        +  +  ++ EY           
Sbjct: 359 TTITAGTGSETISKTASGWTAGAGIETPFTLLGLVGPNWTSKTEYLYVDLGSTTSD 414



 Score = 76.2 bits (186), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 40/216 (18%), Positives = 61/216 (28%), Gaps = 43/216 (19%)

Query: 8   VGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGS 67
           +      + +  SAQAAD   +A +    +V            +D+ G Y G++A     
Sbjct: 4   ILAGVALIGTAVSAQAADLATKAPYYKAPIV----------AVYDWTGFYVGVNAGAGLG 53

Query: 68  FGEEAHH--------------NAGGSIFAGYNVED----SCIMYGVEGDVRYTVPVLAD- 108
                 +               A G    GYN +       ++ G+EGD +         
Sbjct: 54  RDRAIQNFAPGLTSTTYLQPFGALGGGQIGYNYQTNSLFGPLVIGLEGDFQGADLSDTRT 113

Query: 109 ------NIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYET------GKAGEITP 156
                 N         + R R G      +L Y T G        T              
Sbjct: 114 TLSGPVNYSQKLDWFATARGRIGIA-RGPVLNYFTGGFAAGDVRTTVTEGGFTAFDSGKR 172

Query: 157 IAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEG 192
              G T G GVE   L  +   ++EY          
Sbjct: 173 TLTGWTIGSGVEA-ALGGNWTGKIEYLHLDLGNKTD 207


>gi|148255740|ref|YP_001240325.1| putative outer-membrane protein [Bradyrhizobium sp. BTAi1]
 gi|146407913|gb|ABQ36419.1| putative outer-membrane protein, putative secreted protein
           [Bradyrhizobium sp. BTAi1]
          Length = 212

 Score = 92.0 bits (227), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 41/174 (23%), Positives = 59/174 (33%), Gaps = 15/174 (8%)

Query: 39  PTIATNRYVPIRHDFNGPYAGLSALYNGSFGEEA--HHNAGGSIFAGYNVEDSCIMYGVE 96
           PT      +     + G Y G    Y       A       G    GYN +   +++G+E
Sbjct: 27  PTYTKAPVLAPVQTWTGFYIGAFGGYANEDASTAALKGGFAGGT-VGYNWQQGPLVFGLE 85

Query: 97  GDVRYTVPVLADNIHSLHGI------GGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGK 150
            D  +        I  + G+       G++R R GY   D++LLY T G        +  
Sbjct: 86  ADAAWADINATVGIPGVFGLTDRIESTGTVRGRIGYAF-DTVLLYGTGGYAWGNNKLSAT 144

Query: 151 ----AGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFYNTISLG 200
               AG  T    G  AG GVE    +     + EY          F   + LG
Sbjct: 145 VGGVAGSETKFLSGWAAGAGVE-WMFAPKWSLKGEYLYKSLESSTYFGGAVPLG 197


>gi|75674387|ref|YP_316808.1| outer membrane protein [Nitrobacter winogradskyi Nb-255]
 gi|74419257|gb|ABA03456.1| possible outer membrane protein [Nitrobacter winogradskyi Nb-255]
          Length = 453

 Score = 92.0 bits (227), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 50/244 (20%), Positives = 79/244 (32%), Gaps = 55/244 (22%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K+ L V ++S A+    SAQAAD   R                 +   +D+ G Y G+
Sbjct: 1   MKKILLGVLLASTAM----SAQAADLAPR----------PYTKAPPIAPVYDWTGLYVGV 46

Query: 61  SALYNGSFGEEAHH-------------NAGGSIFAGYNVEDSCI----MYGVEGDVRYTV 103
           +A          H               A G    GYN + +      ++G+E D++   
Sbjct: 47  NAGLGLGRNRAVHDFGVGAISTHLQPLGAVGGGQIGYNWQTNSFFGPLVFGIEADIQGAD 106

Query: 104 PVLADNIHSL-------HGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAG---- 152
                   +            G+ R R G  ++  +L Y T G        T   G    
Sbjct: 107 MTDNRTNFAGLLQYNQRLDWFGTARGRVGL-INGPMLTYVTGGWAYGHVGTTVIQGGVPF 165

Query: 153 EITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSK-----------VEGFYNTISLGV 201
             +    G T G GVE   L  +   ++EY    +              E   N    G+
Sbjct: 166 AFSGGRNGWTFGSGVEA-ALGGNWTGKIEYLYLDFGNRTDSFAGQALRSEMRENIFRAGL 224

Query: 202 GMKF 205
             +F
Sbjct: 225 NYRF 228



 Score = 69.7 bits (169), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 35/190 (18%), Positives = 55/190 (28%), Gaps = 41/190 (21%)

Query: 42  ATNRYVPIR-HDFNGPYAGLSALYNGSFGEE--------------AHHNAGGSIFAGYNV 86
           A+N Y P+   ++NG Y G +                        A     G    GYN 
Sbjct: 230 ASNPYAPVATANWNGLYLGGNVGGGVGRNRTTISNPAGNLAQFNLAPDGFVGGGQIGYNW 289

Query: 87  EDSCIMYGVEGDVRYTVPVLAD-----------NIHSLHGIGGSLRIRGGYEVSDSLLLY 135
           +   I+ G+E D +                   + +S     G++R R GY V +S + Y
Sbjct: 290 QAGNIVLGLETDFQGATLQDNKTCIGCVPGASFDFNSKLQWFGTVRGRLGYAVGNS-MFY 348

Query: 136 ATVGPDVAQKYETGKAG----EITPIAIGGTAGVGVEV----------GGLSESLVARLE 181
           AT G                   +    G   G G+E                +  +  E
Sbjct: 349 ATGGFAYGNIRTALNTPLNNFNFSNTRTGYAVGGGIETPLPMVNLFGGPLFGPNWTSTTE 408

Query: 182 YRASKYSKVE 191
           Y      +  
Sbjct: 409 YLFVDLGRSS 418


>gi|225853091|ref|YP_002733324.1| outer membrane protein Omp31 [Brucella melitensis ATCC 23457]
 gi|256263422|ref|ZP_05465954.1| Omp31b [Brucella melitensis bv. 2 str. 63/9]
 gi|260565169|ref|ZP_05835653.1| outer membrane protein 31b [Brucella melitensis bv. 1 str. 16M]
 gi|265991667|ref|ZP_06104224.1| outer membrane protein 31b [Brucella melitensis bv. 1 str. Rev.1]
 gi|265995505|ref|ZP_06108062.1| outer membrane protein 31b [Brucella melitensis bv. 3 str. Ether]
 gi|225641456|gb|ACO01370.1| outer membrane protein Omp31 [Brucella melitensis ATCC 23457]
 gi|260151237|gb|EEW86331.1| outer membrane protein 31b [Brucella melitensis bv. 1 str. 16M]
 gi|262766618|gb|EEZ12407.1| outer membrane protein 31b [Brucella melitensis bv. 3 str. Ether]
 gi|263002451|gb|EEZ15026.1| outer membrane protein 31b [Brucella melitensis bv. 1 str. Rev.1]
 gi|263093434|gb|EEZ17484.1| Omp31b [Brucella melitensis bv. 2 str. 63/9]
 gi|326409637|gb|ADZ66702.1| outer membrane protein Omp31 [Brucella melitensis M28]
 gi|326539339|gb|ADZ87554.1| outer membrane protein Omp31 [Brucella melitensis M5-90]
          Length = 202

 Score = 92.0 bits (227), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 32/182 (17%), Positives = 62/182 (34%), Gaps = 47/182 (25%)

Query: 70  EEAHHNAGGSIFAGYNVEDSC-IMYGVEGDVRYTVPVL---------------------A 107
           +       G + AGYN + +  ++ G E D + +                         +
Sbjct: 22  DVTASGFVGGVQAGYNWQLANGLVLGGEADFQGSTVKSKLVDNGDLSDIGVAGNLSGDES 81

Query: 108 DNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEI--------TPIAI 159
             + +     G++R R G+  ++ L++Y T G    +   +  A +         +    
Sbjct: 82  FGLETKVQWFGTVRARLGFTPTERLMVYGTGGLAYGKVKTSLSAYDDGESFSAGNSKTKA 141

Query: 160 GGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFY----------------NTISLGVGM 203
           G T G GVE   ++ +   + EY  +   K    Y                +T+ LG+  
Sbjct: 142 GWTLGAGVEY-AVTNNWTLKSEYLYTDLGKRSFNYIDEENVNINMENKVNFHTVRLGLNY 200

Query: 204 KF 205
           KF
Sbjct: 201 KF 202


>gi|17986685|ref|NP_539319.1| 31 kDa outer-membrane immunogenic protein precursor [Brucella
           melitensis bv. 1 str. 16M]
 gi|256045237|ref|ZP_05448134.1| outer membrane protein Omp31 [Brucella melitensis bv. 1 str. Rev.1]
 gi|256114189|ref|ZP_05454943.1| outer membrane protein Omp31 [Brucella melitensis bv. 3 str. Ether]
 gi|17982306|gb|AAL51583.1| 31 kDa outer-membrane immunogenic protein precursor [Brucella
           melitensis bv. 1 str. 16M]
          Length = 201

 Score = 91.6 bits (226), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 32/182 (17%), Positives = 62/182 (34%), Gaps = 47/182 (25%)

Query: 70  EEAHHNAGGSIFAGYNVEDSC-IMYGVEGDVRYTVPVL---------------------A 107
           +       G + AGYN + +  ++ G E D + +                         +
Sbjct: 21  DVTASGFVGGVQAGYNWQLANGLVLGGEADFQGSTVKSKLVDNGDLSDIGVAGNLSGDES 80

Query: 108 DNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEI--------TPIAI 159
             + +     G++R R G+  ++ L++Y T G    +   +  A +         +    
Sbjct: 81  FGLETKVQWFGTVRARLGFTPTERLMVYGTGGLAYGKVKTSLSAYDDGESFSAGNSKTKA 140

Query: 160 GGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFY----------------NTISLGVGM 203
           G T G GVE   ++ +   + EY  +   K    Y                +T+ LG+  
Sbjct: 141 GWTLGAGVEY-AVTNNWTLKSEYLYTDLGKRSFNYIDEENVNINMENKVNFHTVRLGLNY 199

Query: 204 KF 205
           KF
Sbjct: 200 KF 201


>gi|154246284|ref|YP_001417242.1| porin [Xanthobacter autotrophicus Py2]
 gi|154160369|gb|ABS67585.1| porin [Xanthobacter autotrophicus Py2]
          Length = 232

 Score = 91.6 bits (226), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 41/206 (19%), Positives = 67/206 (32%), Gaps = 43/206 (20%)

Query: 41  IATNRYVPIR-HDFNGPYAGLSALYNG----------------SFGEEAHHNAGGSIFAG 83
                 +P++   + G Y G +  +                  S+     +   G +  G
Sbjct: 29  PVKAAPIPVQTFSWTGFYIGGNVGWGWADNTYDVTPFGSLIGYSYSPGTGNGFIGGLQTG 88

Query: 84  YNVED-SCIMYGVEGDVRYT----------VPVLADNIHSLHGIGGSLRIRGGYEVSDSL 132
           YN +  + ++ GVE D  ++           P     I       G++R R GY + D  
Sbjct: 89  YNYQFANNVVIGVEADFDWSDIGSSSLVVGGPFTGGAISQNIDYFGTIRARLGYGI-DRF 147

Query: 133 LLYATVGPD-VAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVE 191
           L Y T G     Q +             G T G GVE   ++ +   + EY    ++K  
Sbjct: 148 LPYITGGAAWAKQNFSDFYGNTYNDTKWGWTVGAGVEY-AITNNWTVKAEYLYLGFNKNT 206

Query: 192 GFY------------NTISLGVGMKF 205
                          +T  LGV  KF
Sbjct: 207 TNDYFGDSYSVGSNISTAKLGVNYKF 232


>gi|307942791|ref|ZP_07658136.1| porin [Roseibium sp. TrichSKD4]
 gi|307773587|gb|EFO32803.1| porin [Roseibium sp. TrichSKD4]
          Length = 183

 Score = 91.3 bits (225), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 40/181 (22%), Positives = 68/181 (37%), Gaps = 27/181 (14%)

Query: 48  PIRHDFNGPYAGLSALYNGSFGEEAHHN---------AGGSIFAGYNVEDSCIMYGVEGD 98
           P  + + G Y G    YN   G++   +           G   AGYN      + GVE +
Sbjct: 7   PETNSWQGFYIGGHFGYNWMNGQDDLDDGIGTTSLSSVIGGFHAGYNHMFGQFLLGVEAE 66

Query: 99  VRYTV--PVLADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITP 156
              +      A  + +      + R+R GY      L YAT G  +A    +    + + 
Sbjct: 67  GNLSDLNGQTAGGLDASSNWMIAGRVRAGYAFE-HFLAYATAGVSMADASLS-GTKKSSN 124

Query: 157 IAIGGTAGVGVEVGGLSESLVARLEYRA------------SKYSKVEGFYNTISLGVGMK 204
              G   G G+E   +++++ ARLEY+             + Y KV+   + +  G+   
Sbjct: 125 THTGLVVGGGLEA-FVTQNISARLEYQHHWLNEQSYNTNNTDY-KVDAELDIVRAGLSYH 182

Query: 205 F 205
           F
Sbjct: 183 F 183


>gi|319408782|emb|CBI82439.1| Hemin binding protein c [Bartonella schoenbuchensis R1]
          Length = 275

 Score = 91.3 bits (225), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 47/281 (16%), Positives = 80/281 (28%), Gaps = 93/281 (33%)

Query: 7   AVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNG 66
            +  S   L +   AQA                ++     V     + G Y G      G
Sbjct: 6   LITASIFTLVASSVAQA------ESGRISQESMSVVLPNVVAPSFSWTGFYFGGQI---G 56

Query: 67  SFGEEAH------------------------HNAGGSIFAGYNVE-DSCIMYGVEGDVRY 101
            F  +                              G ++AG N + ++ ++ GV+ DV +
Sbjct: 57  GFSSKTDLNLNLKGVGSTKLSSIEKDLLPKLSGFMGGLYAGANFDLNNSLVLGVDTDVIW 116

Query: 102 TVPVLADNIHS---------------------------------------LHGIGGSLRI 122
           +       I                                              G+ R+
Sbjct: 117 SDKKDTKVIRHSGYKTKDGGHGVQRQHHLQEAVSSDELLEKFIVTVSHTLKQKWAGATRM 176

Query: 123 RGGYEVSDSLLLYATVGPDVAQKYE---------TGKAGEITPIAIGGTAGVGVEVGGLS 173
           R G+ V D ++ Y   G    Q  +           K  + T   IG T G G++   ++
Sbjct: 177 RVGFAV-DHIMPYIAGGVAYTQLQDILLVSTGIKKDKIVDETKAMIGYTFGGGIDFAMMN 235

Query: 174 ESLVARLEYRASKYSKV---------EGFYNTISLGVGMKF 205
           + ++ R EYR S + K          +   N   +GV  KF
Sbjct: 236 DLIL-RAEYRFSNFGKKKFIKDKFEIDYKTNDFRVGVSYKF 275


>gi|298292422|ref|YP_003694361.1| porin [Starkeya novella DSM 506]
 gi|296928933|gb|ADH89742.1| porin [Starkeya novella DSM 506]
          Length = 203

 Score = 91.3 bits (225), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 39/170 (22%), Positives = 56/170 (32%), Gaps = 20/170 (11%)

Query: 51  HDFNGPYAGLSALYNGSFGEEAHH--NAGGSIFAGYNVEDSC--IMYGVEGDVRYTVPVL 106
             + G Y G +A Y     + +       G + AGYN + +   ++ GVE D +Y     
Sbjct: 39  FTWTGFYIGANAGYGFGEADFSGDIDGFIGGLQAGYNWQGAGSPLVLGVETDFQYADVSS 98

Query: 107 ADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVG 166
           +          G++R R GY   D  L+Y T G                    G T G G
Sbjct: 99  S---VFSLDYFGTVRARVGYAF-DQFLVYGTGGFAYGAGSYELLGLTNDRNHFGWTVGAG 154

Query: 167 VEVGGLSESLVARLEYRASKYS-----------KVEGFYNTISLGVGMKF 205
            E   L  +   + EY                  V    N I  GV  +F
Sbjct: 155 AEY-ALGNNWSVKGEYLYLDMGEETYATFTGPRDVGLTSNVIRAGVNYRF 203


>gi|77917690|ref|YP_355505.1| outer membrane immunogenic protein [Pelobacter carbinolicus DSM
           2380]
 gi|77543773|gb|ABA87335.1| outer membrane immunogenic protein [Pelobacter carbinolicus DSM
           2380]
          Length = 225

 Score = 90.9 bits (224), Expect = 9e-17,   Method: Composition-based stats.
 Identities = 37/166 (22%), Positives = 58/166 (34%), Gaps = 25/166 (15%)

Query: 49  IRHDFNGPYAGLSALYNGSFGEEAHH------------NAGGSIFAGYNVEDSCIMYGVE 96
              D++GPY G    ++ +  E +                 G ++ G+N     IM G E
Sbjct: 31  ALSDYSGPYIGGFVGHSWADLEYSDSWNPGYDLNADIEGFVGGLYFGHNYMIDNIMLGFE 90

Query: 97  GDVRYTVPVLADNIHSLH--------GIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYET 148
            D          + ++ +             LR R G+ V ++ L Y   G  VA+    
Sbjct: 91  ADAGIGDLGEGADKNNSYNDWSAFDIDWDAHLRARAGF-VYNTTLFYVAGGLAVAKVAVD 149

Query: 149 G---KAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVE 191
                 G       G T G G+E   ++E L AR+EY    Y    
Sbjct: 150 DTDSGYGGDNATHFGWTIGAGIE-QKITEHLTARIEYLYDDYGSES 194


>gi|240849916|ref|YP_002971305.1| hemin binding protein A [Bartonella grahamii as4aup]
 gi|240267039|gb|ACS50627.1| hemin binding protein A [Bartonella grahamii as4aup]
          Length = 288

 Score = 90.9 bits (224), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 40/249 (16%), Positives = 65/249 (26%), Gaps = 84/249 (33%)

Query: 40  TIATNRYVPIRHDFNGPYAGLSAL-YNGSFGEEAH---------------HNAGGSIFAG 83
           T            + G Y G     ++G   E                      G I+ G
Sbjct: 41  TAPAVISAAPSFSWTGFYIGGQVGNFSGKVDEFDSETKKKITDKDWTPKPSGFMGGIYVG 100

Query: 84  YNVEDSC-IMYGVEGDVRYTVPVLA----------------------------------- 107
            NV+    ++ GVE D  +     +                                   
Sbjct: 101 SNVDLGNGLILGVETDAVWADREDSKTHSAVIGETGLAAFKNKLTAAEATFASGKNIDNV 160

Query: 108 -------DNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEI------ 154
                  +         G+ R+R G+   D +L Y   G    Q                
Sbjct: 161 TKDGKRVEGTSIKEKWSGATRVRIGFAAVDRILPYFAGGIAYTQLQVVNSLKAEGADGAE 220

Query: 155 ---------TPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFY---------NT 196
                    +   +G T G GV+   ++++++ R EYR S + K              N 
Sbjct: 221 IASAKMFDQSKTMVGFTVGGGVDF-AMTDNVLLRAEYRYSDFGKKAFVKDEDKIAYKTND 279

Query: 197 ISLGVGMKF 205
             +GV  KF
Sbjct: 280 FRVGVAYKF 288


>gi|90418791|ref|ZP_01226702.1| hypothetical protein SI859A1_00696 [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90336871|gb|EAS50576.1| hypothetical protein SI859A1_00696 [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 263

 Score = 90.5 bits (223), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 42/237 (17%), Positives = 71/237 (29%), Gaps = 55/237 (23%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M++L L +  ++        A AAD +           P       V     + G Y G 
Sbjct: 1   MKRLALLLATTAF----VTPALAADVIYEEPPA-----PAPMAIEPVATTATWTGLYIGG 51

Query: 61  SAL---------------------YNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDV 99
            A                            ++ +    G    GY+ + +  + G   D+
Sbjct: 52  QAGVAFGNESDGATFNPGGGGPFGTGTYSEDDDNAGFIGGGHIGYDYQINDFVVGAVADI 111

Query: 100 RYTVPVLADNIHSLHG----------IGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETG 149
            Y       +  +  G            G++R R GY + DS+LLY T G   A      
Sbjct: 112 NYIDAETNRSYTTGGGSTFSTSSDINYLGTVRARVGYAM-DSVLLYGTGGLAYAGVDNNA 170

Query: 150 KAGEITPIA-------------IGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGF 193
            A   +                IG   G GV+V   + ++   +EY  +     +  
Sbjct: 171 SAPASSGTFTNYTFEQDENDTDIGYAVGGGVDVMA-TNNISFGVEYLYTNLGSNDQT 226


>gi|92115908|ref|YP_575637.1| OmpA-like transmembrane region [Nitrobacter hamburgensis X14]
 gi|91798802|gb|ABE61177.1| OmpA-like transmembrane region [Nitrobacter hamburgensis X14]
          Length = 245

 Score = 90.5 bits (223), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 50/232 (21%), Positives = 80/232 (34%), Gaps = 41/232 (17%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K+ LA  V+ + +A+   AQAAD   R          T A        +++ G Y G 
Sbjct: 18  MKKILLA-SVAIVGMAAIVPAQAADLAAR--------PYTKAPVYEAAPIYNWTGFYLGG 68

Query: 61  ----------SALYNGSFGEEAHHNAGGSIFAGYNVE-DSCIMYGVEGDVRYTVPVLADN 109
                     +    G           G    GY+ +     ++G+     Y+     D+
Sbjct: 69  HVGGAFGGDHNLAAPGFTRNGNDGVFMGGGQIGYDYQFSPNWVFGIGA--NYSFLDTNDH 126

Query: 110 IHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAI-----GGTAG 164
                G+ GS+  R GY      LLYA  G   A    T   G  T         G T G
Sbjct: 127 PFVNRGL-GSVTGRLGYTW-GPALLYAKGGYAWADTRNTNGFGGDTFSNNRIGRDGFTVG 184

Query: 165 VGVEVGGLSESLVARLEYRASKYSKVEGF-----------YNTISLGVGMKF 205
            G+E    +++    +EY+   +                  +TI +G+  +F
Sbjct: 185 GGLEY-MFTQNWSGLIEYQYYDFGTTRTTFRNQDVRFRNDEHTIKVGLNYRF 235


>gi|83308665|emb|CAJ01573.1| outer membrane protein [uncultured bacterium]
          Length = 275

 Score = 90.5 bits (223), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 36/184 (19%), Positives = 57/184 (30%), Gaps = 43/184 (23%)

Query: 51  HDFNGPYAGLSALYNGS------------------FGEEAHHNAGGSIFAGYNVEDSCI- 91
             ++G Y G+   Y                     F         G    GYN++ +   
Sbjct: 51  FTWSGLYLGVQVGYAWGSDPVDEVDVLTPRFANNAFFNLQPKGVLGGAHVGYNLQFTNWN 110

Query: 92  -------MYGVEGDVRYTVPVLADNIHSL------HGIGGSLRIRGGYEVSDSLLLYATV 138
                  + G+EG V  +         S           GSLR R G    D LL+Y T 
Sbjct: 111 WLSSSGVVIGLEGSVDGSSLSGTRTSASGLTMRLRTETQGSLRARIGLAW-DRLLIYGTG 169

Query: 139 GPDVAQKYETGKA---------GEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSK 189
           G   A   +              + +    G T G GV+   ++ +    +EYR S + +
Sbjct: 170 GAAFAGFDDNYVTVFGTPFFVDEQDSKTRTGWTVGGGVDY-AITPNWSIGVEYRYSDFGR 228

Query: 190 VEGF 193
              +
Sbjct: 229 TTDY 232


>gi|260460749|ref|ZP_05808999.1| outer membrane protein [Mesorhizobium opportunistum WSM2075]
 gi|259033326|gb|EEW34587.1| outer membrane protein [Mesorhizobium opportunistum WSM2075]
          Length = 221

 Score = 90.1 bits (222), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 49/234 (20%), Positives = 79/234 (33%), Gaps = 50/234 (21%)

Query: 6   LAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYN 65
           L V  + L  A    A AADP                         D+ G YAG+ A Y 
Sbjct: 4   LIVASAGLLAALSVPALAADPTVDVPM--------------TAPGFDWTGYYAGMQAGYG 49

Query: 66  GSFGEEAHH---------NAGGSIFAGYN---VEDSCIMYGVEGDVRYTVPVLADNIHSL 113
               + +           + GG    G+     +    + G E D+ Y+      ++ + 
Sbjct: 50  WGQSDISGTGGGPFSVSPDIGGGFVGGHVAGLWQFDQAVIGAEADLNYSSVDGTADLGAG 109

Query: 114 H------GIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAG---EITPIAIGGTAG 164
           +         GS+  + GY V D +L+Y   G   A    +  AG     T   +G T G
Sbjct: 110 NTLGTDVKWFGSVNAKAGYAV-DRVLVYGIGGVAFAGIETSQSAGAAFSETRTNVGWTVG 168

Query: 165 VGVEVGGLSESLVARLEYRASKYS-------------KVEGFYNTISLGVGMKF 205
            GV+   L++  V   +YR   +                +   NT+ + +  KF
Sbjct: 169 AGVDY-ALTDKFVVGAQYRYYDFGSEHFDGSNGFADRDQDTKLNTVGVNLSYKF 221


>gi|300024284|ref|YP_003756895.1| porin [Hyphomicrobium denitrificans ATCC 51888]
 gi|299526105|gb|ADJ24574.1| porin [Hyphomicrobium denitrificans ATCC 51888]
          Length = 218

 Score = 90.1 bits (222), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 43/191 (22%), Positives = 69/191 (36%), Gaps = 27/191 (14%)

Query: 38  VPTIATNRYVPIRHDFNGPYAGLSALYNGSFGEEAH-HNAGGSIFAGYNVEDSCIMYGVE 96
            P  A   Y P    ++G Y G++  Y  S           G    GYN +   +++G+E
Sbjct: 32  PPPEAAPVYQPAI--WDGAYIGINGGYGWSDARPTEPEGGFGGGQIGYNWQRGRVVFGLE 89

Query: 97  GDV------RYTVPVLADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVA----QKY 146
           GD               D   S      ++R R G+  S   LLYAT G  VA    +  
Sbjct: 90  GDFQGADISGRAYTFDGDTARSDMNWFSTVRGRLGFT-SGPWLLYATGGLAVADVDHRAN 148

Query: 147 ETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRA------------SKYSKVEGFY 194
             G++   +    G   G G+E    S++  A+ EY                + ++    
Sbjct: 149 LEGQSFRGSDTLTGYAVGGGLE-WKFSQNWSAKAEYLYLGLGDSKLTADNGDFVRINNDV 207

Query: 195 NTISLGVGMKF 205
            T+ +G+   F
Sbjct: 208 QTVRVGLNYHF 218


>gi|15420180|gb|AAK97312.1|AF308170_1 Pap31 [Bartonella henselae phage 60457]
          Length = 240

 Score = 90.1 bits (222), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 46/253 (18%), Positives = 77/253 (30%), Gaps = 92/253 (36%)

Query: 13  LALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSFGEEA 72
           +AL S  +AQAAD +         V   +A          + G Y G      G+F  + 
Sbjct: 1   IALISASAAQAADVI---------VPHEVAPTVISAPAFSWTGFYIGGQV---GNFSSKV 48

Query: 73  H-------------------HNAGGSIFAGYNVEDSC-IMYGVEGDVRYTV--------- 103
                                   G I+AG N+     ++ GVE D  +           
Sbjct: 49  EITDPNKKDKLFSKDDTPKPSGFMGGIYAGSNMSLGNNMILGVETDAVWADREDAKTSSA 108

Query: 104 ------------------------PVLADNIHS----------LHGIGGSLRIRGGYEVS 129
                                      +D++                 G+ R+R G+  +
Sbjct: 109 KVIREDELANFKDSLKNANAVFAKDKTSDDVKQDEKHTDSLALKEKWSGATRVRIGFTAA 168

Query: 130 DSLLLYATVGP------DVAQKYETGKAG----------EITPIAIGGTAGVGVEVGGLS 173
           D ++ Y   G        V+    T  A           + T   +G T G GV+   ++
Sbjct: 169 DRIMPYVAGGVSYAQVQAVSSTKVTQAADDAEIASAQLFDKTKTLVGFTLGGGVDF-AMT 227

Query: 174 ESLVARLEYRASK 186
           ++++ R EYR S 
Sbjct: 228 DNVLLRAEYRYSD 240


>gi|115522754|ref|YP_779665.1| porin [Rhodopseudomonas palustris BisA53]
 gi|115516701|gb|ABJ04685.1| porin [Rhodopseudomonas palustris BisA53]
          Length = 446

 Score = 90.1 bits (222), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 32/175 (18%), Positives = 51/175 (29%), Gaps = 30/175 (17%)

Query: 48  PIRHDFNGPYAGLSALYNGSFGEEAH------------HNAGGSIFAGYNVEDSCIMYGV 95
               ++ G Y G +     +                      G    GYN + +  ++G 
Sbjct: 241 APVANWAGFYLGGNFGSGTARERTTATRVATEQFNLAPDGFIGGGQIGYNWQAANWVFGG 300

Query: 96  EGDVRYTVPVLA--------DNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYE 147
           E D + +             D+  +      ++R R GY V  S L Y T G  V     
Sbjct: 301 EADFQGSTQRDNRTIVQGGVDSYDAKLPWLATVRGRLGYSV-GSTLFYGTGGYAVGSVKT 359

Query: 148 T----GKAGEITPIAIGGTAGVGVEVGG-----LSESLVARLEYRASKYSKVEGF 193
           +          T    G TAG G+E           +  ++ EY       V   
Sbjct: 360 SIATPAFTETFTKTKSGWTAGAGIETPFTLFNLFGPNWTSKTEYLYVDLGSVNNT 414



 Score = 81.6 bits (200), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 42/215 (19%), Positives = 66/215 (30%), Gaps = 42/215 (19%)

Query: 8   VGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGS 67
           +      + +  SAQAAD   +A +    +V            +D+ G Y G++A     
Sbjct: 4   ILAGVALVGTAVSAQAADLAVKAPYLKAPIV----------AVYDWTGFYIGVNAGVGLG 53

Query: 68  FGEEAHH--------------NAGGSIFAGYNVEDSCI----MYGVEGDVRYTVPVLADN 109
                H+               A G    GYN + +      + G+E D++ T       
Sbjct: 54  RDLATHNITPAAFATTYLQPQGALGGGQVGYNWQTNSFLGPLVLGLEADIQGTGMSDDRT 113

Query: 110 I--------HSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETG----KAGEITPI 157
                           G+ R R G      +L Y T G        T      +  I   
Sbjct: 114 NLFGNVAAYSQKLDWFGTARGRIGLA-KGPVLSYFTGGFAYGNVKTTVTEGLASDSINRT 172

Query: 158 AIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEG 192
             G T G GVE   L  +   ++EY        + 
Sbjct: 173 QTGWTIGSGVEA-ALGGNWTGKIEYLYVNLGNKDD 206


>gi|299132804|ref|ZP_07025999.1| Carbohydrate-selective porin OprB [Afipia sp. 1NLS2]
 gi|298592941|gb|EFI53141.1| Carbohydrate-selective porin OprB [Afipia sp. 1NLS2]
          Length = 694

 Score = 89.7 bits (221), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 47/193 (24%), Positives = 72/193 (37%), Gaps = 35/193 (18%)

Query: 40  TIATNRYVPIRHDFNGPYAGLSALY----------NGSFGEEAHHN--AGGSIFAGYNVE 87
                       D++G Y G    Y          +G+     +H   A   + AGYNV 
Sbjct: 69  AADFPVKAAPVFDWSGAYVGAHFAYGFGSSHASVFDGASFNTRNHFGTATAGVQAGYNVV 128

Query: 88  DSCIM-YGVEGDVRYTVPVLADN-----------IHSLHGIGGSLRIRGGYEVSDSLLLY 135
               +  GVE D+ +   + +             +       GSLR R GY  +   LLY
Sbjct: 129 LPSRVLLGVEADLSFPNYIESSGGVAVTPTMNGTLTERLDYAGSLRARLGYA-APRWLLY 187

Query: 136 ATVGPDVA--QKYETGKAGEITPIAI--GGTAGVGVEVGGLSESLVARLEYRASKYSKVE 191
            T G   A  +   T  A +   +++  G  AGVG E   +     AR+EY  S Y +  
Sbjct: 188 VTGGLAFAGERFEYTSPAFDDKKLSLRTGWIAGVGAEY-AIGPKWSARVEYLYSDYGR-- 244

Query: 192 GFYNTISLGVGMK 204
              + + LG G++
Sbjct: 245 ---DHVQLGSGLQ 254


>gi|3426106|emb|CAA07721.1| hypothetical protein [Rhizobium leguminosarum]
          Length = 139

 Score = 89.7 bits (221), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 32/138 (23%), Positives = 47/138 (34%), Gaps = 18/138 (13%)

Query: 4   LFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSAL 63
           ++  +   +    S   A AAD V +         P            D++G Y GL   
Sbjct: 1   MYTKIIALAAVAFSAVPAFAADAVVQD--------PAYVQQGQTQSAFDWSGFYLGLQGG 52

Query: 64  YNG------SFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIG 117
           Y           E+        I+ GYN +    ++G+E D  Y      D         
Sbjct: 53  YTSTHASYLDGSEQDLDGGSTGIYGGYNFQHGPFVFGIENDFNYNWK---DGSDVSLKWD 109

Query: 118 GSLRIRGGYEVSDSLLLY 135
           GS R R GY + D  L+Y
Sbjct: 110 GSARGRVGYAL-DRTLIY 126


>gi|319899124|ref|YP_004159217.1| Hemin binding protein d [Bartonella clarridgeiae 73]
 gi|319403088|emb|CBI76643.1| Hemin binding protein d [Bartonella clarridgeiae 73]
          Length = 303

 Score = 89.7 bits (221), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 50/316 (15%), Positives = 86/316 (27%), Gaps = 124/316 (39%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M++L      S  AL     AQAAD V          +PT+ +    P    + G Y G 
Sbjct: 1   MKRLTT----SIFALLLVSEAQAADFV---IPYQSSTIPTVIS----PPHFSWTGIYFGG 49

Query: 61  SAL--------YNGSFGEEAH-----------HNAGGSIFAGYNVEDSC-IMYGVEGDVR 100
                      Y  + GE                  G ++AG + + +  ++ G + D+ 
Sbjct: 50  HVGGFEGPSTSYMSTQGERQKLLFKNNPSPKFSGVIGGLYAGASFDVNNGLVLGFDTDIN 109

Query: 101 YTVPVLADNIHS---------------------------------------LHGIGGSLR 121
           ++      ++                                              G+ R
Sbjct: 110 WSGAKDEKSVDMDSFVMALRKMDNVSNKDNVSNKIFPGFSLEQFISLKQTLKQKWVGATR 169

Query: 122 IRGGYEVSDSLLLYATVGPDVAQKYETG-------------------------------- 149
           +R G+   D ++ Y   G       +                                  
Sbjct: 170 VRIGFGF-DRIMPYVAGGVAYTHLKDVYVMETVTQETLKTGIRQSSQSSQSSQSSQSSQS 228

Query: 150 -----------KAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGF----- 193
                               IG T G G++   ++++L+ R EYR S ++  E       
Sbjct: 229 SQSSQSSQLDFSMESEKKTMIGFTIGGGLD-LAVTDNLILRAEYRYSDFNNKEFTKERFT 287

Query: 194 ----YNTISLGVGMKF 205
                N  S+GV  KF
Sbjct: 288 IKYKSNGFSVGVAYKF 303


>gi|239832169|ref|ZP_04680498.1| Hypothetical protein, conserved [Ochrobactrum intermedium LMG 3301]
 gi|239824436|gb|EEQ96004.1| Hypothetical protein, conserved [Ochrobactrum intermedium LMG 3301]
          Length = 212

 Score = 89.3 bits (220), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 46/221 (20%), Positives = 79/221 (35%), Gaps = 26/221 (11%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           +++   AV + +  +A   SA AAD +    +     V +          HD++G Y G 
Sbjct: 2   LKRSITAVALGAAIVAFAGSAFAADMMGATDYSYNDPVASGP--------HDWSGNYIGA 53

Query: 61  SALYNGSFGE---EAHHNAGGSIFAGYNVEDSCIMYGVE--GDVRYTVPVLADNIHSLHG 115
               + S           A G +  G N++   +++G E  G+       +         
Sbjct: 54  QIGASSSKVPGPFTNRTGALGGVVVGKNMQSGNVVFGAELEGNFAEAEHRIGHGGSLQQS 113

Query: 116 IGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSES 175
             G+ + + GY   D  L+Y T G  V +               G   G GVE   L+  
Sbjct: 114 WNGNAKGKVGYAF-DKTLVYGTAGYGVTRFKAKDNTTSAPGWEGGALIGAGVE-QALTGP 171

Query: 176 LVARLEYRASKYSKVEG-----------FYNTISLGVGMKF 205
           L  + EY   ++S V+              ++I  G+  KF
Sbjct: 172 LSVKAEYDFQRFSDVKSRVNGVEQRNNLKNHSIKAGLNYKF 212


>gi|85713978|ref|ZP_01044967.1| possible outer membrane protein [Nitrobacter sp. Nb-311A]
 gi|85699104|gb|EAQ36972.1| possible outer membrane protein [Nitrobacter sp. Nb-311A]
          Length = 453

 Score = 88.9 bits (219), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 47/221 (21%), Positives = 70/221 (31%), Gaps = 44/221 (19%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+++ L V ++S A+    SAQAAD   R                 +   +D+ G Y G+
Sbjct: 1   MKRILLGVLLASTAM----SAQAADLAPR----------PYTKAPPMAPVYDWTGLYLGV 46

Query: 61  SALYNGSFGEEAHH-------------NAGGSIFAGYNVED----SCIMYGVEGDVRYTV 103
           +A          H               A G    GYN +       I++GVE D++   
Sbjct: 47  NAGLGVGRNRAVHDFGPLAISTHLQPLGAVGGGQIGYNWQTNSFFGPIVFGVEADLQGAD 106

Query: 104 PVLADNIHSLH-------GIGGSLRIRGGYEVSDSLLLYATVGPDVAQ---KYETGKAGE 153
                                G+ R R G  V+  ++ Y T G            G    
Sbjct: 107 MTDNRTNFIGALQYNQRLNWFGTARGRVGL-VNGPMMTYLTGGWAYGNVGTTVIQGGVPS 165

Query: 154 I-TPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGF 193
                  G T G GVE   L  +   ++EY          F
Sbjct: 166 AFGGGRSGWTWGSGVEA-ALGGNWTGKIEYLYLDLGNRTDF 205



 Score = 72.4 bits (176), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 36/186 (19%), Positives = 59/186 (31%), Gaps = 41/186 (22%)

Query: 46  YVP-IRHDFNGPYAGLSALYNGSFGEE--------------AHHNAGGSIFAGYNVEDSC 90
           YVP +  ++NG Y G +                        A +   G    GYN +   
Sbjct: 234 YVPMVTANWNGLYLGGNFGGGVGRNRTTISNPAGNLAQFNLAPNGFVGGGQIGYNWQAGN 293

Query: 91  IMYGVEGDVRYT-----------VPVLADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVG 139
           I++G+E D + +           VP  + + +S     G++R R GY V +S + YAT G
Sbjct: 294 IVFGLETDFQGSTLEDNKACFFCVPGASVDFNSKLQWFGTVRGRLGYAVGNS-MFYATGG 352

Query: 140 PDVAQKYETGKAG----EITPIAIGGTAGVGVEV----------GGLSESLVARLEYRAS 185
                              +    G   G G+E                +  +  EY   
Sbjct: 353 FAYGNVQTALNTPLNNFSFSNTRTGYAVGGGIETPLPLVNLFGGPLFGPNWTSTTEYLYV 412

Query: 186 KYSKVE 191
              +  
Sbjct: 413 DLGRSS 418


>gi|158425587|ref|YP_001526879.1| putative outer-membrane immunogenic protein [Azorhizobium
           caulinodans ORS 571]
 gi|158332476|dbj|BAF89961.1| putative outer-membrane immunogenic protein [Azorhizobium
           caulinodans ORS 571]
          Length = 202

 Score = 88.9 bits (219), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 33/143 (23%), Positives = 55/143 (38%), Gaps = 8/143 (5%)

Query: 52  DFNGPYAGLSALYN-GSFGEEAHHNAGGSIFAGYNVEDSC--IMYGVEGDVRYTVPVLAD 108
            + G Y G +  Y  GS G ++     G + AGYN++ +   I+ G+E D  +       
Sbjct: 40  SWTGFYVGGNIGYGWGSAGADSPKGFLGGLQAGYNLQMAGSPIVLGLETDFDWAGMNDG- 98

Query: 109 NIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVE 168
             +      G++R R G+   D +L+Y T G    +          +  + G   G G E
Sbjct: 99  --NYSQDYIGTVRARAGFAF-DRVLIYGTAGFAYGKGSYQVFGLSNSQTSYGWALGAGAE 155

Query: 169 VGGLSESLVARLEYRASKYSKVE 191
              +  +  AR EY         
Sbjct: 156 Y-AIDRNWSARAEYMYVDLGNST 177


>gi|148258659|ref|YP_001243244.1| OmpA domain-containing protein [Bradyrhizobium sp. BTAi1]
 gi|146410832|gb|ABQ39338.1| putative outer membrane protein with ompA domain [Bradyrhizobium
           sp. BTAi1]
          Length = 662

 Score = 88.6 bits (218), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 44/175 (25%), Positives = 62/175 (35%), Gaps = 31/175 (17%)

Query: 44  NRYVPIRHDFNGPYAGLSALYN-------------GSFGEEAHHNAGGSIFAGYNV-EDS 89
            R      D++G Y G  A Y              G+          G + AGYN    S
Sbjct: 35  ARMAQTVFDWSGIYVGAHAGYTRDHAQASLIDPIGGAGAGSRFSGLTGGVQAGYNWVTRS 94

Query: 90  CIMYGVEGDVRYTVPVL-----------ADNIHSLHGIGGSLRIRGGYEVSDSLLLYATV 138
            ++ G EGD  +   +              ++  L     S R R GY   D  L+YAT 
Sbjct: 95  GLLLGFEGDFSFPNSLTSNHTVAMLNRPGSSVSELWDYVASARGRIGYAQGD-WLVYATG 153

Query: 139 G--PDVAQKYETGKAGEIT--PIAIGGTAGVGVEVGGLSESLVARLEYRASKYSK 189
           G      +   T  AG+       +G TAG G+E    +     RLEY  S++  
Sbjct: 154 GLAWTGGRFINTTAAGDEKLLTTRVGWTAGAGIE-RAFAPHWSWRLEYLYSQFEN 207


>gi|240849917|ref|YP_002971306.1| hemin binding protein A [Bartonella grahamii as4aup]
 gi|240267040|gb|ACS50628.1| hemin binding protein A [Bartonella grahamii as4aup]
          Length = 296

 Score = 88.6 bits (218), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 50/303 (16%), Positives = 82/303 (27%), Gaps = 116/303 (38%)

Query: 7   AVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNG 66
            +  S   L S  +AQAAD +         +               + G Y G      G
Sbjct: 6   LIATSVATLISASAAQAADVMIPHEVAPAVIA--------AAPSFSWTGFYLGGQV---G 54

Query: 67  SFGEEAH-------------------HNAGGSIFAGYNVEDSC-IMYGVEGDVRYTVPVL 106
           +F  +                         G I+AG NV+    ++ GVE D  +     
Sbjct: 55  NFSSKTKVTIPGEERELFKKDNIPSPSGFMGGIYAGSNVDLGNGLILGVETDAVWADREE 114

Query: 107 ADNIHS----------------------------------------LHGIGGSLRIRGGY 126
           +                                                  G+ R+R G+
Sbjct: 115 SKKARELTLTEKNAADFNAALEKAKVELKDQQQFQKDDKVTETHSYKEKWSGATRVRIGF 174

Query: 127 EVSDSLLLYATVGPD-------------VAQKYETGKAG--------------------- 152
              D ++ Y   G                 +     KAG                     
Sbjct: 175 AAVDRIMPYVAGGIAYAQVQGIQSVAGKGERAKVEQKAGGDEIVPEAGAKQSIDLTGGTW 234

Query: 153 -EITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFYNT---------ISLGVG 202
            + T   +G T G GV+   ++++++ R EYR S + K +   +T           +GV 
Sbjct: 235 ADDTKTMLGFTIGGGVDF-AMTDNVLLRAEYRYSDFGKKKFANDTREFNYKTNDFRVGVA 293

Query: 203 MKF 205
            KF
Sbjct: 294 YKF 296


>gi|148252036|ref|YP_001236621.1| putative 31 kDa outer-membrane immunogenic protein [Bradyrhizobium
           sp. BTAi1]
 gi|146404209|gb|ABQ32715.1| putative 31 kDa outer-membrane immunogenic protein precursor
           [Bradyrhizobium sp. BTAi1]
          Length = 219

 Score = 88.2 bits (217), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 38/176 (21%), Positives = 66/176 (37%), Gaps = 26/176 (14%)

Query: 51  HDFNGPYAGLSALYNGSFGEEAHHNAG----------GSIFAGYNVE-DSCIMYGVEGDV 99
             + G YAG +     +  +   + AG          G + AGYN +     + G+E D+
Sbjct: 45  FSWTGFYAGANVGGAFTGNDSVTNLAGGNGGKLSGVIGGMQAGYNYQVSPLFVVGIENDL 104

Query: 100 RYTVPVLADNI---HSLHGIGGSLRIRGGYEVSD-SLLLYATVGPDVAQKYETGKAGEIT 155
            +T      ++           + R R G+ + D  L LY T G    +  +    G + 
Sbjct: 105 DFTGLSRQGDLVNPAVSVPWLTTGRARAGFTMLDQRLFLYGTAGLAAGELKD----GPVH 160

Query: 156 PIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFY------NTISLGVGMKF 205
            + +G TAG G E   L     A+LEY  +               +++ +G+   F
Sbjct: 161 KVKMGWTAGGGAEWAFL-PKWSAKLEYLYTDLKHDALPDWRAAKIHSVRVGLNYHF 215


>gi|153009238|ref|YP_001370453.1| hypothetical protein Oant_1908 [Ochrobactrum anthropi ATCC 49188]
 gi|151561126|gb|ABS14624.1| conserved hypothetical protein [Ochrobactrum anthropi ATCC 49188]
          Length = 212

 Score = 88.2 bits (217), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 46/221 (20%), Positives = 79/221 (35%), Gaps = 26/221 (11%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           +++   AV + +  +A   SA AAD +    +     V            HD++G Y G 
Sbjct: 2   LKRSITAVALGAAIVAFAGSAFAADMMGATDYSYNDPVAAGP--------HDWSGNYVGA 53

Query: 61  SALYNGSFGE---EAHHNAGGSIFAGYNVEDSCIMYGVE--GDVRYTVPVLADNIHSLHG 115
               + S           A G +  G N++   +++G E  G+       + +       
Sbjct: 54  QVGASSSRVPGPFTNRTGALGGVVVGKNMQSGNVVFGGELEGNFAEAEHRIGNGGSLQQS 113

Query: 116 IGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSES 175
             G+ + + GY   D  L+Y T G  V +               G   G GVE   LS  
Sbjct: 114 WNGNAKGKVGYAF-DKTLVYGTAGYGVTRFKAKDNTTSAPGWEGGALVGAGVE-QALSGP 171

Query: 176 LVARLEYRASKYSKVEG-----------FYNTISLGVGMKF 205
           L  + EY   +++ V+              ++I  G+  KF
Sbjct: 172 LSVKAEYDFQRFNDVKSRVNGVEQRNNLKNHSIKAGLNYKF 212


>gi|319404477|emb|CBI78084.1| Hemin binding protein D [Bartonella rochalimae ATCC BAA-1498]
          Length = 267

 Score = 88.2 bits (217), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 45/273 (16%), Positives = 81/273 (29%), Gaps = 84/273 (30%)

Query: 8   VGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSAL---- 63
           +  S   L S    QA D V    +      P +     +     + G Y G        
Sbjct: 4   LTASVFTLFSISIVQATDFV--IPYQSYTASPVV-----LSSTFSWTGFYFGGKIGVFSG 56

Query: 64  -------------YNGSFGEEAH---HNAGGSIFAGYNVEDSC-IMYGVEGDVRYTVPV- 105
                        +N  F  ++        G ++ G N+  +   + G + D+ ++    
Sbjct: 57  QSTSSFIDSNNVKHNIIFQNQSSPKLSGVVGGLYTGLNININNGFVLGFDTDINWSGAKD 116

Query: 106 ----------LADNIHSLH-----------GIGGSLRIRGGYEVSDSLLLYATVGPDVAQ 144
                      ADN                    ++R R G+   D ++ Y   G  V +
Sbjct: 117 TKVIDIIASLKADNNKKSQIDFDIKQSLQQKWLSAIRGRIGFSF-DRVMPYIAGGISVTK 175

Query: 145 KYETGK-----------------------AGEITPIAIGGTAGVGVEVGGLSESLVARLE 181
              T                         +   + I  G T G G++   ++++ + R E
Sbjct: 176 LQSTYLKFFVPSKNNSLTRSSLEKTPPVLSTSNSKIMNGYTIGGGLDF-AITDNFILRAE 234

Query: 182 YRASKYSKVEGFYNTISL---------GVGMKF 205
           Y  S + K E   N +++         GV  KF
Sbjct: 235 YNYSDFGKKEFVNNNMNVSYKSNAFYFGVACKF 267


>gi|90419518|ref|ZP_01227428.1| possible outer membrane protein [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90336455|gb|EAS50196.1| possible outer membrane protein [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 273

 Score = 87.8 bits (216), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 43/240 (17%), Positives = 71/240 (29%), Gaps = 58/240 (24%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+   L++  +S AL     AQAAD +              A     P+   + G Y G+
Sbjct: 1   MRTYLLSILTASTALTFASYAQAADVIYEEPM-------APAPMEISPVASGWTGIYLGV 53

Query: 61  SAL----------------------------YNGSFGEEAHHNAGGSIFAGYNVEDSCIM 92
                                          +  +F      +  G    GY+ +   ++
Sbjct: 54  QGGGAFNPQDPDNVDLRTNGFAFGGSAVQTAFGSNFDSNVDSSFLGGAHIGYDYQMDSVV 113

Query: 93  YGVEGDVRYTVPVLADNIHSLH----------GIGGSLRIRGGYEVSDSLLLYATVGPDV 142
           +GV  D+       + N  S               G++R R GY V+   L Y T G   
Sbjct: 114 FGVLADINAIDLTRSSNADSNAPAYYRTDRELNYLGTVRARVGYLVTPDALAYVTGGLAY 173

Query: 143 AQ------------KYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKV 190
                            T         + G T G G+EV   ++++    EY  +     
Sbjct: 174 GDVDYSFSTNSPAVTGATPAVVSEDEDSFGYTVGGGMEV-KFTDNMSFGAEYLYTNLGGS 232


>gi|76885942|gb|ABA60112.1| pap31-like protein [Bartonella bacilliformis]
          Length = 300

 Score = 87.8 bits (216), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 49/310 (15%), Positives = 87/310 (28%), Gaps = 120/310 (38%)

Query: 4   LFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSAL 63
           +   V  S  AL S  +AQAAD +          +P   +         + G Y G    
Sbjct: 3   IKCLVTASVCALISASAAQAADVM----------IPQEISPIISAPTFSWTGLYLGGQIG 52

Query: 64  ----------------YNGSFGEEAHHNAGGSIFAGYNVEDSC-IMYGVEGDVRYTVPV- 105
                           +  +  +       G ++AG N++    ++ GV+ D+ +     
Sbjct: 53  GLSGKHDFKAIGKDSEWPFANKDLKVSGFVGGLYAGSNIDLGSGLVLGVDTDIVWVDKEG 112

Query: 106 -----------------------------------LADNIHSLHGIGGSLRIRGGYEVSD 130
                                              L  N        G+ R+R G+  +D
Sbjct: 113 KLFSNHRAETQDDADAFKQIFDENKIEVAKGQIKELTQNFSLKEKWAGATRVRIGFG-AD 171

Query: 131 SLLLYATVGPDVAQKYETGKA--------------------------------------- 151
            ++ Y + G    Q    G A                                       
Sbjct: 172 RIMPYVSGGVAYTQVQAIGSAILKGTKDTGTEGGGGTEGGGGTEGGGGSASKAVRSEALD 231

Query: 152 -------GEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFYNTI------- 197
                   +     +G T G GV+   ++++++ R EYR S + K +   + I       
Sbjct: 232 VLASGTITDEKKTLLGYTLGAGVDF-AMTDNVILRTEYRYSDFGKKKFVKDAIETNYKTN 290

Query: 198 --SLGVGMKF 205
              +GV  KF
Sbjct: 291 DFRVGVAYKF 300


>gi|121602865|ref|YP_989466.1| omp25/ropB family outer membrane protein [Bartonella bacilliformis
           KC583]
 gi|120615042|gb|ABM45643.1| outer membrane protein, omp25/ropB family [Bartonella bacilliformis
           KC583]
          Length = 300

 Score = 87.8 bits (216), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 49/310 (15%), Positives = 87/310 (28%), Gaps = 120/310 (38%)

Query: 4   LFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSAL 63
           +   V  S  AL S  +AQAAD +          +P   +         + G Y G    
Sbjct: 3   IKCLVTASVCALISASAAQAADVM----------IPQEISPIISAPTFSWTGLYLGGQIG 52

Query: 64  ----------------YNGSFGEEAHHNAGGSIFAGYNVEDSC-IMYGVEGDVRYTVPV- 105
                           +  +  +       G ++AG N++    ++ GV+ D+ +     
Sbjct: 53  GLSGKHDFKAIGKDSEWPFANKDLKVSGFVGGLYAGSNIDLGSGLVLGVDTDIVWVDKEG 112

Query: 106 -----------------------------------LADNIHSLHGIGGSLRIRGGYEVSD 130
                                              L  N        G+ R+R G+  +D
Sbjct: 113 KLSSNHKAETQDDADAFKQIFDENKIEVAKGQIKELTQNFSLKEKWAGATRVRIGFG-AD 171

Query: 131 SLLLYATVGPDVAQKYETGKA--------------------------------------- 151
            ++ Y + G    Q    G A                                       
Sbjct: 172 RIMPYVSGGVAYTQVQAIGSAILKGTKDTGTEGGGGTEGGGGTEGGGGSASKAVRSEALD 231

Query: 152 -------GEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFYNTI------- 197
                   +     +G T G GV+   ++++++ R EYR S + K +   + I       
Sbjct: 232 VLASGTITDEKKTLLGYTLGAGVDF-AMTDNVILRTEYRYSDFGKKKFVKDAIETNYKTN 290

Query: 198 --SLGVGMKF 205
              +GV  KF
Sbjct: 291 DFRVGVAYKF 300


>gi|39933549|ref|NP_945825.1| OmpA-like transmembrane domain-containing protein [Rhodopseudomonas
           palustris CGA009]
 gi|39647395|emb|CAE25916.1| OmpA-like transmembrane domain [Rhodopseudomonas palustris CGA009]
          Length = 736

 Score = 87.8 bits (216), Expect = 9e-16,   Method: Composition-based stats.
 Identities = 45/195 (23%), Positives = 68/195 (34%), Gaps = 41/195 (21%)

Query: 49  IRHDFNGPYAGLSALY----------NGSFGEEAHHNAGG---SIFAGYNVEDS-CIMYG 94
             +D++G Y G  A Y          + +   +  + AGG      AGYN      ++ G
Sbjct: 113 PAYDWSGFYVGAHAGYVRGHAGATLQDATSVAQNSNGAGGITAGAQAGYNFVTGSNLLLG 172

Query: 95  VEGDVRY-----------TVPVLADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDV- 142
           VE D+ +                  N        G++R R G  ++   L Y T G    
Sbjct: 173 VEADISFPSYLPQNAVLSEFDNGTANTLQHLDYYGTVRARLGV-IAGRWLGYVTGGLAFE 231

Query: 143 -AQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSK------------ 189
             +       G +    IG  AG GVE  G + +  AR+EY  S+Y              
Sbjct: 232 HERYLTDPDVGRVMNARIGWAAGAGVEY-GFTPNWSARVEYLYSQYQNATVDLPTGASYA 290

Query: 190 VEGFYNTISLGVGMK 204
                 T+ +GV  K
Sbjct: 291 TSLNLQTVRVGVNRK 305


>gi|15420178|gb|AAK97311.1|AF308169_1 Pap31 [Bartonella henselae phage 60457]
          Length = 239

 Score = 87.4 bits (215), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 46/252 (18%), Positives = 77/252 (30%), Gaps = 92/252 (36%)

Query: 13  LALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSFGEEA 72
           +AL S  +AQAAD +         V   +A          + G Y G      G+F  + 
Sbjct: 1   IALISPSAAQAADVI---------VPHEVAPTVISAPAFSWTGFYIGGQV---GNFSSKV 48

Query: 73  H-------------------HNAGGSIFAGYNVEDSC-IMYGVEGDVRYTVP-------- 104
                                   G I+AG N++    ++ GVE D  +           
Sbjct: 49  EITDPNKKDKLFSKDDTPKPSGFMGGIYAGSNMDLGNNMILGVETDAVWADREDAKTSSA 108

Query: 105 -----------------------------------VLADNIHSLHGIGGSLRIRGGYEVS 129
                                                 D++       G+ R+R G+  +
Sbjct: 109 KVIREDELANFKDSLKNANAVFAKDKTMDDVKQDEKHTDSLALKEKWSGATRVRIGFTAA 168

Query: 130 DSLLLYATVGP------DVAQKYETGKAG----------EITPIAIGGTAGVGVEVGGLS 173
           D ++ Y   G        V+    T  A           + T   +G T G GV+   ++
Sbjct: 169 DRIMPYVAGGVSYAQVQAVSSTKVTQAADDAEIASAQLFDKTKTLVGFTLGGGVDF-AMT 227

Query: 174 ESLVARLEYRAS 185
           ++++ R EYR S
Sbjct: 228 DNVLLRAEYRYS 239


>gi|85713475|ref|ZP_01044465.1| carbohydrate-selective porin OprB [Nitrobacter sp. Nb-311A]
 gi|85699379|gb|EAQ37246.1| carbohydrate-selective porin OprB [Nitrobacter sp. Nb-311A]
          Length = 668

 Score = 87.4 bits (215), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 42/184 (22%), Positives = 69/184 (37%), Gaps = 34/184 (18%)

Query: 37  VVPTIATNRYVPIRHDFNGPYAGLSALYNGSFGE---------EAHHNAGG---SIFAGY 84
            +PT A          + G Y G  A + G                ++ GG    + AGY
Sbjct: 37  SIPTKAVPH---PIIQWTGLYLGAHAGFGGGRSTATLADPAPITTGNDFGGLISGVQAGY 93

Query: 85  NVEDSC-IMYGVEGDVRYTVPVLAD-----------NIHSLHGIGGSLRIRGGYEVSDSL 132
           N++    ++ GVE D+ +   + ++           ++       GS R R GY  +   
Sbjct: 94  NLQLPSGLLLGVETDISFPSYIESNSFVSKLATARSDVTHQWDFIGSARGRIGYA-TGPW 152

Query: 133 LLYATVGPDVA--QKYETGKAGEITPIA---IGGTAGVGVEVGGLSESLVARLEYRASKY 187
           L YAT G  +A  +      +G+        +G  AG G+E    +    ARLEY   ++
Sbjct: 153 LTYATGGLAIAGERYLNDPPSGDREKTLGSRLGWVAGAGLEY-AFAPHWSARLEYLYYQF 211

Query: 188 SKVE 191
            K  
Sbjct: 212 DKTN 215


>gi|90426297|ref|YP_534667.1| OmpA-like transmembrane region [Rhodopseudomonas palustris BisB18]
 gi|90108311|gb|ABD90348.1| OmpA-like transmembrane region [Rhodopseudomonas palustris BisB18]
          Length = 251

 Score = 86.6 bits (213), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 46/233 (19%), Positives = 80/233 (34%), Gaps = 41/233 (17%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K  L   V+ +A+A+   A AAD              T A        +++ G Y G 
Sbjct: 22  MKKFLLGT-VALVAMATTVPALAADL--------GARTYTKAPAYVAAPIYNWTGFYIGG 72

Query: 61  SALYNGSFGEEAHHNAG----------GSIFAGYNVED-SCIMYGVEGDVRYTVPVLADN 109
                G+F  +     G          G +  GY+ +     + GVE    +        
Sbjct: 73  HVG--GAFVGDDSIGTGATRSSDGTFLGGVQGGYDYQFAPNWVLGVEAQYSWLDQGTDPV 130

Query: 110 IHSLHGIG------GSLRIRGGYEVSDSLLLYATVGPDVAQ----KYETGKAGEITPIAI 159
           +   +         GS+  R GY      LLYA  G   A         G    ++  + 
Sbjct: 131 LVGPYSFSDKQKGLGSVTGRIGYTW-GPALLYAKGGYAFADYDTTVTLGGVGAAVSSKSD 189

Query: 160 GGTAGVGVEVGGLSESLVARLEYRASKYSKVE-------GFYNTISLGVGMKF 205
           G T G G+E    +++   ++EY+   +  V+          + +  G+  +F
Sbjct: 190 GYTVGAGLEYL-FAQNWSGKVEYQYYDFGNVDFGGFSFKNDEHVVKAGLNYRF 241


>gi|146340936|ref|YP_001205984.1| putative outer-membrane protein [Bradyrhizobium sp. ORS278]
 gi|146193742|emb|CAL77759.1| putative outer-membrane protein, putative secreted protein
           [Bradyrhizobium sp. ORS278]
          Length = 217

 Score = 86.6 bits (213), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 54/233 (23%), Positives = 76/233 (32%), Gaps = 44/233 (18%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K+ LA    +   A                      PT      +     + G Y G 
Sbjct: 1   MKKILLATVALAALAAPAA------------AADLAARPTYTKAPVLAPVPTWAGFYLGA 48

Query: 61  SALY----NGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLA--------- 107
              Y    NG         AGG+I  GYN +    +YG+E D  +     +         
Sbjct: 49  FGGYATTDNGGVLSPKGGFAGGTI--GYNWQSGAWVYGLEADAAWADIKDSVGGVVPGFG 106

Query: 108 -DNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYET----GKAGEITPIAIGGT 162
              I S     G+ R R GY   +++LLY T G   A    T    G     T    G T
Sbjct: 107 AVGIASKIDATGTARGRVGYAF-NNVLLYGTGGYAWANNKITLSALGVGVSDTQFLSGWT 165

Query: 163 AGVGVEVGGLSESLVARLEYRASKYSKVEGF----------YNTISLGVGMKF 205
           AG GVEV   +     + EY    +     F           +++ +GV   F
Sbjct: 166 AGGGVEVL-FAPKWSVKAEYLYKSFDGKTYFGGALPTGNLNLHSVQVGVNYHF 217


>gi|15420176|gb|AAK97310.1|AF308168_1 Pap31 [Bartonella henselae phage 60457]
          Length = 245

 Score = 86.6 bits (213), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 47/251 (18%), Positives = 76/251 (30%), Gaps = 86/251 (34%)

Query: 11  SSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSFGE 70
           S +AL S  +AQAAD +         V   +A          + G Y G       S  E
Sbjct: 5   SVIALISASAAQAADVI---------VPHEVAPTVISAPAFSWTGFYIGGQVGNFSSKVE 55

Query: 71  EAH----------------HNAGGSIFAGYNVEDSC-IMYGVEGDVRYTV---------- 103
                                  G I+AG N++    ++ GVE D  +            
Sbjct: 56  ITDPNKKDKLFSKDDTPKPSGFMGGIYAGSNMDLGNNMILGVETDAVWADREDAKTSSAE 115

Query: 104 ---------------------------------PVLADNIHSLHGIGGSLRIRGGYEVSD 130
                                                D++       G+ R+R G+  +D
Sbjct: 116 AIGQDELETFRDSLKKANAAFAQGKTSDNVAAVDKHTDSLALKEKWSGATRVRIGFTAAD 175

Query: 131 SLLLYATVGP------DVAQKYETGKAG----------EITPIAIGGTAGVGVEVGGLSE 174
            ++ Y   G        V+    T  A           + T   +G T G GV+   +++
Sbjct: 176 RIMPYVAGGVSYAQVQAVSSTKVTQAADDAEIATAQLFDKTKTLVGFTLGGGVDF-AMTD 234

Query: 175 SLVARLEYRAS 185
           +++ R EYR S
Sbjct: 235 NVLLRAEYRYS 245


>gi|27379826|ref|NP_771355.1| outer-membrane immunogenic protein [Bradyrhizobium japonicum USDA
           110]
 gi|27352979|dbj|BAC49980.1| blr4715 [Bradyrhizobium japonicum USDA 110]
          Length = 283

 Score = 86.2 bits (212), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 44/252 (17%), Positives = 72/252 (28%), Gaps = 75/252 (29%)

Query: 1   MQKLFLAVGVSSLALASF-CSAQAADPVRRAHHGGRGVVPTIATNRYV-PIRHDFNGPYA 58
           M+     V    +A+ +   +A AAD             PT             +NG Y 
Sbjct: 1   MKNFEKLVLAGVVAVGAAWGTAHAADLA-----------PTYKMPVKAIAPVQTWNGFYV 49

Query: 59  GLSALYNGSFGEE------------------------------AHHNAGGSIFAGYNVE- 87
           G +  Y+ S G                                +     G + AGYN + 
Sbjct: 50  GGNVGYDWSTGSTGISVLSTDPALAAPLAALVAAGSFPTALSPSAKGVIGGVQAGYNWQV 109

Query: 88  DSCIMYGVEGDVRYT--------------VPVLADNIHSLHGIGGSLRIRGGYEVSDSLL 133
               + G+E D +                    +  +       G++R R G  V+   L
Sbjct: 110 APQWLVGLEADFQGADVKGTTTQALAPVGFDATSTTVSKGIDWFGTVRGRVGVLVAPQWL 169

Query: 134 LYATVGPDVAQKYET----------------GKAGEITPIAIGGTAGVGVEVGGLSESLV 177
           LY T G    +   +                  +G  +  + G TAG G EV   + +  
Sbjct: 170 LYGTGGFAYGRTKSSFSTTDVTGGCIVGATICASGASSGTSTGWTAGAGTEV-MFAPNWS 228

Query: 178 ARLEYRASKYSK 189
            + EY      +
Sbjct: 229 FKAEYLYVDLGR 240


>gi|86747693|ref|YP_484189.1| OmpA-like transmembrane domain-containing protein [Rhodopseudomonas
           palustris HaA2]
 gi|86570721|gb|ABD05278.1| OmpA-like transmembrane domain [Rhodopseudomonas palustris HaA2]
          Length = 661

 Score = 86.2 bits (212), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 40/171 (23%), Positives = 62/171 (36%), Gaps = 29/171 (16%)

Query: 48  PIRHDFNGPYAGLSALY----------NGSFGEEAHHNAGG---SIFAGYN-VEDSCIMY 93
               D++G Y G  A Y          + +F       +GG      AGYN +  + +++
Sbjct: 40  SPAMDWSGFYVGAHAGYVRGHADARLQDPTFAASQSSGSGGVTAGAQAGYNILTRAGVLF 99

Query: 94  GVEGDVRY-----------TVPVLADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDV 142
           GVE D+ +                           G+LR R G   +   L Y T G   
Sbjct: 100 GVEADISFPSYLPANAVLSEFDNATSTAQQHIDFYGTLRARLGVA-AGRWLGYVTGGLAY 158

Query: 143 A--QKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVE 191
              +      AG++    IG  AG G+E  G + +  AR+EY  S +    
Sbjct: 159 EHERYLTEPGAGKVLNGRIGWAAGAGLEY-GFTPNWSARIEYLYSDFGNAS 208


>gi|49474419|ref|YP_032461.1| hemin binding protein E [Bartonella quintana str. Toulouse]
 gi|21689909|gb|AAM68132.1| hemin-binding protein E [Bartonella quintana]
 gi|49239923|emb|CAF26323.1| Hemin binding protein E [Bartonella quintana str. Toulouse]
          Length = 299

 Score = 85.9 bits (211), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 50/302 (16%), Positives = 78/302 (25%), Gaps = 112/302 (37%)

Query: 8   VGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSAL---- 63
           +  S  A       QAAD +         V+P +           + G Y G        
Sbjct: 6   IIGSVFAFIPASVVQAADVI--VPQQSEQVIPPVIA----SPPFSWTGFYFGGQIGGFSS 59

Query: 64  ------------Y--NGSFGEEAHHN----------------AGGSIFAGYNVEDSC-IM 92
                       Y  N  F +E   N                  G  + G N+E     +
Sbjct: 60  KISAMTSDVASPYVDNLFFPDEESKNKKWVSVEKKYMPELSGFIGGGYTGANLELGNGFI 119

Query: 93  YGVEGDVRYTVPVLADNI------------------------------------------ 110
            GVE D+  +       +                                          
Sbjct: 120 LGVETDILVSKRKDTKTVVFSDKSDQKITLVEGTKGETDGHTEEDSLGQLIGVSRLKEAE 179

Query: 111 --------HSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYE-----------TGKA 151
                          G+ R+R G+ V   ++ Y + G    Q  +               
Sbjct: 180 ENSLTVSHTLKQKWTGATRVRVGFPVE-RMMPYISGGVAYGQFQDIFSMSITGEDADFTT 238

Query: 152 GEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFY--------NTISLGVGM 203
            + T   IG T G GV+   +++  + R EYR S + K +           N   +GV  
Sbjct: 239 VDDTKAMIGYTLGGGVDF-AMTDHFIVRAEYRYSDFGKKKFQERIELNYKTNDFRVGVAY 297

Query: 204 KF 205
           KF
Sbjct: 298 KF 299


>gi|156739568|gb|ABU93444.1| Omp25 [Brucella melitensis]
 gi|156739602|gb|ABU93461.1| Omp25 [Brucella suis]
          Length = 66

 Score = 85.9 bits (211), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 19/68 (27%), Positives = 35/68 (51%), Gaps = 2/68 (2%)

Query: 110 IHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEV 169
           +    G  GSLR R GY++ + ++ Y T G   +Q        + +   +G TAG G+E 
Sbjct: 1   LEVKQGFEGSLRARVGYDL-NPVMPYLTAGIAGSQIKLNNGLDDESKFRVGWTAGAGLEA 59

Query: 170 GGLSESLV 177
             L+++++
Sbjct: 60  -KLTDNIL 66


>gi|15420170|gb|AAK97307.1|AF308165_1 Pap31 [Bartonella henselae phage 60457]
          Length = 243

 Score = 85.5 bits (210), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 47/251 (18%), Positives = 76/251 (30%), Gaps = 86/251 (34%)

Query: 11  SSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSFGE 70
           S +AL S  +AQAAD +         V   +A          + G Y G       S  E
Sbjct: 3   SVIALISASAAQAADVI---------VPHEVAPTVISAPAFSWTGFYIGGQVGNFSSKVE 53

Query: 71  EAH----------------HNAGGSIFAGYNVEDSC-IMYGVEGDVRYTV---------- 103
                                  G I+AG N++    ++ GVE D  +            
Sbjct: 54  ITDPNKKDKLFSKDDTPKPSGFMGGIYAGSNMDLGNNMILGVETDAVWADREDAKTSSAE 113

Query: 104 ---------------------------------PVLADNIHSLHGIGGSLRIRGGYEVSD 130
                                                D++       G+ R+R G+  +D
Sbjct: 114 AIGQDELETFRDSLKKANAAFAQGKTSDNVAAVDKHTDSLALKEKWSGATRVRIGFTAAD 173

Query: 131 SLLLYATVGP------DVAQKYETGKAG----------EITPIAIGGTAGVGVEVGGLSE 174
            ++ Y   G        V+    T  A           + T   +G T G GV+   +++
Sbjct: 174 RIMPYVAGGVSYAQVQAVSSTKVTQAADDAEIATAQLFDKTKTLVGFTLGGGVDF-AMTD 232

Query: 175 SLVARLEYRAS 185
           +++ R EYR S
Sbjct: 233 NVLLRAEYRYS 243


>gi|260466904|ref|ZP_05813087.1| porin [Mesorhizobium opportunistum WSM2075]
 gi|259029300|gb|EEW30593.1| porin [Mesorhizobium opportunistum WSM2075]
          Length = 238

 Score = 85.5 bits (210), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 42/209 (20%), Positives = 73/209 (34%), Gaps = 56/209 (26%)

Query: 51  HDFNGPYAGLSALYNG-------SFGEEAHHNAG---------GSIFAGYNVEDSC-IMY 93
           ++++G Y G  A Y         +F   +  + G         G ++AG N +    ++ 
Sbjct: 32  YNWSGAYIGAQAGYAWANARVGQTFAPGSFDDYGWGYNPSGGFGGLYAGVNHQFDSGLVL 91

Query: 94  GVEGDVRYTVPVLAD------------NIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPD 141
           G+E D  +                            GSLR+R GY V D  L + T G  
Sbjct: 92  GIEADYSFAGVKDTTHYRALGVDDPAFGGELKLDTVGSLRLRAGYAV-DRWLPFVTGGLA 150

Query: 142 VAQKY-------ETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSK----- 189
           VA           +    ++     G T G G E   ++++ + R EYR + + +     
Sbjct: 151 VASYKHTTVNLPGSTPYADVKGTVAGYTLGAGAEY-AVTDNWLVRGEYRFADFGRHTSVR 209

Query: 190 -------------VEGFYNTISLGVGMKF 205
                        V+   + + +GV  KF
Sbjct: 210 HSLVNGAPLNPDAVDLTTHDLRIGVAYKF 238


>gi|154244432|ref|YP_001415390.1| porin [Xanthobacter autotrophicus Py2]
 gi|154158517|gb|ABS65733.1| porin [Xanthobacter autotrophicus Py2]
          Length = 283

 Score = 85.5 bits (210), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 40/249 (16%), Positives = 68/249 (27%), Gaps = 77/249 (30%)

Query: 18  FCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSFG-------- 69
           F +  AA  V         +   +      P    + G Y G +A Y  + G        
Sbjct: 5   FVAVFAA-SVMSGAACAADLAVAVTKAPPAPASFSWTGFYIGGNAGYAWNSGTLDGVGYI 63

Query: 70  -----------------EEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLAD---- 108
                                ++  G   AGYN +    + G E D+ Y           
Sbjct: 64  YGSDYGSYSNGWFNGQRSSESNSFTGGAQAGYNYQIGRAVLGFEADINYADASKTYAASS 123

Query: 109 ----------------------NIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKY 146
                                 +  +     G++R R G    D LL+YAT G    +  
Sbjct: 124 TYDLYPYPVDRPDYNYHLREQLDASASVEWFGTIRARLGVTALDRLLVYATGGAAYGKVS 183

Query: 147 ET------------------------GKAGEITPIAIGGTAGVGVEVGGLSESLVARLEY 182
            +                        G  G  + +  G T G G+E   +++++  + EY
Sbjct: 184 GSGSYSWREYGFWWGGPGDHAFDRSGGFGGTDSSVRWGWTVGGGLEY-AITDNITVKGEY 242

Query: 183 RASKYSKVE 191
                   +
Sbjct: 243 LYVDLGSND 251


>gi|27383307|ref|NP_774836.1| outer-membrane immunogenic protein [Bradyrhizobium japonicum USDA
           110]
 gi|27356481|dbj|BAC53461.1| bll8196 [Bradyrhizobium japonicum USDA 110]
          Length = 278

 Score = 85.5 bits (210), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 44/249 (17%), Positives = 69/249 (27%), Gaps = 69/249 (27%)

Query: 2   QKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLS 61
           ++L LA  ++   +A    + AAD             P +     V     + G Y G S
Sbjct: 5   KQLSLASIIAFGTIAFGSGSLAADLP---------AAPVVKAPAPVYPLFSWTGGYIGGS 55

Query: 62  ALYNGSFGEE----------------------------------AHHNAGGSIFAGYNVE 87
                   +                                     +   G + AGYN +
Sbjct: 56  VGSGWGTSQTDLAVGNTFIGAPVNQTVNQLIGGTADLNVPLPQVQLNGFLGGVQAGYNFQ 115

Query: 88  DSCIMYGVEGDVRYTVPVLAD------NIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPD 141
              ++YGVE D  ++            N  +       +  R G  V D  L+Y   G  
Sbjct: 116 SGVMVYGVESDFLWSGIKGRTGCFVVLNCTNDTKWIADITGRVGVTVGDRGLVYIKGGAA 175

Query: 142 VAQKYE-------------------TGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEY 182
            A                           G  T    GGT G G+E   L     A++EY
Sbjct: 176 WADSSIGINQSFAVTSNLGAGFAANGAADGRATKNIFGGTLGAGIEYAFL-PGWSAKVEY 234

Query: 183 RASKYSKVE 191
               + + +
Sbjct: 235 DYFDFGRQD 243


>gi|75674443|ref|YP_316864.1| outer membrane protein [Nitrobacter winogradskyi Nb-255]
 gi|74419313|gb|ABA03512.1| possible outer membrane protein [Nitrobacter winogradskyi Nb-255]
          Length = 241

 Score = 85.5 bits (210), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 47/227 (20%), Positives = 75/227 (33%), Gaps = 38/227 (16%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K+ LA  V+ L +A+   AQAAD   R +      VP           +++ G Y G 
Sbjct: 18  MKKILLA-SVAFLGMAAIVPAQAADLAPRPYTKAPPYVPA--------PIYNWTGFYLGG 68

Query: 61  SALYNG---------SFGEEAHHNAGGSIFAGYNVE-DSCIMYGVEGDVRYTVPVLADNI 110
                           F         G    GY+ +     ++G+E         L    
Sbjct: 69  HIGGAFGGPGNVLAPGFFNNNDGAFMGGGQVGYDTQFSPNWVFGIEA----NYSFLDTGS 124

Query: 111 HSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVG 170
              +   GS+  R GY      LLY   G   A    T           G T G G+E  
Sbjct: 125 FFANRGLGSVTARLGYTW-GPALLYVKGGYGWADSRFTNGF-AGNGGRDGYTVGGGLEYL 182

Query: 171 GLSESLVARLEYRASKYSKV------------EGFYNTISLGVGMKF 205
             +++   ++EY+      V                +T+ +G+  +F
Sbjct: 183 -FTQNWSGKVEYQYYDLGNVNFFGPLGGIGNFRNDQHTVKVGLNYRF 228


>gi|158425350|ref|YP_001526642.1| outer membrane protein Omp31 precursor [Azorhizobium caulinodans
           ORS 571]
 gi|158332239|dbj|BAF89724.1| outer membrane protein Omp31 precursor [Azorhizobium caulinodans
           ORS 571]
          Length = 233

 Score = 85.5 bits (210), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 42/196 (21%), Positives = 71/196 (36%), Gaps = 43/196 (21%)

Query: 51  HDFNGPYAGLSALYNGS----------FGEEAHHNAG--GSIFAGYNVED-SCIMYGVEG 97
             + G Y G +A + G           FG    +++G       GYN +  + ++ G+E 
Sbjct: 40  FSWTGFYIGANAGFGGDKYNYDFGAPGFGSATANSSGFFAGGQLGYNYQFANNVVLGLET 99

Query: 98  DVRYTVPVLAD---------NIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKY-- 146
           D++++               N++S     G++R R GY   D  L Y T G    +    
Sbjct: 100 DIQWSGIEGDTTLASGGSVANLNSSLDYFGTVRARVGYAF-DRFLPYITGGFAYGESKTS 158

Query: 147 ------ETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYS-----------K 189
                  T   GE +    G T G GVE    + +   + EY                  
Sbjct: 159 ITTITPTTLTFGEGSGTKTGWTLGGGVEY-AFTNNWTFKTEYLYVDLDDSNYGVGAGAVN 217

Query: 190 VEGFYNTISLGVGMKF 205
           V+  ++T+  G+  KF
Sbjct: 218 VDNKFHTVKAGINYKF 233


>gi|121602037|ref|YP_989465.1| omp25/ropB family outer membrane protein [Bartonella bacilliformis
           KC583]
 gi|120614214|gb|ABM44815.1| outer membrane protein, omp25/ropB family [Bartonella bacilliformis
           KC583]
          Length = 284

 Score = 85.1 bits (209), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 45/290 (15%), Positives = 79/290 (27%), Gaps = 91/290 (31%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+  +L+V    + L S     AAD V              +++ + P    + G Y G 
Sbjct: 1   MKMRYLSVLFG-ITLGSSSVVNAADVVVINKTEEEA---PASSSVFTPADLSWTGVYLGG 56

Query: 61  SAL----------YNGSFGEEAHH-------NAGGSIFAGYNVEDSC-IMYGVEGDVRYT 102
                        Y+ +                 G ++ G N++     + GVE D  ++
Sbjct: 57  QISGFSSKVDIDRYSDNTWSSVEKSLLPEISGFSGGLYVGSNIDLGEGFILGVETDALWS 116

Query: 103 VPVLADNIHSL------------------------------------------------H 114
                  + +                                                  
Sbjct: 117 NTGDKKTLPTKKVGAAHRLEAAERNREDEVVQERRVAAANNSAKAPEANVRMTGEYALRQ 176

Query: 115 GIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETG----------KAGEITPIAIGGTAG 164
              G+ R R G+ V    + Y T G    Q                + +   + +G   G
Sbjct: 177 QWIGATRARVGFAVE-RFMPYVTGGLAYGQLRGVNLLALATNNTENSEKEEKLMVGYAVG 235

Query: 165 VGVEVGGLSESLVARLEYRASKYSKVEGFY---------NTISLGVGMKF 205
            G++   +S ++  R EYR S   K +            N   +GV  KF
Sbjct: 236 AGLDF-AVSSNIFLRTEYRFSDLGKKKFANEKIEVNYKINDFRVGVAYKF 284


>gi|163869043|ref|YP_001610277.1| hemin binding protein [Bartonella tribocorum CIP 105476]
 gi|161018724|emb|CAK02282.1| hemin binding protein [Bartonella tribocorum CIP 105476]
          Length = 296

 Score = 84.7 bits (208), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 44/299 (14%), Positives = 81/299 (27%), Gaps = 97/299 (32%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRY----VPIRHDFNGP 56
           M+       +S     +  +AQAAD V           P+  ++R     V     ++G 
Sbjct: 1   MKT-KCLFVLSLFTFMTTSTAQAADTVISQQSQPSVSAPSSLSSRLSPVTVSAPFSWSGF 59

Query: 57  YAGLSALYNGSFG--------------------EEAHHNAGGSIFAGYNVEDSC-IMYGV 95
           Y G    +  S                                 +AG N++    ++   
Sbjct: 60  YFGGQLGHLSSKSTLNYAPESQGGKWALVDRGLSPKPTGFVAGFYAGSNIDLGNSLVVSF 119

Query: 96  EGDVRYTVPVLADNIHSL------------------------------------------ 113
           + D+ ++        +                                            
Sbjct: 120 DTDMIWSGKKNTQTDNGKKILDKLDSVHAAFHDAGIPIITSEVQDETIPNYSDIIVSSVT 179

Query: 114 --HGIGGSLRIRGGYEVSDSLLLYATVGPDVAQ----------------KYETGKAGEIT 155
                 G+ R R G+  S  L+ Y   G    Q                 + +G   + T
Sbjct: 180 LKEKWAGAARARIGFA-SHRLMPYIAGGVAYTQMQYILSLLTKSQEDSTVFASGDVFDKT 238

Query: 156 PIAIGGTAGVGVEVGGLSESLVARLEYRASKY---------SKVEGFYNTISLGVGMKF 205
              IG T G G +   +++ ++ R EYR + +          K+    +   LG+  KF
Sbjct: 239 KTMIGYTVGGGFD-LAMTDDIIMRTEYRYTDFFKQKFANDELKMSVQTHNFRLGIAYKF 296


>gi|83956056|ref|ZP_00964538.1| outer membrane protein [Sulfitobacter sp. NAS-14.1]
 gi|83839622|gb|EAP78801.1| outer membrane protein [Sulfitobacter sp. NAS-14.1]
          Length = 199

 Score = 84.7 bits (208), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 34/193 (17%), Positives = 64/193 (33%), Gaps = 33/193 (17%)

Query: 45  RYVPIRHDFNGPYAGLSALY-----------------NGSFGEEAH-HNAGGSIFAGYNV 86
                   + G Y G +  Y                 NG     +       ++ AGY+ 
Sbjct: 8   AEQAPAPAWTGGYVGGNISYGFGSLDANDDLASALTTNGFSDNLSEPDGVSAALRAGYDW 67

Query: 87  EDSCIMYGVEGDVRY-TVPVLADNIHSLHGIG------GSLRIRGGYEVSDSLLLYATVG 139
           +    ++G+  +  + +     + I +  G+        ++  RGGY V D+ L Y  +G
Sbjct: 68  QFGRGVFGLGAEYNFGSYDGDGEGILAGSGVDVEIQDMATIFARGGYLVKDNFLAYGLLG 127

Query: 140 PDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFY----- 194
              A+   +      +    G T G G E    +++     EY  + +  V+        
Sbjct: 128 YSQAEGEVSLGGDSESEDLDGVTIGFGGEY-MFTQNWTGYAEYTYTDFGDVDNTDGQLEA 186

Query: 195 --NTISLGVGMKF 205
               I  GV  +F
Sbjct: 187 DLQQIKFGVNYRF 199


>gi|91977250|ref|YP_569909.1| hypothetical protein RPD_2780 [Rhodopseudomonas palustris BisB5]
 gi|91683706|gb|ABE40008.1| conserved hypothetical protein [Rhodopseudomonas palustris BisB5]
          Length = 570

 Score = 84.7 bits (208), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 48/220 (21%), Positives = 71/220 (32%), Gaps = 55/220 (25%)

Query: 10  VSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSFG 69
           +S++  AS  +A AAD  R          P  A         ++ G Y G      G   
Sbjct: 8   LSAVLFASCGTAHAADIAR----------PPAADPI---AALNWTGFYLGAHLG-AGFGT 53

Query: 70  EEAHHNAGGSIF--------------AGYNVEDSC--IMYGVEGD------------VRY 101
            +  +  G SI+              AGYN +      + GVE D            + Y
Sbjct: 54  TKVDNPYGPSIYGDTVRVPKALAGLQAGYNWQAPGTAWVLGVEADASALDADGTDTCLAY 113

Query: 102 TVPVLADNIHSLHGIGGSLRIRGGYEV--SDSLLLYATVGPDV----------AQKYETG 149
           +   ++ N      + G+L  R G+        L+Y   G             A  Y   
Sbjct: 114 SGQFVSANCRVREHVLGTLTGRIGHAFGSQGRSLMYVKGGAAFLTSDLTMTTNAVDYLNR 173

Query: 150 KAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSK 189
            A E+     G T G G+E   LS     R EY  + +  
Sbjct: 174 PAAELKETRWGWTVGAGIE-HALSSGWAVRAEYDYADFGT 212


>gi|296445473|ref|ZP_06887430.1| putative outer-membrane immunogenic protein precursor [Methylosinus
           trichosporium OB3b]
 gi|296257039|gb|EFH04109.1| putative outer-membrane immunogenic protein precursor [Methylosinus
           trichosporium OB3b]
          Length = 210

 Score = 84.7 bits (208), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 46/174 (26%), Positives = 67/174 (38%), Gaps = 25/174 (14%)

Query: 50  RHDFNGPYAGLSALY-----NGSFGEEAHHNAGGSIFAGYNVE-DSCIMYGVEGDVRYTV 103
              + G Y GL+A       NG  G+ +    GG I  GYN++     + G+E D + T 
Sbjct: 41  VFSWTGAYVGLNAGGAFKADNGLGGDYSGVVGGGQI--GYNLQLSPLFVVGLETDFQGTS 98

Query: 104 PVLAD--NIHSLHGIGGSLRIRGGYEVSDS-LLLYATVGPDVAQKYETGKAGEITPIAIG 160
                           G++R R G  + DS LL Y T G    +      A   +    G
Sbjct: 99  LSRNTWFGQQVSLPWFGTVRGRVGVTLFDSQLLAYGTGGFAYGEVK----APWSSDTHTG 154

Query: 161 GTAGVGVEVGGLSESLVARLEYRASKYSKVEG---------FYNTISLGVGMKF 205
            TAG GVE   L  +  A++EY  +      G          ++T+  GV   F
Sbjct: 155 WTAGGGVEWAFL-PNWSAKVEYLYTDLQNNSGWGWVAPQRAKFHTVRAGVNYHF 207


>gi|319406584|emb|CBI80226.1| Hemin binding protein C [Bartonella sp. 1-1C]
          Length = 304

 Score = 84.7 bits (208), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 51/315 (16%), Positives = 84/315 (26%), Gaps = 121/315 (38%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M  +   +  S +AL +  +AQAAD       G   V         V     + G Y G 
Sbjct: 1   MNNMKCLITASVVALMTASAAQAADIKVPQEIGETIV---------VAPAFSWTGFYLGG 51

Query: 61  SALYNGSFGEEAH--------------------HNAGGSIFAGYNVEDSC-IMYGVEG-- 97
                 S    +                         G  +AG NV+    ++ GV+   
Sbjct: 52  QIGGFSSKTSFSSLADGDSKKWFPLDKKLSPKPSGFIGGFYAGSNVDLGNGLILGVDTDV 111

Query: 98  -------------------DVRYTVPVLADNIHS-------------------------- 112
                              D    VP  A +  +                          
Sbjct: 112 VFSGRKDTRNDTMTSELGKDKNNNVPTGAKDNGNPKPEKEPGKEPGKEPEKEPEKESDVK 171

Query: 113 --------LHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYE----------------- 147
                        G+ R+R G+  +D ++ Y   G    Q  +                 
Sbjct: 172 FTKYDHTLKAKWAGATRVRIGFA-ADRIMPYVAGGVAYTQLQDTFTTLTGIQKIPVQKAD 230

Query: 148 --------TGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFY----- 194
                        + +   IG T   GV+   ++++++ R EYR S + K +        
Sbjct: 231 GKDEETSGKSNTVDESKTMIGYTLAAGVDF-AMTDNVLLRAEYRYSDFGKKKLHNDKFEV 289

Query: 195 ----NTISLGVGMKF 205
               N   +GV  KF
Sbjct: 290 NYKANDFRVGVAYKF 304


>gi|156739550|gb|ABU93435.1| Omp25 [Brucella abortus]
 gi|156739554|gb|ABU93437.1| Omp25 [Brucella abortus]
 gi|156739570|gb|ABU93445.1| Omp25 [Brucella melitensis]
          Length = 65

 Score = 84.3 bits (207), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 19/67 (28%), Positives = 34/67 (50%), Gaps = 2/67 (2%)

Query: 111 HSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVG 170
               G  GSLR R GY++ + ++ Y T G   +Q        + +   +G TAG G+E  
Sbjct: 1   EVKQGFEGSLRARVGYDL-NPVMPYLTAGIAGSQIKLNNGLDDESKFRVGWTAGAGLEA- 58

Query: 171 GLSESLV 177
            L+++++
Sbjct: 59  KLTDNIL 65


>gi|192288904|ref|YP_001989509.1| carbohydrate-selective porin OprB [Rhodopseudomonas palustris
           TIE-1]
 gi|192282653|gb|ACE99033.1| Carbohydrate-selective porin OprB [Rhodopseudomonas palustris
           TIE-1]
          Length = 689

 Score = 84.3 bits (207), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 41/170 (24%), Positives = 62/170 (36%), Gaps = 29/170 (17%)

Query: 49  IRHDFNGPYAGLSALY----------NGSFGEEAHHNAGG---SIFAGYNVEDS-CIMYG 94
             +D++G Y G  A Y          + +   +  + AGG      AGYN      ++ G
Sbjct: 66  PAYDWSGFYVGAHAGYVRGHAGATLQDATSVAQNSNGAGGITAGAQAGYNFVTGSNLLLG 125

Query: 95  VEGDVRY-----------TVPVLADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDV- 142
           VE D+ +                  N        G++R R G  ++   L Y T G    
Sbjct: 126 VEADISFPSYLPQNAVLSEFDNGTANTLQHLDYYGTVRARLGV-IAGRWLGYVTGGLAFE 184

Query: 143 -AQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVE 191
             +      AG +    IG  AG GVE  G + +   R+EY  S+Y    
Sbjct: 185 HERYLTDPDAGRVMNARIGWAAGAGVEY-GFAPNWSVRIEYLYSQYQNAS 233


>gi|307946127|ref|ZP_07661462.1| putative outer membrane protein [Roseibium sp. TrichSKD4]
 gi|307769791|gb|EFO29017.1| putative outer membrane protein [Roseibium sp. TrichSKD4]
          Length = 256

 Score = 83.9 bits (206), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 41/193 (21%), Positives = 68/193 (35%), Gaps = 26/193 (13%)

Query: 8   VGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGS 67
           + + ++       A+AAD           V P + +   V     + G Y G  A  + +
Sbjct: 44  LVMCAVLGGLVAGAKAAD----MPVYDDFVTPNLPSAGSV-----WEGGYVGAEAGLSQT 94

Query: 68  FGEE---------AHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADN------IHS 112
             E          +  +A   +F GYN + S ++ GVE    Y       N      + +
Sbjct: 95  LTESKVPGAKSTASKMDAAFGLFGGYNWQVSRVVLGVEAGATYLGGQAKKNLSGVGQVKA 154

Query: 113 LHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGL 172
                 SLR R G     S + Y T G               + + +G   G G+EV  +
Sbjct: 155 GSQWSASLRGRVGLPFE-SFMPYLTAGLAATDHSTKANGKTHSALGVGLMFGGGLEV-AV 212

Query: 173 SESLVARLEYRAS 185
           SE+   R +Y  +
Sbjct: 213 SENWRVRADYSMT 225


>gi|319408966|emb|CBI82625.1| Hemin binding protein E [Bartonella schoenbuchensis R1]
          Length = 303

 Score = 83.9 bits (206), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 26/115 (22%), Positives = 43/115 (37%), Gaps = 24/115 (20%)

Query: 113 LHGIGGSLRIRGGYEVSDSLLLYATVGPD-------------VAQKYETGKAGEITPIAI 159
                G+ RIR G+  +D ++ Y   G                    E     + T   I
Sbjct: 191 NQKWTGATRIRIGFA-ADRIMPYIAGGVAYGQFQNILSLSSTATHDKELNNMSDETKTMI 249

Query: 160 GGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFYNTISL---------GVGMKF 205
           G T G G++   +++ ++ R EYR S + K +   ++  L         GV  KF
Sbjct: 250 GYTFGAGIDF-AMTDDIILRAEYRYSDFGKKKFAKDSFELHYKTNDFRAGVSYKF 303



 Score = 43.9 bits (102), Expect = 0.013,   Method: Composition-based stats.
 Identities = 15/59 (25%), Positives = 21/59 (35%), Gaps = 5/59 (8%)

Query: 5  FLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSAL 63
             +  S   LA+    QAAD +    +   GV P +      P    +NG Y G    
Sbjct: 4  KCLIATSIFTLAAISLVQAADSIVFKENYKMGVSPIVR-----PPTFSWNGFYIGGQVG 57


>gi|240849918|ref|YP_002971307.1| hemin binding protein B [Bartonella grahamii as4aup]
 gi|240267041|gb|ACS50629.1| hemin binding protein B [Bartonella grahamii as4aup]
          Length = 582

 Score = 83.9 bits (206), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 45/272 (16%), Positives = 83/272 (30%), Gaps = 75/272 (27%)

Query: 7   AVGVSSLALASFCSAQAADPVRR---AHHGGRGVVPTIA--------TNRYVPIRHDFNG 55
            +  SS+   +   A  A    +           VP+          ++      +  +G
Sbjct: 313 TLVKSSVTAPAVQPAAKAPTSVQSASQPSTAEKTVPSAPLVLARSGSSSEPAKASNGTSG 372

Query: 56  PYAGLSALYNGSFGEE-----------------------AHHNAGGSIFAGYNVEDSCIM 92
              G     +GS  +                        A  + GG   AG+  + +  +
Sbjct: 373 AQNGAHHGAHGSGSDANPHGASHGGGHGSGAHAHGANPHASRSHGGQNMAGHGAQSTQAV 432

Query: 93  -------YGVE------GDVRYTVPVLADNIHS--LHGIGGSLRIRGGYEVSDSLLLYAT 137
                  YG+E       ++        + ++       GG+ R+R G+  +D  + Y  
Sbjct: 433 DKNNSSVYGIEQMKRVASELGLDQEDEVETLNHTFKQNWGGATRVRIGFA-ADRFMPYLA 491

Query: 138 VGPDVA---------------QKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEY 182
            G                   +   +    + T   IG T G GV+   L ++++ R EY
Sbjct: 492 GGIAYGQFQDTISISVKDEDGRVVSSKNLADETKTMIGYTLGGGVDFSVL-DNVIVRAEY 550

Query: 183 RASKYS---------KVEGFYNTISLGVGMKF 205
           R S +          +V    N   +GV  KF
Sbjct: 551 RYSDFGKKKFAKEKFEVNYKTNDFRVGVAYKF 582



 Score = 42.3 bits (98), Expect = 0.037,   Method: Composition-based stats.
 Identities = 22/135 (16%), Positives = 42/135 (31%), Gaps = 30/135 (22%)

Query: 7   AVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNG 66
            +  S  +L S  +A AAD +               ++  V     + G Y G+ A   G
Sbjct: 6   LITASIFSLISTSTALAADVM------IPHQPAPSTSSAIVAPTFSWTGLYLGVQA---G 56

Query: 67  SFGEEAH--------------------HNAGGSIFAGYNVEDS-CIMYGVEGDVRYTVPV 105
            F  ++                         G  +AG N++     ++GV+ D+  +   
Sbjct: 57  GFSSKSDMALVDQEKNLPLDKEFSPKLSGFVGGFYAGSNIDLGDNFIFGVDTDLMISGKK 116

Query: 106 LADNIHSLHGIGGSL 120
               I        ++
Sbjct: 117 HTKTITIGAADNTTV 131


>gi|296446453|ref|ZP_06888397.1| putative outer-membrane immunogenic protein precursor [Methylosinus
           trichosporium OB3b]
 gi|296256088|gb|EFH03171.1| putative outer-membrane immunogenic protein precursor [Methylosinus
           trichosporium OB3b]
          Length = 210

 Score = 83.5 bits (205), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 41/194 (21%), Positives = 63/194 (32%), Gaps = 28/194 (14%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K   A+  + + LA     +AAD             P           + ++G YAGL
Sbjct: 1   MRKTVSALASTFVLLAG--DVRAADL-----------PPQATVFGGARPAYAWSGVYAGL 47

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSC-IMYGVEGDVRYTVPVLADNIHS----LHG 115
           +     S          G    GYN       + G+E D + T        +        
Sbjct: 48  NLGAGLSASGLDRSGILGGGQLGYNYRLGPLFVVGLETDFQGTSLGGDSGRYGFPSPRFD 107

Query: 116 IGGSLRIRGGY-EVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSE 174
             G+ R R G    SD LL + T G             +   +  G TAG G+E     +
Sbjct: 108 WFGTARGRVGVLPFSDHLLFFGTGGYAYGH--------DGDRMHDGWTAGGGLEWAFARD 159

Query: 175 SLVARLEYRASKYS 188
               + EY  + + 
Sbjct: 160 -WSVKAEYLYTDFG 172


>gi|86751713|ref|YP_488209.1| outer membrane protein [Rhodopseudomonas palustris HaA2]
 gi|86574741|gb|ABD09298.1| outer membrane protein [Rhodopseudomonas palustris HaA2]
          Length = 449

 Score = 83.5 bits (205), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 32/175 (18%), Positives = 46/175 (26%), Gaps = 30/175 (17%)

Query: 47  VPIRHDFNGPYAGLSALYNGSFGEEAH------------HNAGGSIFAGYNVEDSCIMYG 94
            P   ++ G Y G +     +                      G    GYN + S  ++G
Sbjct: 242 TPPPANWAGLYLGGNFGGATARNRTTSSVIFSENFNLSPDGFVGGGQIGYNWQASNWVFG 301

Query: 95  VEGDVRYTVPVLADNI--------HSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKY 146
            E D + +                +      G+ R R GY V  S L YAT G       
Sbjct: 302 AEADFQGSTQKDDRAAVLSSLLLYNQKLPWFGTARARLGYTV-GSTLFYATGGYAYGNVK 360

Query: 147 ETGKAGEITPIAI----GGTAGVGVEVGG-----LSESLVARLEYRASKYSKVEG 192
                            G   G GVE        L  +  ++ EY          
Sbjct: 361 TNVVTAFSNETFNRSRSGYAVGAGVETPFQLFGLLGPNWTSKTEYLYVDLGSTTD 415



 Score = 77.0 bits (188), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 43/216 (19%), Positives = 70/216 (32%), Gaps = 46/216 (21%)

Query: 8   VGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGS 67
           + V    + S  SAQAAD   +A +              +   +D+ G Y G +      
Sbjct: 4   ILVGVALIGSAVSAQAADLAVKAPYLK----------APIAAVYDWTGFYIGANVGVGLG 53

Query: 68  FGEEAHHNAGGSI-------------FAGYNVED-----SCIMYGVEGDVRYTV------ 103
              + H    G +               GYN +        ++ GVE D++ +       
Sbjct: 54  RDLQTHAVPAGGVASHLSPQGVIGGGQIGYNWQSNTTFLGPLLIGVEADIQGSGMTDGHT 113

Query: 104 ----PVLADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKY--ETGKAG----E 153
               P+ A N +       ++R R G  V   ++ Y T G   A      T   G     
Sbjct: 114 TLSSPLGAANYNQKLDWFTTVRGRVGL-VRGPVVGYFTGGFAAANVKTTVTQIGGIVPFA 172

Query: 154 ITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSK 189
            +    G T G GVE   +  +   ++EY       
Sbjct: 173 FSETRTGWTIGSGVEA-AIGGNWTGKIEYLYLDLGN 207


>gi|300024536|ref|YP_003757147.1| porin [Hyphomicrobium denitrificans ATCC 51888]
 gi|299526357|gb|ADJ24826.1| porin [Hyphomicrobium denitrificans ATCC 51888]
          Length = 232

 Score = 83.2 bits (204), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 43/194 (22%), Positives = 63/194 (32%), Gaps = 37/194 (19%)

Query: 41  IATNRYVPIRHDFNGPYAGLSALYNGSFGEEAHH-------------------NAGGSIF 81
            A    +     + GPY G                                       + 
Sbjct: 13  AAATPVLAGEPSWTGPYIGAHVGGAWGNASTTDDPRDWGNDPKFIGPFDQNPVGVIAGLT 72

Query: 82  AGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLH-----------GIGGSLRIRGGYEVSD 130
           AGYNV+ S I+ GVEGD+ Y     A +  S             GI G++  R G+  + 
Sbjct: 73  AGYNVQLSNIVLGVEGDIGYLGLDSALDTPSSQSGNHQSIVLDSGIYGAVTARAGFLATP 132

Query: 131 SLLLYATVGPDVAQKYETGKAGEI------TPIAIGGTAGVGVEVGGLSESLVARLEYRA 184
           S L+Y   G        T            T    G  AG G+E   L+++L  ++EY  
Sbjct: 133 STLVYGKGGFAFYNGDATQSTTADGYVFHGTGTFTGWVAGGGIE-QRLTDNLSIKVEYLH 191

Query: 185 SKYSKVEGFYNTIS 198
             +    G   +IS
Sbjct: 192 FDFGSQAGDQTSIS 205


>gi|316934003|ref|YP_004108985.1| porin [Rhodopseudomonas palustris DX-1]
 gi|315601717|gb|ADU44252.1| porin [Rhodopseudomonas palustris DX-1]
          Length = 578

 Score = 83.2 bits (204), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 45/223 (20%), Positives = 68/223 (30%), Gaps = 55/223 (24%)

Query: 7   AVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNG 66
           ++   S  LA+ C A AAD  R                       ++ G Y G      G
Sbjct: 16  SIICVSAVLAASCGAHAADLPR-------------PPAAKAVAVWNWTGFYLGAHLG-AG 61

Query: 67  SFGEEAHHNAGGSIF--------------AGYNVEDSC--IMYGVEGD------------ 98
               +  +  G SI+              AGY  +      + GVE D            
Sbjct: 62  FGTAKVDNPFGASIYGDTVRAPKALAGLQAGYTWQAPGSAWVLGVEVDASAIDADGTDTC 121

Query: 99  VRYTVPVLADNIHSLHGIGGSLRIRGGYEV--SDSLLLYATVGPDV----------AQKY 146
           + Y+   ++ N      + G+L  R G+        LLY   G             A  Y
Sbjct: 122 LAYSGQFVSANCRIREHVLGTLTGRLGHAFGAQGRSLLYVKGGGAFLIGNLTMTTNASDY 181

Query: 147 ETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSK 189
                 E+     G T G G+E   L+     R EY  + + +
Sbjct: 182 LAQPGAELNATRWGWTVGAGIE-HALTPRWSVRAEYDYANFGR 223


>gi|156739548|gb|ABU93434.1| Omp25 [Brucella abortus]
 gi|156739556|gb|ABU93438.1| Omp25 [Brucella abortus]
 gi|156739560|gb|ABU93440.1| Omp25 [Brucella melitensis]
 gi|156739564|gb|ABU93442.1| Omp25 [Brucella melitensis]
 gi|156739578|gb|ABU93449.1| Omp25 [Brucella melitensis]
 gi|156739582|gb|ABU93451.1| Omp25 [Brucella melitensis]
 gi|156739584|gb|ABU93452.1| Omp25 [Brucella melitensis]
 gi|156739588|gb|ABU93454.1| Omp25 [Brucella melitensis]
 gi|156739592|gb|ABU93456.1| Omp25 [Brucella suis]
 gi|156739598|gb|ABU93459.1| Omp25 [Brucella suis]
 gi|156739620|gb|ABU93470.1| Omp25 [Brucella pinnipedialis]
 gi|156739622|gb|ABU93471.1| Omp25 [Brucella pinnipedialis]
 gi|156739624|gb|ABU93472.1| Omp25 [Brucella pinnipedialis]
 gi|156739626|gb|ABU93473.1| Omp25 [Brucella pinnipedialis]
          Length = 64

 Score = 83.2 bits (204), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 19/66 (28%), Positives = 34/66 (51%), Gaps = 2/66 (3%)

Query: 112 SLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGG 171
              G  GSLR R GY++ + ++ Y T G   +Q        + +   +G TAG G+E   
Sbjct: 1   VKQGFEGSLRARVGYDL-NPVMPYLTAGIAGSQIKLNNGLDDESKFRVGWTAGAGLEA-K 58

Query: 172 LSESLV 177
           L+++++
Sbjct: 59  LTDNIL 64


>gi|254719331|ref|ZP_05181142.1| 22 kDa outer membrane protein precursor [Brucella sp. 83/13]
 gi|265984332|ref|ZP_06097067.1| outer membrane protein 22 [Brucella sp. 83/13]
 gi|306839106|ref|ZP_07471923.1| 22 kDa outer membrane protein precursor [Brucella sp. NF 2653]
 gi|264662924|gb|EEZ33185.1| outer membrane protein 22 [Brucella sp. 83/13]
 gi|306405653|gb|EFM61915.1| 22 kDa outer membrane protein precursor [Brucella sp. NF 2653]
          Length = 212

 Score = 83.2 bits (204), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 46/220 (20%), Positives = 77/220 (35%), Gaps = 26/220 (11%)

Query: 2   QKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLS 61
           ++   A    +  +A   SA AAD +    +     V            HD++G Y G  
Sbjct: 3   KRSITAAAFGTAVMAFAGSAFAADMMGGTDYTYNDPVAAGP--------HDWSGNYVGAQ 54

Query: 62  ALYNGSFGEE---AHHNAGGSIFAGYNVEDSCIMYGV--EGDVRYTVPVLADNIHSLHGI 116
              + S       +   A G I  G N+++  I++G   EG+       +          
Sbjct: 55  VGGSSSKFPSPFASRTGALGGIVVGKNMQNGNIVFGAELEGNFAEAEHRIGHGGTLQQSW 114

Query: 117 GGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESL 176
            G+ + + GY   D  L+Y T G  V +               G   G GVE   LS  L
Sbjct: 115 NGNAKGKVGYAF-DKTLVYGTAGYGVTRFKAKENTTSAPGWEGGVLIGAGVE-QALSGPL 172

Query: 177 VARLEYRASKYSKVEG-----------FYNTISLGVGMKF 205
             + EY   +++ V+              ++I  G+  +F
Sbjct: 173 SVKAEYDFQRFNDVKSQVNGIEQRNNLKNHSIKAGLNYRF 212


>gi|148559641|ref|YP_001259198.1| hypothetical protein BOV_1247 [Brucella ovis ATCC 25840]
 gi|46251263|gb|AAS84602.1| Omp22 [Brucella ovis]
 gi|148370898|gb|ABQ60877.1| putative membrane protein [Brucella ovis ATCC 25840]
          Length = 212

 Score = 82.8 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 46/205 (22%), Positives = 72/205 (35%), Gaps = 26/205 (12%)

Query: 17  SFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSFGEE---AH 73
              SA AAD + R  +     V            HD++G Y G     + S       + 
Sbjct: 18  FAGSAFAADMMGRTDYTYNDPVAAGP--------HDWSGNYVGTQVGGSSSKFPSPFASR 69

Query: 74  HNAGGSIFAGYNVEDSCIMYGV--EGDVRYTVPVLADNIHSLHGIGGSLRIRGGYEVSDS 131
             A G I  G N+++  I++G   EG+       +           G+ + + GY   D 
Sbjct: 70  TGALGGIVVGKNMQNGNIVFGAELEGNFAEAEHRIGHGGTLQQSWNGNAKGKVGYAF-DK 128

Query: 132 LLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVE 191
            L+Y T G  V +               G   G GVE   LS  L  + EY   +++ V+
Sbjct: 129 TLVYGTAGYGVTRFKAKDNTTSAPGWEGGVLIGAGVE-QALSGPLSVKAEYDFQRFNDVK 187

Query: 192 G-----------FYNTISLGVGMKF 205
                         ++I  G+  KF
Sbjct: 188 SQVNGIEQRNNLKNHSIKAGLNYKF 212


>gi|237815697|ref|ZP_04594694.1| Hypothetical protein, conserved [Brucella abortus str. 2308 A]
 gi|237788995|gb|EEP63206.1| Hypothetical protein, conserved [Brucella abortus str. 2308 A]
          Length = 222

 Score = 82.8 bits (203), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 45/205 (21%), Positives = 72/205 (35%), Gaps = 26/205 (12%)

Query: 17  SFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSFGEE---AH 73
              SA AAD +    +     V            HD++G Y G     + S       + 
Sbjct: 28  FAGSAFAADMMGGTDYTYNDPVAAGP--------HDWSGNYVGAQVGGSSSKFPSPFASR 79

Query: 74  HNAGGSIFAGYNVEDSCIMYGVE--GDVRYTVPVLADNIHSLHGIGGSLRIRGGYEVSDS 131
             A G I  G N+++  I++G E  G+       +           G+ + + GY   D 
Sbjct: 80  TGALGGIVVGKNMQNGNIVFGAELEGNFAEAEHRIGHGGTLQQSWNGNAKGKVGYTF-DK 138

Query: 132 LLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVE 191
            L+Y T G  V +          +    G   G GVE   LS  L  + EY   +++ V+
Sbjct: 139 TLVYGTAGYGVTRFKAKDNTTSASGWEGGVLIGAGVE-QALSGPLSVKAEYDFQRFNDVK 197

Query: 192 G-----------FYNTISLGVGMKF 205
                         ++I  G+  KF
Sbjct: 198 SQVNGIEQRNNLKNHSIKAGLNYKF 222


>gi|254470977|ref|ZP_05084380.1| outer membrane protein, hypothetical [Pseudovibrio sp. JE062]
 gi|211960119|gb|EEA95316.1| outer membrane protein, hypothetical [Pseudovibrio sp. JE062]
          Length = 228

 Score = 82.8 bits (203), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 41/184 (22%), Positives = 70/184 (38%), Gaps = 29/184 (15%)

Query: 47  VPIRHDFNGPYAGLSALYNGSFGEEAHHNAGG-------SIFAGYNVEDSCIMYGVEGDV 99
            P  +D++G Y G+   +    G    +N+G         ++ GYN     I+ GVEG+ 
Sbjct: 49  TPPEYDWDGFYLGVQGGWARLHGTNRFNNSGSQYNGGTVGLYGGYNYTYQNILIGVEGEG 108

Query: 100 RY--TVPVLADNIHSLHGIGGSLRIRGG--YEVSDSLLLYATVGPDVAQKYETGKA---G 152
            Y          +        + +IR G  Y+     + Y T G  V+    +      G
Sbjct: 109 AYWAFGERSRGEMSLRSDYFAAAKIRAGLTYDW---FMAYVTGGAAVSTFRASNPNFGPG 165

Query: 153 EITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYS-----------KVEGFYNTISLGV 201
             +   +G   G G+E   ++E ++ RL+Y    +            K +   + I LGV
Sbjct: 166 TDSNTMLGWVGGAGLE-MFVTERIIVRLDYERIVFPGRSFTVGGTRFKEDIDSDAIRLGV 224

Query: 202 GMKF 205
             KF
Sbjct: 225 SYKF 228


>gi|39935611|ref|NP_947887.1| outer membrane protein [Rhodopseudomonas palustris CGA009]
 gi|39649464|emb|CAE27986.1| possible outer membrane protein [Rhodopseudomonas palustris CGA009]
          Length = 997

 Score = 82.8 bits (203), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 51/225 (22%), Positives = 74/225 (32%), Gaps = 46/225 (20%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+     + V S+   +  SA AAD               +A    VP   ++ G Y G 
Sbjct: 1   MKNFPAWLSVWSVVAVACGSAHAADLQN------------VAVPSAVPAATNWTGFYIGT 48

Query: 61  SALYNGS-------------------FGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRY 101
                 S                    G     NA   I  GYN +    + G+EGD  +
Sbjct: 49  HVGAAASESAWNSIAGSGAGLAAGPFPGHGVSGNAIAGIQGGYNAQFGNYVLGIEGDASF 108

Query: 102 -TVPVLADNIHSLHGIGG------SLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAG-- 152
            ++  LA  +H             +L  R GY   D LL+Y   G   A  +    +G  
Sbjct: 109 GSINGLARCLHGTFACTSRIDELWTLAARFGYAAGD-LLVYGKAGAAWADVHRRMASGNF 167

Query: 153 ----EITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGF 193
               E +    G   G GVE   L   L A++EY  + +      
Sbjct: 168 VNVLEASETRSGWLLGAGVEYAFL-PGLSAKIEYNYADFGNRSLT 211



 Score = 68.1 bits (165), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 37/181 (20%), Positives = 59/181 (32%), Gaps = 36/181 (19%)

Query: 52  DFNGPYAGLSALYNGSFGEEAH----------HNAGGSIFAGY---NVEDSCIMYGVEGD 98
           ++ G Y G S          A            + GG++  G    N +   ++ GVE  
Sbjct: 785 NWTGLYVGASVGAGWGRTTYADPFPTPTTGDRADLGGALLGGQIGANYQFGHLVAGVEAS 844

Query: 99  VRYTVPVLADNIHSLH------GIG--------GSLRIRGGYEVSDSLLLYATVGPDVAQ 144
             +      D     +      G          G+   RGGY + D  LLY   G    +
Sbjct: 845 ANWANIRGTDTCFGAYPNPVVAGFNCGSRIDAIGAFTARGGYAI-DRTLLYVKGGAAWDR 903

Query: 145 KYET-------GKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFYNTI 197
           + +        G     T    G T G G+E   L+ S    LEY+   +     F  ++
Sbjct: 904 QQDQFNTVGVGGTTLASTSTNWGWTVGGGLEY-ALAPSWSMALEYKYFDFGASPAFSTSV 962

Query: 198 S 198
           +
Sbjct: 963 T 963



 Score = 63.1 bits (152), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 44/217 (20%), Positives = 66/217 (30%), Gaps = 49/217 (22%)

Query: 34  GRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSFGEEAHHNAGGSIFA----------- 82
           G   V           +  + G Y G+ A   G FG     +A G++ A           
Sbjct: 240 GAASVSAAPLPGVPLPQWSWTGIYLGVHAG--GGFGSNDWDSATGALLAASTSGGFPGRG 297

Query: 83  -----------GYNVEDSCIMYGVEGDV------RYTVPVLADNI------HSLHGIGGS 119
                      G N +    + GVE          Y               H+     G+
Sbjct: 298 DSSGLFGGGQIGANYQFGRWVAGVEASAAAADIGGYAKCATDVGTRRNFTCHNELSSLGT 357

Query: 120 LRIRGGYEVSDSLLLYATVGPD-VAQKYETGKAGE-----ITPIAIGGTAGVGVEVGGLS 173
           +  R G    + LL+Y   G        +  +AG       +    G   G G+E   LS
Sbjct: 358 ITGRLGQTWGN-LLIYGKAGAAWATGSSDAQRAGSASRFTESGTRWGWVTGTGLEY-ALS 415

Query: 174 ESLVARLEYRASKYSK-----VEGFYNTISLGVGMKF 205
            +L A +EY    +       V+ F N   +G   KF
Sbjct: 416 PNLSAFVEYNHVDFGTQDTAYVDQFGNASEVGFKQKF 452


>gi|225852776|ref|YP_002733009.1| hypothetical protein BMEA_A1331 [Brucella melitensis ATCC 23457]
 gi|256044924|ref|ZP_05447827.1| hypothetical membrane protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|256263738|ref|ZP_05466270.1| outer membrane protein [Brucella melitensis bv. 2 str. 63/9]
 gi|260565476|ref|ZP_05835960.1| outer membrane protein [Brucella melitensis bv. 1 str. 16M]
 gi|265991350|ref|ZP_06103907.1| outer membrane protein [Brucella melitensis bv. 1 str. Rev.1]
 gi|225641141|gb|ACO01055.1| hypothetical membrane protein [Brucella melitensis ATCC 23457]
 gi|260151544|gb|EEW86638.1| outer membrane protein [Brucella melitensis bv. 1 str. 16M]
 gi|263002134|gb|EEZ14709.1| outer membrane protein [Brucella melitensis bv. 1 str. Rev.1]
 gi|263093797|gb|EEZ17802.1| outer membrane protein [Brucella melitensis bv. 2 str. 63/9]
 gi|326409306|gb|ADZ66371.1| conserved hypothetical protein [Brucella melitensis M28]
 gi|326539015|gb|ADZ87230.1| hypothetical membrane protein [Brucella melitensis M5-90]
          Length = 212

 Score = 82.4 bits (202), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 45/205 (21%), Positives = 72/205 (35%), Gaps = 26/205 (12%)

Query: 17  SFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSFGEE---AH 73
              SA AAD +    +     V            HD++G Y G     + S       + 
Sbjct: 18  FAGSAFAADMMGGTDYTYNDPVAAGP--------HDWSGNYVGAQVGGSSSKFPSPFASR 69

Query: 74  HNAGGSIFAGYNVEDSCIMYGVE--GDVRYTVPVLADNIHSLHGIGGSLRIRGGYEVSDS 131
             A G I  G N+++  I++G E  G+       +           G+ + + GY   D 
Sbjct: 70  TGALGGIVVGKNMQNGNIVFGAELEGNFAEAEHRIGHGGTLQQSWNGNAKGKVGYTF-DK 128

Query: 132 LLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVE 191
            L+Y T G  V +          +    G   G GVE   LS  L  + EY   +++ V+
Sbjct: 129 TLVYGTAGYGVTRFKAKDNTTSASGCEGGVLIGAGVE-QALSGPLSVKAEYDFQRFNDVK 187

Query: 192 G-----------FYNTISLGVGMKF 205
                         ++I  G+  KF
Sbjct: 188 SQVNGIEQRNNLKNHSIKAGLNYKF 212


>gi|261317611|ref|ZP_05956808.1| LOW QUALITY PROTEIN: porin [Brucella pinnipedialis B2/94]
 gi|265988645|ref|ZP_06101202.1| LOW QUALITY PROTEIN: porin [Brucella pinnipedialis M292/94/1]
 gi|261296834|gb|EEY00331.1| LOW QUALITY PROTEIN: porin [Brucella pinnipedialis B2/94]
 gi|264660842|gb|EEZ31103.1| LOW QUALITY PROTEIN: porin [Brucella pinnipedialis M292/94/1]
          Length = 134

 Score = 82.4 bits (202), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 26/123 (21%), Positives = 41/123 (33%), Gaps = 25/123 (20%)

Query: 106 LADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKY--------ETGKAGEITPI 157
           L   + S     G++R R G  + D  + Y   G                       +  
Sbjct: 14  LTTGVDSKLRWSGAVRARMGVAM-DRWMPYIAGGVAFGNVKNSVSLTDGIESIGVSQSKT 72

Query: 158 AIGGTAGVGVEVGGLSESLVARLEYRASKYSKVE---------------GFYNTISLGVG 202
             G  AG GV+    +++++ RLEYR + Y   +                  + I LGV 
Sbjct: 73  MTGWAAGAGVDYAA-TDNVIVRLEYRYTDYGHKDFSVVDGDLSVEARNKFKTHDIRLGVA 131

Query: 203 MKF 205
            KF
Sbjct: 132 YKF 134


>gi|323136250|ref|ZP_08071332.1| outer membrane protein Omp31 precursor [Methylocystis sp. ATCC
           49242]
 gi|322398324|gb|EFY00844.1| outer membrane protein Omp31 precursor [Methylocystis sp. ATCC
           49242]
          Length = 226

 Score = 82.4 bits (202), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 49/206 (23%), Positives = 71/206 (34%), Gaps = 23/206 (11%)

Query: 9   GVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYN-GS 67
             + +A        AA P   A        P        P    ++G Y G+   Y   S
Sbjct: 1   MKNKVAALLAPFVLAAGPSLSADLPRGAAPPPGDYVAP-PPAFVWSGFYVGVHGGYAFSS 59

Query: 68  FGEEAHHNAGG------SIFAGYNVE-DSCIMYGVEGDVRYTVPVLADNIHSLHGIGG-- 118
           F ++A+   GG       +  GYN       + GVE D  +T    ++         G  
Sbjct: 60  FEDDANTLIGGADGGLIGVTGGYNYMVTPQFLLGVEADFAFTGVSKSNAPFFGVIARGEV 119

Query: 119 ----SLRIRGGYEVSDSLLLYATVGPDVAQKYE------TGKAGEITPIAIGGTAGVGVE 168
               +LR R GY + D  LLY T G   ++         TG  G       G   G GVE
Sbjct: 120 DDMFTLRGRAGYSI-DRALLYVTGGFAASKNAIGLTTPFTGFYGYQATFQPGWALGAGVE 178

Query: 169 VGGLSESLVARLEYRASKYSKVEGFY 194
              ++ +L A+ EY  +       F 
Sbjct: 179 Y-MITSNLSAKGEYIFTSTGSDSYFD 203


>gi|121602149|ref|YP_989467.1| omp25/ropB family outer membrane protein [Bartonella bacilliformis
           KC583]
 gi|120614326|gb|ABM44927.1| outer membrane protein, omp25/ropB family [Bartonella bacilliformis
           KC583]
          Length = 281

 Score = 82.4 bits (202), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 53/283 (18%), Positives = 87/283 (30%), Gaps = 80/283 (28%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M K  + + +  +A++S    QAAD V  +    +      A +        + G Y G+
Sbjct: 1   MNKKNVLLSLCVVAVSSPSLVQAADTVVVSRAVSKTQTAQNAMSVVDHSDLSWGGLYFGV 60

Query: 61  S-ALYNGSF--------GEEAHH--------NAGGSIFAGYNVEDSC-IMYGVEGDVRYT 102
                +G+         GE+              G  + G NVE    ++ GV+ DV ++
Sbjct: 61  QVGGISGNLSLNRKAVSGEDKSSSETLPKLSGFIGGFYLGSNVEFGGGLVVGVDTDVVWS 120

Query: 103 -------------------------------------VPVLADNIHSLHGIGGSLRIRGG 125
                                                   +A N+       G+ RIR G
Sbjct: 121 NQKYKQLSDPIHVDEEVLKLHQALMSDYGHNSNSLKIGDKIAYNVTRKTNWIGATRIRFG 180

Query: 126 YEVSDSLLLYATVGPDVAQKYETG--------------KAGEITPIAIGGTAGVGVEVGG 171
               + ++ Y   G    Q   T                        +G T G G E   
Sbjct: 181 LA-GERMMPYVAGGIAYTQLQVTPWFEVTPTKGEVSSIDFMNDKKTMVGYTLGAGFEFLM 239

Query: 172 LSESLVARLEYRASKYS---------KVEGFYNTISLGVGMKF 205
            ++ ++ R EYR S +          KV    N + +GV  KF
Sbjct: 240 -TDDVILRTEYRHSDFGKKNFLKDTSKVSYKTNDVRIGVAYKF 281


>gi|256113839|ref|ZP_05454632.1| hypothetical membrane protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|265995187|ref|ZP_06107744.1| outer membrane protein [Brucella melitensis bv. 3 str. Ether]
 gi|262766300|gb|EEZ12089.1| outer membrane protein [Brucella melitensis bv. 3 str. Ether]
          Length = 212

 Score = 82.0 bits (201), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 45/205 (21%), Positives = 72/205 (35%), Gaps = 26/205 (12%)

Query: 17  SFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSFGEE---AH 73
              SA AAD +    +     V            HD++G Y G     + S       + 
Sbjct: 18  FAGSAFAADMMGGTDYTYYDPVAAGP--------HDWSGNYVGAQVGGSSSKFPSPFASR 69

Query: 74  HNAGGSIFAGYNVEDSCIMYGVE--GDVRYTVPVLADNIHSLHGIGGSLRIRGGYEVSDS 131
             A G I  G N+++  I++G E  G+       +           G+ + + GY   D 
Sbjct: 70  TGALGGIVVGKNMQNGNIVFGAELEGNFAEAEHRIGHGGTLQQSWNGNAKGKVGYTF-DK 128

Query: 132 LLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVE 191
            L+Y T G  V +          +    G   G GVE   LS  L  + EY   +++ V+
Sbjct: 129 TLVYGTAGYGVTRFKAKDNTTSASGCEGGVLIGAGVE-QALSGPLSVKAEYDFQRFNDVK 187

Query: 192 G-----------FYNTISLGVGMKF 205
                         ++I  G+  KF
Sbjct: 188 SQVNGIEQRNNLKNHSIKAGLNYKF 212


>gi|148258633|ref|YP_001243218.1| OmpA-like transmembrane domain-containing protein [Bradyrhizobium
           sp. BTAi1]
 gi|146410806|gb|ABQ39312.1| OmpA-like transmembrane domain protein [Bradyrhizobium sp. BTAi1]
          Length = 710

 Score = 82.0 bits (201), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 43/192 (22%), Positives = 66/192 (34%), Gaps = 25/192 (13%)

Query: 20  SAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSF-GEEAH----- 73
            A A           R       +   +   +D+ G Y G    Y G   G+++H     
Sbjct: 59  PAGADRLGTERRLDVRTKADRPPSEAEMKRVYDWTGFYVGGHFGYGGGRLGDDSHPKPEQ 118

Query: 74  --------HNAGGSIFAGYNVEDSC-IMYGVEGDVRYTVPVLADNI-----HSLHGIGGS 119
                       G    GYN + +  ++ GVE D  +T P     +     +S     G+
Sbjct: 119 GVFLPHSPTGLIGGFQVGYNRQLANHLVLGVEADASFTSPTDEPALAPSPFNSTVDYVGT 178

Query: 120 LRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPI---AIGGTAGVGVEVGGLSESL 176
            R R GY   D  + Y T G      +     G    +     G TAG+G E   +S + 
Sbjct: 179 ARGRVGYAF-DRWMPYVTGGFAWGHGHIEVNDGSGAQLGRYQTGWTAGLGAEF-AVSGNW 236

Query: 177 VARLEYRASKYS 188
            A++EY     S
Sbjct: 237 TAKVEYDYVNLS 248


>gi|156739526|gb|ABU93423.1| Omp25 [Brucella neotomae]
 gi|156739608|gb|ABU93464.1| Omp25 [Brucella ovis]
          Length = 63

 Score = 81.6 bits (200), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 19/65 (29%), Positives = 33/65 (50%), Gaps = 2/65 (3%)

Query: 112 SLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGG 171
              G  GSLR R GY++ + ++ Y T G   +Q        + +   +G TAG G+E   
Sbjct: 1   VKQGFEGSLRARVGYDL-NPVMPYLTAGIAGSQIKLNNGLDDESKFRVGWTAGAGLEA-K 58

Query: 172 LSESL 176
           L++++
Sbjct: 59  LTDNI 63


>gi|92116045|ref|YP_575774.1| carbohydrate-selective porin OprB [Nitrobacter hamburgensis X14]
 gi|91798939|gb|ABE61314.1| Carbohydrate-selective porin OprB [Nitrobacter hamburgensis X14]
          Length = 692

 Score = 81.6 bits (200), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 51/218 (23%), Positives = 82/218 (37%), Gaps = 43/218 (19%)

Query: 3   KLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPY----- 57
            +   V +S+LAL    SA AAD        G  ++PT A  R      D+ G Y     
Sbjct: 36  VVLAGVALSALALGG--SAVAADV-------GASLLPTKAMPR---PVIDWTGLYFGAHA 83

Query: 58  -------AGLSALYNGSFGEEAHHNAGGSIFAGYNVEDSC-IMYGVEGDVRYTVPVLADN 109
                           + G   +      + AGYN++    ++ G+E D+ +   + +++
Sbjct: 84  GFGGGRSTATLVDPASTTGRNDYGGIISGVQAGYNIQLPSGLLLGLEADISFPNYIESNS 143

Query: 110 IHSL-----------HGIGGSLRIRGGYEVSDSLLLYATVGPD-VAQKYETG-KAGEITP 156
             S                GS R R GY  +   L YA+ G     ++Y     +G+   
Sbjct: 144 DVSKLATARSAVTQQWDFIGSARGRIGYA-TGPWLTYASGGLAFAGERYLNDLPSGDQEK 202

Query: 157 IA---IGGTAGVGVEVGGLSESLVARLEYRASKYSKVE 191
                +G  AG G+E    + S  ARLEY   ++ K  
Sbjct: 203 ALDMRLGWAAGAGLEY-AFTPSWSARLEYLYYRFDKTN 239


>gi|39933882|ref|NP_946158.1| outer membrane protein [Rhodopseudomonas palustris CGA009]
 gi|192289301|ref|YP_001989906.1| porin [Rhodopseudomonas palustris TIE-1]
 gi|39647729|emb|CAE26249.1| possible outer membrane protein [Rhodopseudomonas palustris CGA009]
 gi|192283050|gb|ACE99430.1| porin [Rhodopseudomonas palustris TIE-1]
          Length = 449

 Score = 81.6 bits (200), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 32/177 (18%), Positives = 48/177 (27%), Gaps = 32/177 (18%)

Query: 47  VPIRHDFNGPYAGLS--------------ALYNGSFGEEAHHNAGGSIFAGYNVEDSCIM 92
            P   ++ G Y G +                        A     G    GYN + S  +
Sbjct: 241 TPPPANWAGLYIGGNFGGATGRDRSSLTLGGGQTDTFNLAPDGFIGGGQIGYNWQASNWV 300

Query: 93  YGVEGDVRYTVPVLADNI--------HSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQ 144
           +GVE D + +                 +     G+ R R GY +  S L Y T G     
Sbjct: 301 FGVEADFQGSTQKDQRASVLGPRAYYDAKLPWFGTARGRIGYSL-GSTLFYGTAGYAYGN 359

Query: 145 KYETGKAG----EITPIAIGGTAGVGVEVGG-----LSESLVARLEYRASKYSKVEG 192
                 +            G  AG G+E        L  +  ++ EY          
Sbjct: 360 IKSDIVSSIGNYSFKTTKGGWAAGAGIETPFQLFGLLGPNWTSKTEYLYVDLGSTTD 416



 Score = 78.9 bits (193), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 48/225 (21%), Positives = 74/225 (32%), Gaps = 47/225 (20%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+++F  V ++  A  S   AQAAD   +A +              V   +D+ G Y G 
Sbjct: 1   MKRIFAGVVLAGTAAVS---AQAADLAVKAPYLK----------APVAAVYDWTGFYIGA 47

Query: 61  SALYNGSFGEEAHHNAGG---------------SIFAGYNVEDSCI----MYGVEGDVRY 101
           +         + H   GG                   GYN +        + G+E D++ 
Sbjct: 48  NVGVGLGRNLQTHAYPGGASLNTTYLQPQGVIGGGQIGYNWQLGSFLGPMLLGLEADIQG 107

Query: 102 TVPV--------LADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAG- 152
           +           LA N +      G++R R G  V    + Y T G  V     T   G 
Sbjct: 108 SGASDGYTSLNGLATNYNQKLDWFGTVRGRVGL-VRGPAVAYFTGGYAVGSVKTTVTEGG 166

Query: 153 ----EITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGF 193
               + +    G   G GVE   L  +   ++EY          F
Sbjct: 167 LVAFDNSKTRSGWVIGSGVEA-ALGGNWTGKIEYLYLDLGNQTDF 210


>gi|156739586|gb|ABU93453.1| Omp25 [Brucella melitensis]
          Length = 64

 Score = 81.6 bits (200), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 19/66 (28%), Positives = 34/66 (51%), Gaps = 2/66 (3%)

Query: 112 SLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGG 171
              G  GSLR R GY++ + ++ Y T G   +Q        + +   +G TAG G+E   
Sbjct: 1   VKQGFEGSLRARVGYDL-NPVMPYLTAGIVGSQIKLNNGLDDESKFRVGWTAGAGLEA-K 58

Query: 172 LSESLV 177
           L+++++
Sbjct: 59  LTDNIL 64


>gi|225627750|ref|ZP_03785787.1| Hypothetical protein, conserved [Brucella ceti str. Cudo]
 gi|225617755|gb|EEH14800.1| Hypothetical protein, conserved [Brucella ceti str. Cudo]
          Length = 222

 Score = 81.6 bits (200), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 45/205 (21%), Positives = 71/205 (34%), Gaps = 26/205 (12%)

Query: 17  SFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSFGEE---AH 73
              SA AAD +    +     V            HD++G Y G     + S       + 
Sbjct: 28  FAGSAFAADMMGGTDYTYNDPVAAGP--------HDWSGNYVGARVGGSSSKFPSPFASR 79

Query: 74  HNAGGSIFAGYNVEDSCIMYGV--EGDVRYTVPVLADNIHSLHGIGGSLRIRGGYEVSDS 131
             A G I  G N+++  I++G   EG+       +           G+ + + GY   D 
Sbjct: 80  TGALGGIVVGKNMQNGNIVFGAELEGNFAEAEHRIGHGGTLQQSWNGNAKGKVGYAF-DK 138

Query: 132 LLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVE 191
            L+Y T G  V +               G   G GVE   LS  L  + EY   +++ V+
Sbjct: 139 TLVYGTAGYGVTRFKAKDNTTSAPGWEGGVLIGAGVE-QALSGPLSVKAEYDFQRFNDVK 197

Query: 192 G-----------FYNTISLGVGMKF 205
                         ++I  G+  KF
Sbjct: 198 SQVNGIEQRNNLKNHSIKAGLNYKF 222


>gi|296447421|ref|ZP_06889346.1| OmpA domain protein transmembrane region-containing protein
           [Methylosinus trichosporium OB3b]
 gi|296255041|gb|EFH02143.1| OmpA domain protein transmembrane region-containing protein
           [Methylosinus trichosporium OB3b]
          Length = 271

 Score = 81.2 bits (199), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 49/233 (21%), Positives = 71/233 (30%), Gaps = 59/233 (25%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+ L     ++     +  SA AAD                           + G YAGL
Sbjct: 1   MKTLSALSMIT--LGFAVSSASAADLPSAK---------APVAFVEPAPAFTWTGVYAGL 49

Query: 61  SALYNGS--------------------FGEEAHHNAGGSIFAGYNVEDS--CIMYGVEGD 98
           +  Y  S                    F   A     G    GYN + +    + G+E D
Sbjct: 50  NIGYGWSEKQSIAGTVSAAGTPIAFWSFPSSAVDGVLGGGQIGYNRQFAGTSFVVGLEAD 109

Query: 99  V------RYTVPVLADNIHS---------LHGIGGSLRIRGGYEVSDSLLLYATVGPDVA 143
                   Y+      N                 G++R R GY V+ +LL+Y T G    
Sbjct: 110 FRGAGVNGYSNGFGPTNQFGYTPFVNARQQLDWFGTVRGRLGYAVAPTLLVYGTGGFAYG 169

Query: 144 QKYETGKAG----------EITPIAIGGTAGVGVEVGGLSESLVARLEYRASK 186
               T   G            + +  G TAG GVE   L     A++EY  ++
Sbjct: 170 GYRATYSGGAVGVPVTVSVSNSDVRTGWTAGGGVEWAFL-PRWSAKVEYLYTE 221


>gi|62290190|ref|YP_221983.1| hypothetical protein BruAb1_1285 [Brucella abortus bv. 1 str.
           9-941]
 gi|82700111|ref|YP_414685.1| hypothetical protein BAB1_1302 [Brucella melitensis biovar Abortus
           2308]
 gi|189024424|ref|YP_001935192.1| hypothetical protein BAbS19_I12150 [Brucella abortus S19]
 gi|254689494|ref|ZP_05152748.1| hypothetical protein Babob68_04824 [Brucella abortus bv. 6 str.
           870]
 gi|254693981|ref|ZP_05155809.1| hypothetical protein Babob3T_04824 [Brucella abortus bv. 3 str.
           Tulya]
 gi|254697632|ref|ZP_05159460.1| hypothetical protein Babob28_07971 [Brucella abortus bv. 2 str.
           86/8/59]
 gi|254730522|ref|ZP_05189100.1| hypothetical protein Babob42_04834 [Brucella abortus bv. 4 str.
           292]
 gi|256257742|ref|ZP_05463278.1| hypothetical protein Babob9C_10416 [Brucella abortus bv. 9 str.
           C68]
 gi|260546733|ref|ZP_05822472.1| outer membrane protein [Brucella abortus NCTC 8038]
 gi|260755016|ref|ZP_05867364.1| outer membrane protein 22 [Brucella abortus bv. 6 str. 870]
 gi|260758232|ref|ZP_05870580.1| outer membrane protein 22 [Brucella abortus bv. 4 str. 292]
 gi|260762059|ref|ZP_05874402.1| outer membrane protein 22 [Brucella abortus bv. 2 str. 86/8/59]
 gi|260884027|ref|ZP_05895641.1| outer membrane protein [Brucella abortus bv. 9 str. C68]
 gi|261214272|ref|ZP_05928553.1| outer membrane protein 22 [Brucella abortus bv. 3 str. Tulya]
 gi|297248580|ref|ZP_06932298.1| hypothetical protein BAYG_01539 [Brucella abortus bv. 5 str. B3196]
 gi|14018349|emb|CAC38354.1| outer membrane protein [Brucella abortus]
 gi|46251261|gb|AAS84601.1| Omp22 [Brucella abortus]
 gi|62196322|gb|AAX74622.1| hypothetical membrane protein [Brucella abortus bv. 1 str. 9-941]
 gi|82616212|emb|CAJ11258.1| membrane protein, putative [Brucella melitensis biovar Abortus
           2308]
 gi|189019996|gb|ACD72718.1| hypothetical protein BAbS19_I12150 [Brucella abortus S19]
 gi|260095783|gb|EEW79660.1| outer membrane protein [Brucella abortus NCTC 8038]
 gi|260668550|gb|EEX55490.1| outer membrane protein 22 [Brucella abortus bv. 4 str. 292]
 gi|260672491|gb|EEX59312.1| outer membrane protein 22 [Brucella abortus bv. 2 str. 86/8/59]
 gi|260675124|gb|EEX61945.1| outer membrane protein 22 [Brucella abortus bv. 6 str. 870]
 gi|260873555|gb|EEX80624.1| outer membrane protein [Brucella abortus bv. 9 str. C68]
 gi|260915879|gb|EEX82740.1| outer membrane protein 22 [Brucella abortus bv. 3 str. Tulya]
 gi|297175749|gb|EFH35096.1| hypothetical protein BAYG_01539 [Brucella abortus bv. 5 str. B3196]
          Length = 212

 Score = 81.2 bits (199), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 45/205 (21%), Positives = 72/205 (35%), Gaps = 26/205 (12%)

Query: 17  SFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSFGEE---AH 73
              SA AAD +    +     V            HD++G Y G     + S       + 
Sbjct: 18  FAGSAFAADMMGGTDYTYNDPVAAGP--------HDWSGNYVGAQVGGSSSKFPSPFASR 69

Query: 74  HNAGGSIFAGYNVEDSCIMYGVE--GDVRYTVPVLADNIHSLHGIGGSLRIRGGYEVSDS 131
             A G I  G N+++  I++G E  G+       +           G+ + + GY   D 
Sbjct: 70  TGALGGIVVGKNMQNGNIVFGAELEGNFAEAEHRIGHGGTLQQSWNGNAKGKVGYTF-DK 128

Query: 132 LLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVE 191
            L+Y T G  V +          +    G   G GVE   LS  L  + EY   +++ V+
Sbjct: 129 TLVYGTAGYGVTRFKAKDNTTSASGWEGGVLIGAGVE-QALSGPLSVKAEYDFQRFNDVK 187

Query: 192 G-----------FYNTISLGVGMKF 205
                         ++I  G+  KF
Sbjct: 188 SQVNGIEQRNNLKNHSIKAGLNYKF 212


>gi|90424285|ref|YP_532655.1| hypothetical protein RPC_2788 [Rhodopseudomonas palustris BisB18]
 gi|90106299|gb|ABD88336.1| conserved hypothetical protein [Rhodopseudomonas palustris BisB18]
          Length = 578

 Score = 81.2 bits (199), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 46/253 (18%), Positives = 75/253 (29%), Gaps = 78/253 (30%)

Query: 29  RAHHGGRGVVPTIATNRYV----PIRHDFNGPYAGLSAL-------YNGSFGEEAHHNAG 77
           ++ +      P  A   +     P+  ++ G Y G           ++ S G        
Sbjct: 318 QSSYKWGDTTPPSAAVGFATKAPPLAVNWTGVYVGGQLGAGFGPKHWSDSIGSTTSLVNP 377

Query: 78  GSIF-AG--------------------------YNVEDSCIMYGVEGDVRYTVPVLADNI 110
           GS F AG                          YN +    + GVE DV +     +  I
Sbjct: 378 GSDFPAGTPPGLNVGGFGKSTPMAGGLGGAQLGYNFQTGRTVLGVEADVAFADLKGSHTI 437

Query: 111 HSLHGIG---------GSLRIRGGYEVSDSLLLYATVG-PDVAQKYETGKA--------- 151
           +S  G G         GS+  R GY V  +LL     G   V        +         
Sbjct: 438 YSGLGGGQAEAHTTALGSVTGRVGYAVERNLLYVKAGGAWAVTDHTLDTSSIFIPSQGEG 497

Query: 152 ---GEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYS-----------------KVE 191
                +    +G T G G+E   +     A+LEY    +                   ++
Sbjct: 498 CCHDNVRSTRLGWTVGAGLEY-AVDRHWSAKLEYDYMDFGSQSVSFPVNARLGLPSVDID 556

Query: 192 GFYNTISLGVGMK 204
             ++ + +GV  K
Sbjct: 557 QAFHVVKMGVNYK 569


>gi|154246410|ref|YP_001417368.1| porin [Xanthobacter autotrophicus Py2]
 gi|154160495|gb|ABS67711.1| porin [Xanthobacter autotrophicus Py2]
          Length = 258

 Score = 81.2 bits (199), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 33/197 (16%), Positives = 55/197 (27%), Gaps = 43/197 (21%)

Query: 41  IATNRYVPIRHDFNGPYAGLSALYNGS------------------FGEEAHHNAGGSIFA 82
                 V     + G Y G +  Y G                                  
Sbjct: 28  PVKAVAVAPVFSWTGFYIGANVGYGGDKFTFDEVESYNGYPYYATSTSLNSSGFFAGGQI 87

Query: 83  GYNVED-SCIMYGVEGDVRYTVPVLADNIHS---------------LHGIGGSLRIRGGY 126
           GYN +  + ++ G E D++++      +  S                    G++R R GY
Sbjct: 88  GYNYQFANNVVLGAETDLQWSGIEGKADYSSVYLYGGYPYTSSFGASVDYFGTIRARIGY 147

Query: 127 EVSDSLLLYATVGPDVAQKYETG-------KAGEITPIAIGGTAGVGVEVGGLSESLVAR 179
              D  L Y T G    +   +G            +    G T G GVE   ++ +   +
Sbjct: 148 AF-DRFLPYITGGAAYGKTKVSGSYYDYSVGGFSASGTNWGWTVGGGVEY-AITNNWTFK 205

Query: 180 LEYRASKYSKVEGFYNT 196
            EY        +  Y +
Sbjct: 206 TEYLYVDLGSTDYTYAS 222


>gi|254714341|ref|ZP_05176152.1| 22 kDa outer membrane protein precursor [Brucella ceti M644/93/1]
 gi|261322117|ref|ZP_05961314.1| conserved hypothetical protein [Brucella ceti M644/93/1]
 gi|261294807|gb|EEX98303.1| conserved hypothetical protein [Brucella ceti M644/93/1]
          Length = 222

 Score = 81.2 bits (199), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 45/205 (21%), Positives = 71/205 (34%), Gaps = 26/205 (12%)

Query: 17  SFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSFGEE---AH 73
              SA AAD +    +     V            HD++G Y G     + S       + 
Sbjct: 28  FAGSAFAADMMGGTDYTYNDPVAAGP--------HDWSGNYVGARVGGSSSKFPSPFASR 79

Query: 74  HNAGGSIFAGYNVEDSCIMYGV--EGDVRYTVPVLADNIHSLHGIGGSLRIRGGYEVSDS 131
             A G I  G N+++  I++G   EG+       +           G+ + + GY   D 
Sbjct: 80  TGALGGIVVGKNMQNGNIVFGAELEGNFAEAEHRIGHGGTLQQSWNGNAKGKVGYAF-DK 138

Query: 132 LLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVE 191
            L+Y T G  V +               G   G GVE   LS  L  + EY   +++ V+
Sbjct: 139 TLVYGTAGYGVTRFKAKDNTTSAPGWEGGVLIGAGVE-QALSGPLSVKAEYDFQRFNDVK 197

Query: 192 G-----------FYNTISLGVGMKF 205
                         ++I  G+  KF
Sbjct: 198 SQVNGIEQRNNLKNHSIKAGLNYKF 222


>gi|156739606|gb|ABU93463.1| Omp25 [Brucella canis]
          Length = 63

 Score = 80.9 bits (198), Expect = 9e-14,   Method: Composition-based stats.
 Identities = 20/65 (30%), Positives = 34/65 (52%), Gaps = 2/65 (3%)

Query: 112 SLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGG 171
              GI GSLR R GY++ + ++ Y T G   +Q        + +   +G TAG G+E   
Sbjct: 1   VKQGIEGSLRARVGYDL-NPVMPYLTAGIAGSQIKLNNGLDDESKFRVGWTAGAGLEA-K 58

Query: 172 LSESL 176
           L++++
Sbjct: 59  LTDNI 63


>gi|306840252|ref|ZP_07473026.1| 22 kDa outer membrane protein precursor [Brucella sp. BO2]
 gi|306289779|gb|EFM60961.1| 22 kDa outer membrane protein precursor [Brucella sp. BO2]
          Length = 212

 Score = 80.9 bits (198), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 45/202 (22%), Positives = 71/202 (35%), Gaps = 26/202 (12%)

Query: 20  SAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSFGEE---AHHNA 76
           SA AAD +    +     V            HD++G Y G     + S       +   A
Sbjct: 21  SAFAADMMGGTDYTYSDPVAAGP--------HDWSGNYVGAQVGGSSSKFPSPFASRTGA 72

Query: 77  GGSIFAGYNVEDSCIMYGV--EGDVRYTVPVLADNIHSLHGIGGSLRIRGGYEVSDSLLL 134
            G I  G N+++  I++G   EG+       +           G+ + + GY   D  L+
Sbjct: 73  LGGIVVGKNMQNGNIVFGAELEGNFAEAEHRIGHGGTLQQSWNGNAKGKVGYAF-DKTLV 131

Query: 135 YATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEG-- 192
           Y T G  V +               G   G GVE   LS  L  + EY   +++ V+   
Sbjct: 132 YGTAGYGVTRFKAKDNTTSAPGWEGGVLIGAGVE-QALSGPLSVKAEYDFQRFNDVKSQV 190

Query: 193 ---------FYNTISLGVGMKF 205
                      ++I  G+  KF
Sbjct: 191 NGIEQRNNLKNHSIKAGLNYKF 212


>gi|306844187|ref|ZP_07476780.1| 22 kDa outer membrane protein precursor [Brucella sp. BO1]
 gi|306275462|gb|EFM57199.1| 22 kDa outer membrane protein precursor [Brucella sp. BO1]
          Length = 212

 Score = 80.9 bits (198), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 45/202 (22%), Positives = 71/202 (35%), Gaps = 26/202 (12%)

Query: 20  SAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSFGEE---AHHNA 76
           SA AAD +    +     V            HD++G Y G     + S       +   A
Sbjct: 21  SAFAADMMGGTDYTYSDPVAAGP--------HDWSGNYVGAQVGGSSSKFPSPFASRTGA 72

Query: 77  GGSIFAGYNVEDSCIMYGV--EGDVRYTVPVLADNIHSLHGIGGSLRIRGGYEVSDSLLL 134
            G I  G N+++  I++G   EG+       +           G+ + + GY   D  L+
Sbjct: 73  LGGIVVGKNMQNGNIVFGAELEGNFAEAEHRIGHGGTLQQSWNGNAKGKVGYAF-DKTLV 131

Query: 135 YATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEG-- 192
           Y T G  V +               G   G GVE   LS  L  + EY   +++ V+   
Sbjct: 132 YGTAGYGVTRFKAKDNTTSAPGWEGGVLIGAGVE-QALSGPLSVKAEYDFQRFNDVKSQV 190

Query: 193 ---------FYNTISLGVGMKF 205
                      ++I  G+  KF
Sbjct: 191 NGIEQRNNLKNHSIKAGLNYKF 212


>gi|161619235|ref|YP_001593122.1| 22 kDa outer membrane protein precursor [Brucella canis ATCC 23365]
 gi|260566198|ref|ZP_05836668.1| outer membrane protein 22 [Brucella suis bv. 4 str. 40]
 gi|46251265|gb|AAS84603.1| Omp22 [Brucella canis]
 gi|161336046|gb|ABX62351.1| 22 kDa outer membrane protein precursor [Brucella canis ATCC 23365]
 gi|260155716|gb|EEW90796.1| outer membrane protein 22 [Brucella suis bv. 4 str. 40]
          Length = 212

 Score = 80.9 bits (198), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 46/205 (22%), Positives = 72/205 (35%), Gaps = 26/205 (12%)

Query: 17  SFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSFGEE---AH 73
           S  SA AAD +    +     V            HD++G Y G     + S       + 
Sbjct: 18  SAGSAFAADMMGGTDYTYNDPVAAGP--------HDWSGNYVGAQVGGSSSKFPSPFASR 69

Query: 74  HNAGGSIFAGYNVEDSCIMYGV--EGDVRYTVPVLADNIHSLHGIGGSLRIRGGYEVSDS 131
             A G I  G N+++  I++G   EG+       +           G+ + + GY   D 
Sbjct: 70  TGALGGIVVGKNMQNGNIVFGAELEGNFAEAEHRIGHGGTLQQSWNGNAKGKVGYAF-DK 128

Query: 132 LLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVE 191
            L+Y T G  V +               G   G GVE   LS  L  + EY   +++ V+
Sbjct: 129 TLVYGTAGYGVTRFKAKDNTTSAPGWEGGVLIGAGVE-QALSGPLSVKAEYDFQRFNDVK 187

Query: 192 G-----------FYNTISLGVGMKF 205
                         ++I  G+  KF
Sbjct: 188 SQVNGIEQRNNLKNHSIKAGLNYKF 212


>gi|46202723|ref|ZP_00052712.2| COG3659: Carbohydrate-selective porin [Magnetospirillum
           magnetotacticum MS-1]
          Length = 693

 Score = 80.9 bits (198), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 45/214 (21%), Positives = 68/214 (31%), Gaps = 57/214 (26%)

Query: 32  HGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSFGE--------------------- 70
           HG     PT     ++P    + G Y G       +FG+                     
Sbjct: 10  HGADLATPTPHDATHLPSFGTWAGGYTGWQGSAGDAFGDFGFGSGMIGRRSVPEFRTGDA 69

Query: 71  EAHHNAG-------GSIFAGYNVEDSCIMYGVEGDVRYTVPVLADN-------------- 109
              ++AG       G +F GY  +    +YGVE DV  T      +              
Sbjct: 70  TGRNDAGRNATTALGGLFGGYAWQIGPFVYGVEADVDATNLKRPVSSTTPGFGFEGLDPA 129

Query: 110 ---IHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPI--------- 157
              I +   + G+ R R GY      L+YA+ G   AQ        +             
Sbjct: 130 FPVIRAKADVFGTARARVGYAFE-RYLVYASFGLAGAQVRFLTNFPDPATTSAPALRRGR 188

Query: 158 -AIGGTAGVGVEVGGLSESLVARLEYRASKYSKV 190
             +G + G G+E   ++E L   LEYR     + 
Sbjct: 189 AFLGFSLGAGIEY-AITEHLALGLEYRYLDLGRS 221


>gi|23502160|ref|NP_698287.1| hypothetical protein BR1284 [Brucella suis 1330]
 gi|163843547|ref|YP_001627951.1| 22 kDa outer membrane protein precursor [Brucella suis ATCC 23445]
 gi|254702018|ref|ZP_05163846.1| 22 kDa outer membrane protein precursor [Brucella suis bv. 5 str.
           513]
 gi|254704559|ref|ZP_05166387.1| 22 kDa outer membrane protein precursor [Brucella suis bv. 3 str.
           686]
 gi|256369703|ref|YP_003107213.1| hypothetical protein BMI_I1295 [Brucella microti CCM 4915]
 gi|261752584|ref|ZP_05996293.1| outer membrane protein 22 [Brucella suis bv. 5 str. 513]
 gi|261755243|ref|ZP_05998952.1| outer membrane protein 22 [Brucella suis bv. 3 str. 686]
 gi|294852619|ref|ZP_06793292.1| outer membrane protein [Brucella sp. NVSL 07-0026]
 gi|23348124|gb|AAN30202.1| membrane protein, putative [Brucella suis 1330]
 gi|157310303|emb|CAN43863.1| outer membrane protein 22 [Brucella microti CCM 4915]
 gi|157310305|emb|CAN43864.1| outer membrane protein 22 [Brucella microti]
 gi|163674270|gb|ABY38381.1| 22 kDa outer membrane protein precursor [Brucella suis ATCC 23445]
 gi|255999865|gb|ACU48264.1| hypothetical protein BMI_I1295 [Brucella microti CCM 4915]
 gi|261742337|gb|EEY30263.1| outer membrane protein 22 [Brucella suis bv. 5 str. 513]
 gi|261744996|gb|EEY32922.1| outer membrane protein 22 [Brucella suis bv. 3 str. 686]
 gi|294821208|gb|EFG38207.1| outer membrane protein [Brucella sp. NVSL 07-0026]
          Length = 212

 Score = 80.9 bits (198), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 45/205 (21%), Positives = 71/205 (34%), Gaps = 26/205 (12%)

Query: 17  SFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSFGEE---AH 73
              SA AAD +    +     V            HD++G Y G     + S       + 
Sbjct: 18  FAGSAFAADMMGGTDYTYNDPVAAGP--------HDWSGNYVGAQVGGSSSKFPSPFASR 69

Query: 74  HNAGGSIFAGYNVEDSCIMYGV--EGDVRYTVPVLADNIHSLHGIGGSLRIRGGYEVSDS 131
             A G I  G N+++  I++G   EG+       +           G+ + + GY   D 
Sbjct: 70  TGALGGIVVGKNMQNGNIVFGAELEGNFAEAEHRIGHGGTLQQSWNGNAKGKVGYAF-DK 128

Query: 132 LLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVE 191
            L+Y T G  V +               G   G GVE   LS  L  + EY   +++ V+
Sbjct: 129 TLVYGTAGYGVTRFKAKDNTTSAPGWEGGVLIGAGVE-QALSGPLSVKAEYDFQRFNDVK 187

Query: 192 G-----------FYNTISLGVGMKF 205
                         ++I  G+  KF
Sbjct: 188 SQVNGIEQRNNLKNHSIKAGLNYKF 212


>gi|119383169|ref|YP_914225.1| outer membrane protein [Paracoccus denitrificans PD1222]
 gi|119372936|gb|ABL68529.1| outer membrane protein [Paracoccus denitrificans PD1222]
          Length = 255

 Score = 80.9 bits (198), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 50/255 (19%), Positives = 84/255 (32%), Gaps = 58/255 (22%)

Query: 4   LFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSAL 63
           +  ++   ++A  +  +A AA+            V   A         D+ G YAGL+  
Sbjct: 6   VKASLTAGAVASLALGTALAANAGGYTPPVVDTDV--TAPVVESAPVGDWAGAYAGLTLG 63

Query: 64  ------------------YNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPV 105
                             Y G  G+     A   +  GY  +    ++G E  + +    
Sbjct: 64  YAFGGDDRVGFTEVDTGTYLGDAGKLELGGANAGLHVGYRWQRDRWVFGPE--LGFEAGN 121

Query: 106 LADNIHSLHGIGGS------------LRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGE 153
           + D I   + +GGS            LR++ GY +   LLLY   G   A         +
Sbjct: 122 IKDTITFDNQLGGSTDVSSKIRNVLALRLKTGYALRPDLLLYGIAGIARADVEYKVAGTD 181

Query: 154 ITP---------IAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGF----------- 193
            +           + G   G+GVE   LS+ +    EY  + + K               
Sbjct: 182 GSGGSMSESRDFKSNGYIVGLGVE-RKLSDRMSVTGEYEYANFGKTTRTFQVDGGVSTQA 240

Query: 194 ---YNTISLGVGMKF 205
              Y+ + LG+  KF
Sbjct: 241 TPDYHNVKLGLNFKF 255


>gi|39936434|ref|NP_948710.1| putative outer membrane protein [Rhodopseudomonas palustris CGA009]
 gi|39650289|emb|CAE28812.1| putative outer membrane protein [Rhodopseudomonas palustris CGA009]
          Length = 240

 Score = 80.9 bits (198), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 39/238 (16%), Positives = 71/238 (29%), Gaps = 41/238 (17%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+ +   +  ++  +A    A AAD             P         + +++ G Y G 
Sbjct: 1   MKTMKNTLLGAAAVIALSAPAFAADLP---PRPYTKAAPAYTAPE---VVYNWTGFYVGG 54

Query: 61  SALYNGSFGEEAHHNAG---GSIFAGYNVEDS-CIMYGVEGDVRYTVPVLADNIHSLHGI 116
                 +       N+G   G +  G + + +   + G+E    +        I      
Sbjct: 55  HVGGAWAGDNNITGNSGRFFGGVQGGADYQFATNWVIGIEAQYSWMSSNNTGVIFPGGST 114

Query: 117 G-------GSLRIRGGYEVSDSLLLYATVGPD--------VAQKYETGKAGEITPIAIGG 161
                   GS+  R GY      L+YA  G           +                G 
Sbjct: 115 ATEDTRGLGSVTGRLGYAW-GPTLVYAKGGYAWRDSDLSVASLGGVPSGYTTSGSRNDGY 173

Query: 162 TAGVGVEVGGLSESLVARLEYRASKYSKV--------------EGFYNTISLGVGMKF 205
           T G G+E    + S  A++EY+  K+                     +T+  G+  +F
Sbjct: 174 TVGAGLEY-MFAPSWSAKVEYQYYKFGDTTFTGGPADVVGTSFRNDEHTVKAGINYRF 230


>gi|188581225|ref|YP_001924670.1| carbohydrate-selective porin OprB [Methylobacterium populi BJ001]
 gi|179344723|gb|ACB80135.1| Carbohydrate-selective porin OprB [Methylobacterium populi BJ001]
          Length = 703

 Score = 80.5 bits (197), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 45/215 (20%), Positives = 70/215 (32%), Gaps = 63/215 (29%)

Query: 43  TNRYVPIRHDFNGPYAGLSALYNGSFGE---------------------EAHHNAGG--- 78
             R  P   D++G YAG+      SFG                          + GG   
Sbjct: 36  AERARPRFLDWSGLYAGVQGSAGASFGNYDIGPTTIGTRRVRTISTGDATGSRDLGGDAT 95

Query: 79  ----SIFAGYNVEDSCIMYGVEGDVRYTVPVLADN-----------------IHSLHGIG 117
                 FAG+N +D  I+YG+E D+  T                        +     + 
Sbjct: 96  TVAAGAFAGWNWQDGAIVYGLEADLAGTNLKRGARSDAPGFGYEAVDPPFALVREKTDLF 155

Query: 118 GSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITP----------IAIGGTAGVGV 167
           G+ R R GY   ++ L+YAT G   A         +++             +G T G GV
Sbjct: 156 GAARARLGYAFGNN-LIYATFGLTGANGRVLATYPDLSGGPTATAARNVSYLGYTLGAGV 214

Query: 168 EVGGLSESLVARLEYRASKYSKVEGFYNTISLGVG 202
           +   +   L   ++YR S          +   G+G
Sbjct: 215 QF-AVDPHLSLGIDYRYSDLG------ESARFGLG 242


>gi|192292221|ref|YP_001992826.1| porin [Rhodopseudomonas palustris TIE-1]
 gi|192285970|gb|ACF02351.1| porin [Rhodopseudomonas palustris TIE-1]
          Length = 240

 Score = 80.5 bits (197), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 39/238 (16%), Positives = 71/238 (29%), Gaps = 41/238 (17%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+ +   +  ++  +A    A AAD             P         + +++ G Y G 
Sbjct: 1   MKTMKNTLLGAAAVIALSAPAFAADLP---PRPYTKAAPAYTAPE---VVYNWTGFYVGG 54

Query: 61  SALYNGSFGEEAHHNAG---GSIFAGYNVEDS-CIMYGVEGDVRYTVPVLADNIHSLHGI 116
                 +       N+G   G +  G + + +   + G+E    +        I      
Sbjct: 55  HVGGAWAGDNNITGNSGRFFGGVQGGADYQFATNWVIGIEAQYSWMSSNNTGVIFPGGST 114

Query: 117 G-------GSLRIRGGYEVSDSLLLYATVGPD--------VAQKYETGKAGEITPIAIGG 161
                   GS+  R GY      L+YA  G           +                G 
Sbjct: 115 ATEDTRGLGSVTGRLGYAW-GPTLVYAKGGYAWRDSDLSVASLGGVPSGYTASGSRNDGY 173

Query: 162 TAGVGVEVGGLSESLVARLEYRASKYSKV--------------EGFYNTISLGVGMKF 205
           T G G+E    + S  A++EY+  K+                     +T+  G+  +F
Sbjct: 174 TVGAGLEY-MFAPSWSAKVEYQYYKFGDTTFTGGPADVVGTSFRNDEHTVKAGINYRF 230


>gi|192291194|ref|YP_001991799.1| outer membrane insertion C-terminal signal [Rhodopseudomonas
           palustris TIE-1]
 gi|192284943|gb|ACF01324.1| outer membrane insertion C-terminal signal [Rhodopseudomonas
           palustris TIE-1]
          Length = 997

 Score = 80.5 bits (197), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 51/225 (22%), Positives = 73/225 (32%), Gaps = 46/225 (20%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+     + V S+   +  SA AAD                A    VP   ++ G Y G 
Sbjct: 1   MKNFPAWLSVWSVVAVACGSAHAADLQNG------------AVPSAVPAATNWTGFYIGT 48

Query: 61  SALYNGS-------------------FGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRY 101
                 S                    G     NA   I  GYN +    + G+EGD  +
Sbjct: 49  HVGAAASDSAWNSIAGSGAGLAAGPFPGHGVSGNAIAGIQGGYNAQFGNYVLGIEGDASF 108

Query: 102 -TVPVLADNIHSLHGIGG------SLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAG-- 152
            ++  LA  +H             +L  R GY   D LL+Y   G   A  +    +G  
Sbjct: 109 GSINGLARCLHGTFACTSRIDELWTLAARFGYAAGD-LLVYGKAGAAWADVHRRMASGNF 167

Query: 153 ----EITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGF 193
               E +    G   G GVE   L   L A++EY  + +      
Sbjct: 168 VNVLEASETRSGWLLGAGVEYAFL-PGLSAKIEYNYADFGSRSLT 211



 Score = 71.2 bits (173), Expect = 8e-11,   Method: Composition-based stats.
 Identities = 43/208 (20%), Positives = 66/208 (31%), Gaps = 43/208 (20%)

Query: 25  DPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSFGEEAH----------H 74
           D    + HG     P IA         ++ G Y G S          A            
Sbjct: 765 DAAEASAHGITKAPPRIAPT-------NWTGLYVGASVGAGWGRTTYADPFPTPTTGDRA 817

Query: 75  NAGGSIFAGY---NVEDSCIMYGVEGDVRYTVPVLADNIHSLH------GIG-------- 117
           + GG++  G    N +   ++ GVE    +      D     +      G          
Sbjct: 818 DLGGALLGGQIGANYQFGHLVAGVEASANWANIRGTDTCFGAYPNPVVAGFNCGSRIDAI 877

Query: 118 GSLRIRGGYEVSDSLLLYATVGPDVAQKYET-------GKAGEITPIAIGGTAGVGVEVG 170
           G+   RGGY + D  LLY   G    ++ +        G     T    G T G G+E  
Sbjct: 878 GAFTARGGYAI-DRTLLYVKGGAAWDRQQDQFNTVGVGGTTLANTSTNWGWTVGGGLEY- 935

Query: 171 GLSESLVARLEYRASKYSKVEGFYNTIS 198
            L+ S    LEY+   +     F  +++
Sbjct: 936 ALAPSWSMALEYKYFDFGASPAFSTSVT 963



 Score = 63.1 bits (152), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 44/217 (20%), Positives = 66/217 (30%), Gaps = 49/217 (22%)

Query: 34  GRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSFGEEAHHNAGGSIFA----------- 82
           G   V           +  + G Y G+ A   G FG     +A G++ A           
Sbjct: 240 GAASVSAAPLPGVPLPQWSWTGIYLGVHAG--GGFGSNDWDSATGALLAASTSGGFPGRG 297

Query: 83  -----------GYNVEDSCIMYGVEGDV------RYTVPVLADNI------HSLHGIGGS 119
                      G N +    + GVE          Y               H+     G+
Sbjct: 298 DSSGLFGGGQIGANYQFGRWVAGVEASAAAADIGGYAKCATDVGTRRNFTCHNELSSLGT 357

Query: 120 LRIRGGYEVSDSLLLYATVGPD-VAQKYETGKAGE-----ITPIAIGGTAGVGVEVGGLS 173
           +  R G    + LL+Y   G        +  +AG       +    G   G G+E   LS
Sbjct: 358 ITGRLGQTWGN-LLIYGKAGAAWATGSSDAQRAGSASRFTESGTRWGWVTGTGLEY-ALS 415

Query: 174 ESLVARLEYRASKYSK-----VEGFYNTISLGVGMKF 205
            +L A +EY    +       V+ F N   +G   KF
Sbjct: 416 PNLSAFVEYNHVDFGTQDTAYVDQFGNASEVGFKQKF 452


>gi|312113068|ref|YP_004010664.1| hypothetical protein Rvan_0276 [Rhodomicrobium vannielii ATCC
           17100]
 gi|311218197|gb|ADP69565.1| hypothetical protein Rvan_0276 [Rhodomicrobium vannielii ATCC
           17100]
          Length = 260

 Score = 80.5 bits (197), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 42/234 (17%), Positives = 72/234 (30%), Gaps = 41/234 (17%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M  +    G +     +   A AADP     +GG G        + V     + G Y G 
Sbjct: 1   MSVVKSVGGAALGMFLAAQVAYAADPYYGGGYGGYGGYKDPYPPQPVAPIPLWQGFYIGG 60

Query: 61  SALYNGSFGEEAHH-------------------NAGGSIFAGYNVEDSCIMYGVEGDVRY 101
           +     S  E A +                      G +  GYN+     ++G+EGD+  
Sbjct: 61  NIGGAWSTIETASNVVFVNGATTVLSDRSVEGSGFLGGLQLGYNIPIGNFLWGIEGDLGG 120

Query: 102 TVPVLADN------------IHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETG 149
                + +            + S  G  G + +RGG+ +  + L+Y   G          
Sbjct: 121 LGNDASKSFAVGGVLPSVLTVSSDGGWYGDVTVRGGF-LYGNALIYLKGGFGFYTGETNV 179

Query: 150 KAGEI--------TPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFYN 195
                        +    G T G G+E   +S     + EY    +      ++
Sbjct: 180 TLVTDNISALRQSSGTFTGWTLGGGLEYQ-VSPRWSIKAEYLYFDFGDSTLNFD 232


>gi|254561199|ref|YP_003068294.1| outer membrane porin [Methylobacterium extorquens DM4]
 gi|254268477|emb|CAX24434.1| Putative outer membrane porin (OMPA-like) [Methylobacterium
           extorquens DM4]
          Length = 703

 Score = 80.5 bits (197), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 53/241 (21%), Positives = 75/241 (31%), Gaps = 75/241 (31%)

Query: 7   AVGVSSLALASF--CSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALY 64
           AV     A+  F   +  AAD   RA                 P   D++G YAG+    
Sbjct: 14  AVSAGLAAILGFHAGAGMAADLAERAG----------------PRFIDWSGFYAGVQGSA 57

Query: 65  NGSFGE----------------EAHHNAG------------GSIFAGYNVEDSCIMYGVE 96
             SFG                       G            G  FAG+N +D   +YGVE
Sbjct: 58  GASFGNYDFGPTTIGSRRVRSISTGDATGSRDLGGDATTAVGGAFAGWNWQDGAFVYGVE 117

Query: 97  GD-VRYTVPVLADNIHSLHGIG----------------GSLRIRGGYEVSDSLLLYATVG 139
            D V   +   A +  +  G                  G+ R R GY   ++ L+YAT G
Sbjct: 118 ADLVGANLKRGARSDATGFGYEGIDPPFALIREKTEVFGAARARLGYAFGNN-LIYATAG 176

Query: 140 PDVAQKYETGKAGE----------ITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSK 189
              A         +               +G T G GV+   +   L   ++YR S   +
Sbjct: 177 LTGANGRVLATYPDLAGGPTVTATRNVSYLGFTLGAGVQF-AVDPHLSLGIDYRYSDLGE 235

Query: 190 V 190
            
Sbjct: 236 S 236


>gi|319898375|ref|YP_004158468.1| Hemin-binding protein E [Bartonella clarridgeiae 73]
 gi|319402339|emb|CBI75878.1| Hemin-binding protein E [Bartonella clarridgeiae 73]
          Length = 288

 Score = 80.1 bits (196), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 47/290 (16%), Positives = 80/290 (27%), Gaps = 98/290 (33%)

Query: 7   AVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSAL--- 63
            +  S          QAAD +                   V     + G Y G       
Sbjct: 6   LMITSIWIFVLASMVQAADIMIPYQQQSHQ-----PAPMIVSSDFSWTGFYFGGQVGGFS 60

Query: 64  ----YNGSFGEEAH------------HNAGGSIFAGYNVEDSC-IMYGVEGDVRYTVPVL 106
                 G    +A                 G ++AG NV     ++ G++ D+ ++    
Sbjct: 61  SKSTVRGRRNSDAEWESLEPKYLPKLSGVIGGVYAGSNVNFGNGLILGIDTDMAWSGKKD 120

Query: 107 ADNIHS-------------------------------------------------LHGIG 117
              IH                                                       
Sbjct: 121 TKIIHREEQNEETVEEESTRRQENTRNNNSRVERSVQVCAVAEEGSNPVSSSHTLKEKWV 180

Query: 118 GSLRIRGGYEVSDSLLLYATVGPDVAQKYE-------------TGKAGEITPIAIGGTAG 164
           G+ R+R G+ V D ++ Y + G    Q  +             T    + T + +G T G
Sbjct: 181 GATRVRIGFAV-DRVMPYVSGGVAYTQLQDLLTIRKEGKELPITRNVIDDTKVFVGYTFG 239

Query: 165 VGVEVGGLSESLVARLEYRASKYSKVEGFY---------NTISLGVGMKF 205
            G++   +++S++ R EYR S + K +            N   +GV  KF
Sbjct: 240 GGIDF-AMAKSVILRAEYRYSDFGKKKFAKDKMEIGYKTNDFRVGVAYKF 288


>gi|254710345|ref|ZP_05172156.1| 22 kDa outer membrane protein precursor [Brucella pinnipedialis
           B2/94]
 gi|256255239|ref|ZP_05460775.1| 22 kDa outer membrane protein precursor [Brucella ceti B1/94]
 gi|260168973|ref|ZP_05755784.1| 22 kDa outer membrane protein precursor [Brucella sp. F5/99]
 gi|261222435|ref|ZP_05936716.1| Omp22 [Brucella ceti B1/94]
 gi|261317908|ref|ZP_05957105.1| conserved hypothetical protein [Brucella pinnipedialis B2/94]
 gi|261758466|ref|ZP_06002175.1| outer membrane protein [Brucella sp. F5/99]
 gi|46251269|gb|AAS84605.1| Omp22 [Brucella pinnipedialis]
 gi|46251271|gb|AAS84606.1| Omp22 [Brucella ceti]
 gi|46251273|gb|AAS84607.1| Omp22 [Brucella ceti]
 gi|260921019|gb|EEX87672.1| Omp22 [Brucella ceti B1/94]
 gi|261297131|gb|EEY00628.1| conserved hypothetical protein [Brucella pinnipedialis B2/94]
 gi|261738450|gb|EEY26446.1| outer membrane protein [Brucella sp. F5/99]
          Length = 212

 Score = 80.1 bits (196), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 45/205 (21%), Positives = 71/205 (34%), Gaps = 26/205 (12%)

Query: 17  SFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSFGEE---AH 73
              SA AAD +    +     V            HD++G Y G     + S       + 
Sbjct: 18  FAGSAFAADMMGGTDYTYNDPVAAGP--------HDWSGNYVGARVGGSSSKFPSPFASR 69

Query: 74  HNAGGSIFAGYNVEDSCIMYGV--EGDVRYTVPVLADNIHSLHGIGGSLRIRGGYEVSDS 131
             A G I  G N+++  I++G   EG+       +           G+ + + GY   D 
Sbjct: 70  TGALGGIVVGKNMQNGNIVFGAELEGNFAEAEHRIGHGGTLQQSWNGNAKGKVGYAF-DK 128

Query: 132 LLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVE 191
            L+Y T G  V +               G   G GVE   LS  L  + EY   +++ V+
Sbjct: 129 TLVYGTAGYGVTRFKAKDNTTSAPGWEGGVLIGAGVE-QALSGPLSVKAEYDFQRFNDVK 187

Query: 192 G-----------FYNTISLGVGMKF 205
                         ++I  G+  KF
Sbjct: 188 SQVNGIEQRNNLKNHSIKAGLNYKF 212


>gi|12620707|gb|AAG60983.1|AF322013_102 ID693 [Bradyrhizobium japonicum]
          Length = 325

 Score = 80.1 bits (196), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 46/210 (21%), Positives = 77/210 (36%), Gaps = 35/210 (16%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K+ +       AL +   +   D   +        +P  A         D++G Y G 
Sbjct: 85  MKKILILTACIG-ALCAAAPSFGTDLAGQPVKVKAAPLPVAA------PIIDWSGYYMGA 137

Query: 61  SALY---------NGSFGEEAHHNAGGSIFA--GYNVEDSCIMYGVEGDVRYTVPVLA-- 107
           +  +         NG   E  H++ GG++    GY  +   ++YG+EG   +     +  
Sbjct: 138 NGGWGTSHNCWDFNGITSEGCHNSTGGTVGGQIGYRWQIFNMVYGLEGQGNWADFRGSNV 197

Query: 108 ------DNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQK--YETGKA-----GEI 154
                 D + +     G L    GY   +++LLY   G  V     Y    A     G+ 
Sbjct: 198 STAFPTDTVGTTTDAFGLLTGHIGYAF-NAVLLYGKGGAAVTSNTYYVNSVATGTELGKN 256

Query: 155 TPIAIGGTAGVGVEVGGLSESLVARLEYRA 184
             +  GG  G G EV  L+ +  A +EY  
Sbjct: 257 NDVRWGGVLGAGAEVS-LTPNWSAGVEYNH 285


>gi|39933934|ref|NP_946210.1| outer membrane protein [Rhodopseudomonas palustris CGA009]
 gi|39647781|emb|CAE26301.1| possible outer membrane protein [Rhodopseudomonas palustris CGA009]
          Length = 244

 Score = 80.1 bits (196), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 40/205 (19%), Positives = 67/205 (32%), Gaps = 46/205 (22%)

Query: 39  PTIATNRYVP-IRHDFNGPYAGLSALYNGSFGEEAHHNAG----------GSIFAGYNVE 87
           P      Y P   +++ G Y G      G+F  +     G          G + AGY+ +
Sbjct: 38  PYTKAPAYAPAPVYNWTGFYIGGHIG--GAFSGDNSIGTGVTASDNGKFLGGVQAGYDWQ 95

Query: 88  D-SCIMYGVEGDVRYTVPVLADNIHSLHGIGG-------------SLRIRGGYEVSDSLL 133
                + GVEG  +Y+  +   N     G  G             S+  R GY      L
Sbjct: 96  FAPNWVLGVEG--QYSW-LSGTNSSVSWGAPGAVFTYSDNQRGLASVTGRLGYTW-GPAL 151

Query: 134 LYATVGPDVAQ-----KYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYS 188
           LY   G   A       +        +    G T G G+E    + +   ++EY+   + 
Sbjct: 152 LYVKGGWAYADYSSSLTFNNVGVAVDSKT-DGYTVGGGLEYL-FAPNWSGKIEYQYYDFG 209

Query: 189 KV--------EGFYNTISLGVGMKF 205
            V        +   + +  G+  +F
Sbjct: 210 NVTLAPGFTAKNDEHVVKAGLNYRF 234


>gi|209885837|ref|YP_002289694.1| OmpA domain protein transmembrane region-containing protein
           [Oligotropha carboxidovorans OM5]
 gi|209874033|gb|ACI93829.1| OmpA domain protein transmembrane region-containing protein
           [Oligotropha carboxidovorans OM5]
          Length = 236

 Score = 79.7 bits (195), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 46/226 (20%), Positives = 72/226 (31%), Gaps = 50/226 (22%)

Query: 17  SFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSAL--YNGS------- 67
           S  S  AAD   R          T A    V   +++ G Y G      + GS       
Sbjct: 14  SSTSVFAADLAAR--------PYTKAPPAPVAPIYNWTGLYIGAQVGGAFQGSSGFVTDD 65

Query: 68  ---FGEEAHHNAGGSIFAGYNVE-DSCIMYGVEGDVR------YTVPVLADNIHSLHGIG 117
               G     +  G    G N +     + G+EG+        YT     D I   +   
Sbjct: 66  PLVTGNRDDSSFLGGGVLGANYQFSPNWVLGIEGEFNGLSNNRYTFTDGFDGIRVKNDWL 125

Query: 118 GSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAI-----GGTAGVGVEVGGL 172
            S+  R GY      ++YA  G       + G     TP  +     G T G G+E    
Sbjct: 126 ASVTGRLGYTW-GPGMIYAKGGVAF---RDNGGIAATTPFLVSRDTTGYTVGAGLEY-MF 180

Query: 173 SESLVARLEYRASKYSKV-------------EGFYNTISLGVGMKF 205
           + +  A++EY+   + +                  +T+  G+   F
Sbjct: 181 APAWSAKIEYQYYDFDRTALTFGTLPSTVSYRDDLHTVKAGINYHF 226


>gi|27379978|ref|NP_771507.1| outer-membrane immunogenic protein [Bradyrhizobium japonicum USDA
           110]
 gi|27353131|dbj|BAC50132.1| bll4867 [Bradyrhizobium japonicum USDA 110]
          Length = 258

 Score = 79.7 bits (195), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 36/178 (20%), Positives = 61/178 (34%), Gaps = 27/178 (15%)

Query: 39  PTIATNRYVPIRHDFNGPYAGLSAL---------YNGSFGEEAHHNAGGSIFA--GYNVE 87
           P       V   +D++G Y G++             G   E +H   GG++    GY  +
Sbjct: 48  PYTKAPAMVAAIYDWSGFYIGINGGGGSAHSTWDLVGGGREGSHDATGGTVGGQIGYRWQ 107

Query: 88  DSCIMYGVEGDVRYTV-------PVLADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGP 140
               ++GVEG   +          + A    S     G +  + GY   +++L+Y   G 
Sbjct: 108 SGQWVFGVEGQGNWADFSGDNVSALFATRNRSKIDSFGLITGQVGYAW-NNVLIYVKGGA 166

Query: 141 DVAQKYETGKA-------GEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVE 191
            VA       +               GGT G G+E  G + +    +EY        +
Sbjct: 167 AVAGTKYEVFSTASGALLSSNDQTRWGGTVGAGLEY-GFAPNWSVGVEYNHIFLQDKD 223


>gi|163851436|ref|YP_001639479.1| carbohydrate-selective porin OprB [Methylobacterium extorquens PA1]
 gi|163663041|gb|ABY30408.1| Carbohydrate-selective porin OprB [Methylobacterium extorquens PA1]
          Length = 703

 Score = 79.7 bits (195), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 42/203 (20%), Positives = 64/203 (31%), Gaps = 57/203 (28%)

Query: 43  TNRYVPIRHDFNGPYAGLSALYNGSFGE----------------EAHHNAG--------- 77
             R  P   D++G YAG+      SFG                       G         
Sbjct: 36  AERARPRFIDWSGFYAGVQGSAGASFGNYDFGPTTIGSRRVRSISTGDATGSRDLGGDAT 95

Query: 78  ---GSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHS-----------------LHGIG 117
              G  FAG+N +D  ++YG+E D+            +                    + 
Sbjct: 96  TAVGGAFAGWNWQDGALVYGIEADLVGANLKRGARSDATGFGYEGIDPPFALIREKTDVF 155

Query: 118 GSLRIRGGYEVSDSLLLYATVGPDVAQKY------ETGKAGEITPIA----IGGTAGVGV 167
           G+ R R GY   ++ L+YAT G   A         +       T       +G T G GV
Sbjct: 156 GAARARLGYAFGNN-LIYATAGLTGANGRVLATYPDLAGGPTATATRNVSYLGFTLGAGV 214

Query: 168 EVGGLSESLVARLEYRASKYSKV 190
           +   +   L   ++YR S   + 
Sbjct: 215 QF-AVDPHLSLGIDYRYSDLGES 236


>gi|218678361|ref|ZP_03526258.1| outer membrane protein [Rhizobium etli CIAT 894]
          Length = 96

 Score = 79.7 bits (195), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 35/102 (34%), Positives = 51/102 (50%), Gaps = 8/102 (7%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+ L   +  S  A+A   +AQAAD V +           +A +  V    ++ G Y G 
Sbjct: 1   MRVLIAGLMASVFAIAGISAAQAADAVDQIPEA------PVAQDAPVKPAGNWEGFYLGG 54

Query: 61  SALYN-GSFGEEAH-HNAGGSIFAGYNVEDSCIMYGVEGDVR 100
           +  YN GSFG + H +  GG +F GYN +   I+YGVE D+ 
Sbjct: 55  AGTYNMGSFGSDRHTYGFGGQVFTGYNWQQGQIVYGVESDLG 96


>gi|240138602|ref|YP_002963074.1| putative outer membrane porin (OMPA-like) [Methylobacterium
           extorquens AM1]
 gi|240008571|gb|ACS39797.1| Putative outer membrane porin (OMPA-like) [Methylobacterium
           extorquens AM1]
          Length = 703

 Score = 79.7 bits (195), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 39/194 (20%), Positives = 61/194 (31%), Gaps = 57/194 (29%)

Query: 52  DFNGPYAGLSALYNGSFGE----------------EAHHNAG------------GSIFAG 83
           D++G YAG+      SFG                       G            G  FAG
Sbjct: 45  DWSGFYAGVQGSAGASFGNYDLGPTTIGPRRVRSISTGDATGSRDLGGDATTAVGGAFAG 104

Query: 84  YNVEDSCIMYGVEGDVRYTVPVLADNIHS-----------------LHGIGGSLRIRGGY 126
           +N +D  ++YG+E D+            +                    + G+ R R GY
Sbjct: 105 WNWQDGALVYGIEADLVGANLKRGARSDAMGFGYEGIDPPFALIREKTDVFGAARARLGY 164

Query: 127 EVSDSLLLYATVGPDVAQKYETGKAGE----------ITPIAIGGTAGVGVEVGGLSESL 176
              ++ L+YAT G   A         +               +G T G GV+   +   L
Sbjct: 165 AFGNN-LIYATAGLTGANGRVLATYPDLAGGPTVTATRNVSYLGFTLGAGVQF-AVDPHL 222

Query: 177 VARLEYRASKYSKV 190
              ++YR S   + 
Sbjct: 223 SLGIDYRYSDLGES 236


>gi|256061359|ref|ZP_05451503.1| 22 kDa outer membrane protein precursor [Brucella neotomae 5K33]
 gi|261325360|ref|ZP_05964557.1| Omp22 [Brucella neotomae 5K33]
 gi|46251267|gb|AAS84604.1| Omp22 [Brucella neotomae]
 gi|261301340|gb|EEY04837.1| Omp22 [Brucella neotomae 5K33]
          Length = 212

 Score = 79.7 bits (195), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 45/205 (21%), Positives = 71/205 (34%), Gaps = 26/205 (12%)

Query: 17  SFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSFGEE---AH 73
              SA AAD +    +     V            HD++G Y G     + S       + 
Sbjct: 18  FAGSAFAADMMGGTDYTYNDPV--------AAGLHDWSGNYVGAQVGGSSSKFPSPFASR 69

Query: 74  HNAGGSIFAGYNVEDSCIMYGV--EGDVRYTVPVLADNIHSLHGIGGSLRIRGGYEVSDS 131
             A G I  G N+++  I++G   EG+       +           G+ + + GY   D 
Sbjct: 70  TGALGGIVVGKNMQNGNIVFGAELEGNFAEAEHRIGHGGTLQQSWNGNAKGKVGYAF-DK 128

Query: 132 LLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVE 191
            L+Y T G  V +               G   G GVE   LS  L  + EY   +++ V+
Sbjct: 129 TLVYGTAGYGVTRFKAKDNTTSAPGWEGGVLIGAGVE-QALSGPLSVKAEYDFQRFNDVK 187

Query: 192 G-----------FYNTISLGVGMKF 205
                         ++I  G+  KF
Sbjct: 188 SQVNGIEQRNNLKNHSIKAGLNYKF 212


>gi|192291549|ref|YP_001992154.1| hypothetical protein Rpal_3175 [Rhodopseudomonas palustris TIE-1]
 gi|192285298|gb|ACF01679.1| conserved hypothetical protein [Rhodopseudomonas palustris TIE-1]
          Length = 566

 Score = 79.3 bits (194), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 47/228 (20%), Positives = 73/228 (32%), Gaps = 57/228 (25%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+     + VS++   S  +A+AAD  R             A         ++ G Y G 
Sbjct: 1   MRT--SIICVSAVLAVSCGAAEAADLSR-------------APATKAITAWNWTGFYLGG 45

Query: 61  SALYNGSFGEEAHHNAGGSIF--------------AGYNVEDSC--IMYGVEGD------ 98
                G    +  +  G SI+              AGYN +      + GVE D      
Sbjct: 46  HLG-AGFGTAKVDNPFGPSIYGDTVRAPKALAGLQAGYNWQAHGSPWVLGVEVDASAIDA 104

Query: 99  ------VRYTVPVLADNIHSLHGIGGSLRIRGGYEV--SDSLLLYATVGPDV-------- 142
                 + Y+   ++ N      + G+L  R G+        L+Y   G           
Sbjct: 105 DGTNTCLAYSGQFVSANCRVREHVVGTLTGRLGHAFGPDGRSLMYVKGGGAFLFGNFRMT 164

Query: 143 --AQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYS 188
             A  Y    + E+     G T G G+E   LS     R EY  + + 
Sbjct: 165 TNAPDYLNQPSAELDTTRWGWTVGAGIE-HALSSRWAVRAEYDYANFG 211


>gi|319408577|emb|CBI82232.1| putative Hemin-binding protein B [Bartonella schoenbuchensis R1]
 gi|319408616|emb|CBI82271.1| putative Hemin-binding protein B [Bartonella schoenbuchensis R1]
          Length = 439

 Score = 79.3 bits (194), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 27/115 (23%), Positives = 46/115 (40%), Gaps = 24/115 (20%)

Query: 113 LHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQK-------------YETGKAGEITPIAI 159
                G+ R+R G+ V D ++ Y   G   AQ                +  +     I +
Sbjct: 327 KQKWSGATRVRIGFAV-DRIVPYIAGGVAYAQLQNIFSRSIETEGHEISSSSLSDKKIMV 385

Query: 160 GGTAGVGVEVGGLSESLVARLEYRASKYSK---------VEGFYNTISLGVGMKF 205
           G T G GV+   ++++++ R EYR S + K         ++   N   +GV  KF
Sbjct: 386 GYTLGGGVDF-AMADNVILRAEYRYSDFGKQKFAKDKLELDYQTNDFRVGVAYKF 439



 Score = 47.0 bits (110), Expect = 0.001,   Method: Composition-based stats.
 Identities = 25/138 (18%), Positives = 43/138 (31%), Gaps = 38/138 (27%)

Query: 5   FLAVGVSSLALASFCSAQAAD--------PVRRAHHGGRGVVPTIA-------TNRYVPI 49
              +  S + L +   AQAAD        PV       + + P +               
Sbjct: 4   KCLISTSIITLFTASVAQAADIMVPRESRPVVSPPQASKQISPPVEMSPNSDIPPVISAP 63

Query: 50  RHDFNGPYAGLS-ALYNGSFGEEAHHNAG---------------------GSIFAGYNVE 87
              +NG Y G     ++G  G   +   G                     G ++AG NV+
Sbjct: 64  TFSWNGFYLGGQIGGFSGKTGISLYAKKGPSTREWTPVEKDTVPQLSGFMGGLYAGANVD 123

Query: 88  DSC-IMYGVEGDVRYTVP 104
                + GV+ D+ ++  
Sbjct: 124 LGNSFILGVDTDIVWSNK 141


>gi|39935901|ref|NP_948177.1| hypothetical protein RPA2834 [Rhodopseudomonas palustris CGA009]
 gi|39649755|emb|CAE28276.1| conserved hypothetical protein [Rhodopseudomonas palustris CGA009]
          Length = 566

 Score = 79.3 bits (194), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 47/228 (20%), Positives = 73/228 (32%), Gaps = 57/228 (25%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+     + VS++   S  +A+AAD  R             A         ++ G Y G 
Sbjct: 1   MRT--SIICVSAVLAVSCGAAEAADLSR-------------APATKAITAWNWTGFYLGG 45

Query: 61  SALYNGSFGEEAHHNAGGSIF--------------AGYNVEDSC--IMYGVEGD------ 98
                G    +  +  G SI+              AGYN +      + GVE D      
Sbjct: 46  HLG-AGFGTAKVDNPFGPSIYGDTVRAPKALAGLQAGYNWQAHGSPWVLGVEVDASAIDA 104

Query: 99  ------VRYTVPVLADNIHSLHGIGGSLRIRGGYEV--SDSLLLYATVGPDV-------- 142
                 + Y+   ++ N      + G+L  R G+        L+Y   G           
Sbjct: 105 DGTNTCLAYSGQFVSANCRVREHVVGTLTGRLGHAFGPDGRSLMYVKGGGAFLFGNFRMT 164

Query: 143 --AQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYS 188
             A  Y    + E+     G T G G+E   LS     R EY  + + 
Sbjct: 165 TNAPDYLNQPSAELDTTRWGWTVGAGIE-HALSSRWAVRAEYDYANFG 211


>gi|316932343|ref|YP_004107325.1| porin [Rhodopseudomonas palustris DX-1]
 gi|315600057|gb|ADU42592.1| porin [Rhodopseudomonas palustris DX-1]
          Length = 448

 Score = 79.3 bits (194), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 34/201 (16%), Positives = 54/201 (26%), Gaps = 43/201 (21%)

Query: 47  VPIRHDFNGPYAGLSALYNGSFGEE-------------AHHNAGGSIFAGYNVEDSCIMY 93
            P   ++ G Y G +     +                 A     G    GYN +    ++
Sbjct: 241 APPPANWAGLYIGGNFGGATARDRSSVTIAGVTDAFNLAPDGFFGGGQIGYNWQAVNWVF 300

Query: 94  GVEGDVRYTVPVLADNI--------HSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQK 145
           GVE D + +                 +     G+ R R GY +  S L Y T G      
Sbjct: 301 GVEADFQGSTLKDQRAAVLGPAVFYDAKLPWFGTARGRIGYSL-GSTLFYGTAGYAYGNI 359

Query: 146 YETGKAG----EITPIAIGGTAGVGVEVGG-----LSESLVARLEYRASKYSKVEG---- 192
                +            G  AG G+E        L  +  ++ EY              
Sbjct: 360 KTDIVSAIGNYSFKTTKGGWAAGAGIETPFQLFGLLGPNWTSKTEYLYVDLGSTTDAFGA 419

Query: 193 --------FYNTISLGVGMKF 205
                     +T+  G+   F
Sbjct: 420 TGINTTKVTQHTLRTGINYHF 440



 Score = 78.9 bits (193), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 47/225 (20%), Positives = 71/225 (31%), Gaps = 47/225 (20%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+++   V ++  A  S   AQAAD   +A +              V   +D+ G Y G 
Sbjct: 1   MKRILAGVVLAGTAAVS---AQAADLAVKAPYMK----------APVAAVYDWTGFYIGA 47

Query: 61  SALYNGSFGEEAHHNAGGSIF---------------AGYNVEDSCIM----YGVEGDVRY 101
           +         + H   G                    GYN +   +      GVE D++ 
Sbjct: 48  NVGVGLGRDLQTHSYPGAGTLNSTYLQPQGAIGGGQIGYNWQFGSMFGPMLIGVEADIQG 107

Query: 102 TV--------PVLADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAG- 152
           +           LA N +      G++R R G  V      Y T G  V     T   G 
Sbjct: 108 SGMSDGYTSLNGLATNYNQKLDWFGTVRGRVGL-VRGPAFGYFTGGYAVGNVKTTVTEGG 166

Query: 153 ----EITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGF 193
               + +    G   G GVE   L  +   ++EY          F
Sbjct: 167 LVAFDNSKTRSGWVIGSGVEA-ALGGNWSGKIEYLYLDLGNQTDF 210


>gi|240142230|ref|YP_002966740.1| hypothetical protein MexAM1_META2p0552 [Methylobacterium extorquens
           AM1]
 gi|240012174|gb|ACS43399.1| Hypothetical protein MexAM1_META2p0552 [Methylobacterium extorquens
           AM1]
          Length = 269

 Score = 79.3 bits (194), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 32/192 (16%), Positives = 61/192 (31%), Gaps = 48/192 (25%)

Query: 52  DFNGPYAGLSALYNGSFGEEAHHN---------------AGGSIFAGYNVEDSCIMYGVE 96
           D++G Y G       +       +                 G    G++ +   +++G  
Sbjct: 58  DWSGAYVGFQVGGAFAGKPSIGDDRVTRSLLSNGREFSGFTGGGHVGFDYQVGSVVFGGI 117

Query: 97  GDVRYTV-----------------PVLADNIHSLHGIGGSLRIRGGYEVSD-SLLLYATV 138
           GD+ Y                           +   I G++R R G+   D  +L Y T 
Sbjct: 118 GDINYVDIRAKGAGPFTLVQNGVVTTYNATGTAGLEIDGTVRARLGFAGLDLPILPYVTG 177

Query: 139 GPDVAQKY--------------ETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRA 184
           G  +   +               T +    +   +G   G GV+    ++++ AR+EY  
Sbjct: 178 GLALGTGFGNFRLLGTDPATGAVTSQNLRDSRTNVGYAVGGGVDY-AFTDNIRARVEYLY 236

Query: 185 SKYSKVEGFYNT 196
           +  S+   F N 
Sbjct: 237 TDLSQARYFQNV 248


>gi|300025034|ref|YP_003757645.1| porin [Hyphomicrobium denitrificans ATCC 51888]
 gi|299526855|gb|ADJ25324.1| porin [Hyphomicrobium denitrificans ATCC 51888]
          Length = 231

 Score = 79.3 bits (194), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 43/200 (21%), Positives = 67/200 (33%), Gaps = 47/200 (23%)

Query: 51  HDFNGPYAGLSALYNGSFGEEAHH---------NAGGSIFAGYNVEDSC-IMYGVEGDVR 100
            D+ G YAGL A Y+ S    +              G  + GYN +    ++ G+E D+ 
Sbjct: 34  FDWTGAYAGLQAGYSWSSARYSDDTYLSEANPEGFIGGGYIGYNYQLPSRLVLGIEADIV 93

Query: 101 YTVPVLADN---------------IHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQK 145
            +    +D                +        ++R R GY      L Y   G      
Sbjct: 94  GSGMDGSDGQRYLDDPSVSIAGVELEMETRWSAAVRGRIGYAY-GRYLPYIAGGVSFTDY 152

Query: 146 Y------ETGKAG-EITPIAIGGTAGVGVEVGGLSESLVARLEYRASK------------ 186
                         +      G   G GVE    ++ ++ R EYR +             
Sbjct: 153 EFRWIDHVNATVPFKREQSRTGWNIGTGVEYAA-NDWVIVRAEYRYTDFGTDHFPNDFAG 211

Query: 187 -YSKVEGFYNTISLGVGMKF 205
            YSK+E   + + LGVG+KF
Sbjct: 212 PYSKMELQTHDLRLGVGVKF 231


>gi|148253089|ref|YP_001237674.1| OmpA-like transmembrane domain-containing protein [Bradyrhizobium
           sp. BTAi1]
 gi|146405262|gb|ABQ33768.1| OmpA-like transmembrane domain protein [Bradyrhizobium sp. BTAi1]
          Length = 598

 Score = 79.3 bits (194), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 37/156 (23%), Positives = 55/156 (35%), Gaps = 31/156 (19%)

Query: 78  GSIFAGYNVEDSC-IMYGVEGDVR-----------YTVPVLADNIHSLHGIGGSLRIRGG 125
           G +  GYN E    ++ GVE D+            ++       +       GSLR R G
Sbjct: 13  GGLQLGYNRELPSRVVLGVETDLSFPNYLDFDDIIWSGVNANGRVTEKVDYYGSLRGRIG 72

Query: 126 YEVSDSLLLYATVGPDVAQKYE-----TGKAGEITPIAIGGTAGVGVEVGGLSESLVARL 180
           Y      L+YAT G   +Q             +      G  AG GVE   +  +  AR+
Sbjct: 73  YA-PARWLIYATAGLAYSQGRLTEDPFDPATQKKIGFRAGWVAGAGVEAP-VDGNWTARI 130

Query: 181 EYRASKYSKVEGF------------YNTISLGVGMK 204
           EY  S +  +                +T+ LG+  K
Sbjct: 131 EYLYSNFGSLNVMLPSGTSYGSTFDLHTVRLGLNRK 166


>gi|90424594|ref|YP_532964.1| OmpA-like transmembrane region [Rhodopseudomonas palustris BisB18]
 gi|90106608|gb|ABD88645.1| OmpA-like transmembrane region [Rhodopseudomonas palustris BisB18]
          Length = 236

 Score = 79.3 bits (194), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 41/238 (17%), Positives = 71/238 (29%), Gaps = 45/238 (18%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+KL L    ++  +     A AAD             P         + +++ G Y G 
Sbjct: 1   MRKLLLG---TAALMVLAAPAFAADL----PAPTYTKAPAYTAPE---VVYNWTGFYIGG 50

Query: 61  SALYNGSFGEEAHHNAG---GSIFAGYNVE-DSCIMYGVEGDVRYTVPVLADNIHSLHGI 116
                 +       N G   G +  G + +     + G+E    +        +    G 
Sbjct: 51  HVGGAFAGDNNISGNDGQFLGGVQIGADYQFTRNWVVGLEAQYSWLPSNDNGGLAFPGGS 110

Query: 117 --------GGSLRIRGGYEVSDSLLLYATVGPD-------VAQKYETGKAGEITPIAIGG 161
                    GS+  R GY      LLYA  G         ++                G 
Sbjct: 111 LVTQDNRGLGSVTGRLGYTW-GPALLYAKGGYAFRDSSLDLSNTGVGVPFTTSGNHRDGY 169

Query: 162 TAGVGVEVGGLSESLVARLEYRASKYSK--------------VEGFYNTISLGVGMKF 205
           T G G+E    + +  A++EY+   +                V    +T+  G+  +F
Sbjct: 170 TVGAGLEY-MFAPNWSAKVEYQYYDFGNTTFTGGPPDVLGASVRNDEHTVKAGLNYRF 226


>gi|218530244|ref|YP_002421060.1| carbohydrate-selective porin OprB [Methylobacterium
           chloromethanicum CM4]
 gi|218522547|gb|ACK83132.1| Carbohydrate-selective porin OprB [Methylobacterium
           chloromethanicum CM4]
          Length = 703

 Score = 78.9 bits (193), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 42/203 (20%), Positives = 64/203 (31%), Gaps = 57/203 (28%)

Query: 43  TNRYVPIRHDFNGPYAGLSALYNGSFGE----------------EAHHNAG--------- 77
             R  P   D++G YAG+      SFG                       G         
Sbjct: 36  AERARPRFIDWSGFYAGVQGSAGASFGNYDFGPTTIGSRRVRSISTGDATGSRDLGGDAT 95

Query: 78  ---GSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHS-----------------LHGIG 117
              G  FAG+N +D  ++YG+E D+            +                    + 
Sbjct: 96  TAVGGAFAGWNWQDGALVYGIEADLVGANLKRGARSDAMGFGYEGIDPPFALIREKTDVF 155

Query: 118 GSLRIRGGYEVSDSLLLYATVGPDVAQKY------ETGKAGEITPIA----IGGTAGVGV 167
           G+ R R GY   ++ L+YAT G   A         +       T       +G T G GV
Sbjct: 156 GAARARLGYAFGNN-LIYATAGLTGANGRVLATYPDLAGGPTATATRNVSYLGFTLGAGV 214

Query: 168 EVGGLSESLVARLEYRASKYSKV 190
           +   +   L   ++YR S   + 
Sbjct: 215 QF-AVDPHLSLGIDYRYSDLGES 236


>gi|146340934|ref|YP_001205982.1| putative outer-membrane protein [Bradyrhizobium sp. ORS278]
 gi|146193740|emb|CAL77757.1| putative outer-membrane protein; putative secreted protein
           [Bradyrhizobium sp. ORS278]
          Length = 261

 Score = 78.9 bits (193), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 45/221 (20%), Positives = 69/221 (31%), Gaps = 50/221 (22%)

Query: 5   FLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALY 64
              +  +S+AL     A AAD   R +              YV     + G Y GL+   
Sbjct: 4   TALITTASVALLGLAPASAADFATRPYGK-------APPPAYVTPLPSWAGFYLGLNGGA 56

Query: 65  NGSFGEEAHHNAGG-------------------SIFAGYNVEDSCIMYGVEGDVRYTVPV 105
           + S      +N GG                       GY  + +  ++G+E    +T   
Sbjct: 57  DWSRNCWTLNNVGGVPVAPRQSEGCHNASSGLIGGQVGYRWQAASWVFGLEAQGNWTDLK 116

Query: 106 LADN----------IHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKA---- 151
            ++             +     G    + GY   D++L Y   G  VA    TG A    
Sbjct: 117 SSNASTAALAAGITNTTKTDAIGLFTGQVGYAW-DNVLWYVKGGAAVAHNKYTGTANAAA 175

Query: 152 --------GEITPIAIGGTAGVGVEVGGLSESLVARLEYRA 184
                      +    GGT G GVE  G + +    +EY  
Sbjct: 176 PVAVGTLLDSASETRWGGTVGTGVEY-GFAPNWSVAVEYDH 215


>gi|148255739|ref|YP_001240324.1| putative outer-membrane protein [Bradyrhizobium sp. BTAi1]
 gi|146407912|gb|ABQ36418.1| putative outer-membrane protein [Bradyrhizobium sp. BTAi1]
          Length = 245

 Score = 78.9 bits (193), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 38/212 (17%), Positives = 65/212 (30%), Gaps = 48/212 (22%)

Query: 39  PTIATNRYVPIRHDFNGPYAGLSA------------------LYNGSFGEEAHHNAGGSI 80
           P       V     ++G YAG+                     + G+     +    G +
Sbjct: 29  PYTKAPPVVVPILSWSGIYAGIQGGGGWGTSKETFIGRFNAPGFLGTQNYNTNGGFVGGV 88

Query: 81  FAGYNVEDSCIMYGVEGDVRYTVPV---------LADNIHSLHGIGGSLRIRGGYEVSDS 131
             GYN +   ++ G+EGD  ++            + D   +     G ++ R GY V   
Sbjct: 89  I-GYNWQFDNLVVGLEGDYHWSDINGRSAVINAGVGDTYFTKLTSFGDIKGRLGYAV-GP 146

Query: 132 LLLYATVGPDVAQKYETGKAGE-----ITPIAIGGTAGVGVEVGGLSESLVARLEYRASK 186
            L + + G  V +                    G T G G E    + +  A+LEY    
Sbjct: 147 ALFFVSGGAAVGELQHRYDRAAGVFFGQNTTRWGYTVGAGAEY-MFAPNWSAKLEYNYLD 205

Query: 187 YSKVEGFY-------------NTISLGVGMKF 205
           + K    Y             +T+  G+   F
Sbjct: 206 FGKSTLQYVGVPGRSEWKDSVHTVKAGLNYHF 237


>gi|17987000|ref|NP_539634.1| 22 kDa outer membrane protein precursor [Brucella melitensis bv. 1
           str. 16M]
 gi|17982651|gb|AAL51898.1| 22 kDa outer membrane protein precursor [Brucella melitensis bv. 1
           str. 16M]
          Length = 185

 Score = 78.9 bits (193), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 39/171 (22%), Positives = 64/171 (37%), Gaps = 18/171 (10%)

Query: 51  HDFNGPYAGLSALYNGSFGEE---AHHNAGGSIFAGYNVEDSCIMYGVE--GDVRYTVPV 105
           HD++G Y G     + S       +   A G I  G N+++  I++G E  G+       
Sbjct: 17  HDWSGNYVGAQVGGSSSKFPSPFASRTGALGGIVVGKNMQNGNIVFGAELEGNFAEAEHR 76

Query: 106 LADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGV 165
           +           G+ + + GY   D  L+Y T G  V +          +    G   G 
Sbjct: 77  IGHGGTLQQSWNGNAKGKVGYTF-DKTLVYGTAGYGVTRFKAKDNTTSASGCEGGVLIGA 135

Query: 166 GVEVGGLSESLVARLEYRASKYSKVEG-----------FYNTISLGVGMKF 205
           GVE   LS  L  + EY   +++ V+              ++I  G+  KF
Sbjct: 136 GVE-QALSGPLSVKAEYDFQRFNDVKSQVNGIEQRNNLKNHSIKAGLNYKF 185


>gi|154246409|ref|YP_001417367.1| porin [Xanthobacter autotrophicus Py2]
 gi|154160494|gb|ABS67710.1| porin [Xanthobacter autotrophicus Py2]
          Length = 248

 Score = 78.9 bits (193), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 39/213 (18%), Positives = 67/213 (31%), Gaps = 60/213 (28%)

Query: 51  HDFNGPYAGLSALYNG---------------SFGEEAHHNAGG---SIFAGYNVED-SCI 91
             + G Y G +  Y G                +      N+ G       GYN +  + +
Sbjct: 38  FSWTGFYIGANVGYGGDKFTFDEVESYYGYPYYANSTSLNSSGFFAGGQIGYNYQFANNV 97

Query: 92  MYGVEGDVRYTVPVLADNIHS---------------LHGIGGSLRIRGGYEVSDSLLLYA 136
           + GVE D++++     ++  S                    G++R R GY   D  L Y 
Sbjct: 98  VLGVETDLQWSGIEGKEDYSSVYVYGGYPYTSSYGASVDYFGTIRARIGYAF-DRFLPYI 156

Query: 137 TVGPDVAQKYETG-------KAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSK 189
           T G    +   +         +   +    G T G GVE   ++ +   + EY       
Sbjct: 157 TGGAAYGKTKISSSYAGDGFGSLSASATNWGWTVGGGVEY-AITNNWTFKTEYLYVDLGS 215

Query: 190 -----------------VEGFYNTISLGVGMKF 205
                            V+  ++T+  GV  KF
Sbjct: 216 TDYAYADGYGYYSYAGTVDTKFHTLKAGVNYKF 248


>gi|27377123|ref|NP_768652.1| hypothetical protein bll2012 [Bradyrhizobium japonicum USDA 110]
 gi|27350266|dbj|BAC47277.1| bll2012 [Bradyrhizobium japonicum USDA 110]
          Length = 308

 Score = 78.9 bits (193), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 46/210 (21%), Positives = 77/210 (36%), Gaps = 35/210 (16%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K+ +       AL +   +   D   +        +P  A         D++G Y G 
Sbjct: 68  MKKILILTACIG-ALCAAAPSFGTDLAGQPVKVKAAPLPVAA------PIIDWSGYYMGA 120

Query: 61  SALY---------NGSFGEEAHHNAGGSIFA--GYNVEDSCIMYGVEGDVRYTVPVLA-- 107
           +  +         NG   E  H++ GG++    GY  +   ++YG+EG   +     +  
Sbjct: 121 NGGWGTSHNCWDFNGITSEGCHNSTGGTVGGQIGYRWQIFNMVYGLEGQGNWADFRGSNV 180

Query: 108 ------DNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQK--YETGKA-----GEI 154
                 D + +     G L    GY   +++LLY   G  V     Y    A     G+ 
Sbjct: 181 STAFPTDTVGTTTDAFGLLTGHIGYAF-NAVLLYGKGGAAVTSNTYYVNSVATGTELGKN 239

Query: 155 TPIAIGGTAGVGVEVGGLSESLVARLEYRA 184
             +  GG  G G EV  L+ +  A +EY  
Sbjct: 240 NDVRWGGVLGAGAEVS-LTPNWSAGVEYNH 268


>gi|148255876|ref|YP_001240461.1| putative outer-membrane protein [Bradyrhizobium sp. BTAi1]
 gi|146408049|gb|ABQ36555.1| putative outer-membrane protein precursor [Bradyrhizobium sp.
           BTAi1]
          Length = 237

 Score = 78.9 bits (193), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 36/206 (17%), Positives = 68/206 (33%), Gaps = 35/206 (16%)

Query: 4   LFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAG--LS 61
           +   +  ++  +     A AAD   R          T A    +   +D++G Y G    
Sbjct: 1   MKKLLLTTTALVVLASPALAADLAAR--------PYTKAPPPVMAAIYDWSGFYIGVNGG 52

Query: 62  ALYNGSFGEE-------AHHNAGGSIFA--GYNVEDSCIMYGVEGDVRYTV-------PV 105
             +  +  +        +H ++GG+I    GY  +    ++GVE    +          +
Sbjct: 53  GGWTHNTWDVVGGGREGSHDSSGGTIGGQVGYRWQMGQFVFGVEAQGNWADFAGDNQSAL 112

Query: 106 LADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPD-------VAQKYETGKAGEITPIA 158
                 +     G    + GY   +++L+YA  G         +         G      
Sbjct: 113 FGTRNRTKTDAFGLFTGQVGYAF-NNVLVYAKGGAAITSNTYTITNAATGAFLGSNDNTR 171

Query: 159 IGGTAGVGVEVGGLSESLVARLEYRA 184
            GG  G G+E  G + +    +EY  
Sbjct: 172 WGGVVGAGLEY-GFAPNWSLGVEYDH 196


>gi|118593217|ref|ZP_01550602.1| outer membrane protein [Stappia aggregata IAM 12614]
 gi|118434108|gb|EAV40764.1| outer membrane protein [Stappia aggregata IAM 12614]
          Length = 251

 Score = 78.5 bits (192), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 35/162 (21%), Positives = 61/162 (37%), Gaps = 18/162 (11%)

Query: 40  TIATNRYVP-IRHDFNGPYAGLSALYN---------GSFGEEAHHNAGGSIFAGYNVEDS 89
           T  T  Y P  +  + GPY G     +         G   + +  +A   +F GYN E S
Sbjct: 61  TYETPLYAPTPQSLWAGPYLGFEGGVSQTVTELKSGGRTKDFSRVDAAFGLFGGYNWEVS 120

Query: 90  CIMYGVEGDVRYTVPVLA------DNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVA 143
             + GVEG   Y              I +      + + R G  + + ++ Y ++G    
Sbjct: 121 RFVLGVEGGAAYLGAREKGTHPTLGAIETGSKWTINAKARVGMPIKN-VMPYLSLGIAAT 179

Query: 144 QKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRAS 185
           +        E   +++G   G GVEV  + ++   R +Y  +
Sbjct: 180 EHSLKANGTERNSVSVGPVLGGGVEV-AVMDAWHLRADYSLT 220


>gi|319408066|emb|CBI81720.1| Hemin-binding protein C [Bartonella schoenbuchensis R1]
          Length = 287

 Score = 78.5 bits (192), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 46/293 (15%), Positives = 77/293 (26%), Gaps = 99/293 (33%)

Query: 4   LFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSAL 63
           +   + VS+  L +  + QA +           V P++     V     + G Y G    
Sbjct: 3   MKYLITVSAFVLLAISTVQAENGT--IPQESISVTPSVI----VTPSFSWTGFYLGGQIG 56

Query: 64  --------YNGSFGEE--------------AHHNAGGSIFAGYNVEDSC-IMYGVEGDVR 100
                    +G    +                    G  +AG NV      + GV+ D+ 
Sbjct: 57  IFSNKIDLSSGYLKNDDVEKWALIRKDFMPKLSGVVGGFYAGANVSLGNSFIIGVDTDMV 116

Query: 101 YTVPVLADNIHS-----------------------------------------------L 113
            +       +                                                  
Sbjct: 117 LSDKKDIKTVKINDYGQNEELRNENTARDSEGMVAASDCGIYNENIVSKIKFATYNHILK 176

Query: 114 HGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYET------------GKAGEITPIAIGG 161
               G+ R+R G+  +D ++ Y   G    Q  +                   T   IG 
Sbjct: 177 QKWAGATRVRVGFA-ADHVMPYVAGGISYTQLQDVLLRSSQEQGQIVDNTVGGTGTMIGY 235

Query: 162 TAGVGVEVGGLSESLVARLEYRASKYSKV---------EGFYNTISLGVGMKF 205
           T G GV+   +  +++ R EYR S + K              N   +GV  KF
Sbjct: 236 TLGAGVDFVMIGNTIL-RTEYRYSDFGKKQFAKSGVEHSYKTNDFRVGVAYKF 287


>gi|163867547|ref|YP_001608746.1| hemin binding protein B [Bartonella tribocorum CIP 105476]
 gi|161017193|emb|CAK00751.1| hemin binding protein B [Bartonella tribocorum CIP 105476]
          Length = 544

 Score = 78.5 bits (192), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 38/192 (19%), Positives = 62/192 (32%), Gaps = 47/192 (24%)

Query: 59  GLSALYNGSFGEEAHHNAGGSIFAG------YNVEDSCI-------MYGVEGDVRYT--- 102
           G    Y+    +   H +G            +  + +         +YG+E   R     
Sbjct: 355 GGGYAYSHGTSQSGGHGSGARGHNANPHSRSHGAQSTQAADKNESSVYGIEQMRRMASEL 414

Query: 103 VPVLADNIHS-----LHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQ------------- 144
                D + +         GG+ R+R G+  +D  + Y   G    Q             
Sbjct: 415 GLEQGDEVETLDHTFKQNWGGATRVRIGFA-ADRFMPYLAGGIAYGQFQDTISISVKDEE 473

Query: 145 --KYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSK---------VEGF 193
                +    + T   IG T G GV+   L ++++ R EYR S + K         V   
Sbjct: 474 GTVVSSKNLTDETKTMIGYTLGGGVDFSVL-DNVIVRAEYRYSDFGKKKFSKEKLEVNYK 532

Query: 194 YNTISLGVGMKF 205
            N   +GV  KF
Sbjct: 533 TNDFRVGVAYKF 544



 Score = 40.4 bits (93), Expect = 0.15,   Method: Composition-based stats.
 Identities = 23/140 (16%), Positives = 43/140 (30%), Gaps = 30/140 (21%)

Query: 7   AVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNG 66
            +  S  +L S  +A AAD +               ++  V     + G Y G+ A   G
Sbjct: 6   LITASIFSLISASTALAADVLIPHQPASST------SSTIVAPTFSWTGLYLGVQA---G 56

Query: 67  SFGEEAH--------------------HNAGGSIFAGYNVEDSC-IMYGVEGDVRYTVPV 105
            F  +A                         G  +AG N++     ++G++ D+  +   
Sbjct: 57  GFSSKADLALVGQEKSFPLDKEFSPKLSGFAGGFYAGSNIDLGDSFIFGIDTDLMLSGKK 116

Query: 106 LADNIHSLHGIGGSLRIRGG 125
               I        ++    G
Sbjct: 117 HTKTITIGAADNITVENAVG 136


>gi|148256482|ref|YP_001241067.1| putative outer-membrane immunogenic protein [Bradyrhizobium sp.
           BTAi1]
 gi|146408655|gb|ABQ37161.1| putative outer-membrane immunogenic protein precursor
           [Bradyrhizobium sp. BTAi1]
          Length = 236

 Score = 78.5 bits (192), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 43/239 (17%), Positives = 73/239 (30%), Gaps = 46/239 (19%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+++FL+    ++       A AAD   R +       P  A        +++ G Y G 
Sbjct: 1   MKRVFLSAVALTVL---AAPAFAADMPARTYTKAPVYTPPQAI-------YNWTGFYIGG 50

Query: 61  SALYNGSFGEEAHHNAG---GSIFAGYNVED-SCIMYGVEGDVRY------TVPVLADNI 110
                 +       N G   G +  G++ +     + G+E    +              +
Sbjct: 51  HLGGAFAGNNSLEGNNGRFLGGVQGGFDYQFAPNWVLGIEAQYSWMDRNTTNFGFPGATV 110

Query: 111 HSLHGIG--GSLRIRGGYEVSDSLLLYATVGPDVAQKY--------ETGKAGEITPIAIG 160
            S  G    GS+  R GY      LLYA  G                            G
Sbjct: 111 VSSTGANQLGSVTGRLGYTW-GPALLYAKGGYAWRDGNALGVNVAGVPAGFTTSGNTKDG 169

Query: 161 GTAGVGVEVGGLSESLVARLEYRASKYSKV--------------EGFYNTISLGVGMKF 205
            T G G+E    + +  A+ EY+   +                     +T+ +GV  +F
Sbjct: 170 YTVGGGLEY-MFAPNWSAKAEYQYYNFGNTTFTGGPAPVVGSRFNSDEHTVKVGVNYRF 227


>gi|83308664|emb|CAJ01572.1| outer membrane protein [uncultured bacterium]
          Length = 252

 Score = 78.5 bits (192), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 41/228 (17%), Positives = 62/228 (27%), Gaps = 75/228 (32%)

Query: 51  HDFNGPYAGLSALYNGSFGEEAHHNAG-----------------------GSIFAGYNVE 87
             + G Y G    Y  S G    +                          G    GYN +
Sbjct: 15  FTWTGVYLGGQIGYAWSNGSNNFNGFDPFFNRGRGVFLDSSAGGTPNGVIGGAHVGYNYQ 74

Query: 88  --------DSCIMYGVEGDVRYTV----------PVLADNIHSLHGIGGSLRIRGGYEVS 129
                    S ++ G+EG V  T                +  S   I GS+R R G    
Sbjct: 75  IPSWNWFSSSGVVIGLEGTVDGTSLSNTAIAVFPDGSNVSASSTANIQGSIRGRIGIAW- 133

Query: 130 DSLLLYATVGPDVAQKYETG--------------KAGEITPIAIGGTAGVGVEVGGLSES 175
           D  L+Y T G                         +G I+    G T G G++   ++ +
Sbjct: 134 DRALIYGTGGVAFGGFETNVRFNGTDFATGAPFFASGSISSTRTGWTVGGGIDY-AITNN 192

Query: 176 LVARLEYRASKYSKV------------------EGFYNTISLGVGMKF 205
                EYR + +  +                      N + +G   KF
Sbjct: 193 WSIFGEYRYTNFGSIRENDFGQLPGGFTFEGSRRLQQNQVQVGFSYKF 240


>gi|156739610|gb|ABU93465.1| Omp25 [Brucella neotomae]
          Length = 63

 Score = 78.5 bits (192), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 19/65 (29%), Positives = 33/65 (50%), Gaps = 2/65 (3%)

Query: 112 SLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGG 171
              G  GSLR R GY++ + ++ Y T G   +Q        + +   +G TAG G+E   
Sbjct: 1   VKQGFEGSLRARVGYDL-NLVMPYLTAGIAGSQIKLNNGLDDESKFRVGWTAGAGLEA-K 58

Query: 172 LSESL 176
           L++++
Sbjct: 59  LTDNI 63


>gi|91975275|ref|YP_567934.1| putative outer membrane protein [Rhodopseudomonas palustris BisB5]
 gi|91681731|gb|ABE38033.1| putative outer membrane protein [Rhodopseudomonas palustris BisB5]
          Length = 454

 Score = 78.5 bits (192), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 37/188 (19%), Positives = 60/188 (31%), Gaps = 35/188 (18%)

Query: 47  VPIRHDFNGPYAGLSALYN-----------GSFGEEAH---HNAGGSIFAGYNVEDSCIM 92
            P   ++ G Y G +   +           G F E+ +       G    GYN + +  +
Sbjct: 245 APPPANWAGLYIGGNFGGSATARNRTTATIGGFTEQFNLSPEGFIGGGQIGYNWQAANWV 304

Query: 93  YGVEGDVRYTVPVLAD--------NIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQ 144
           +G E D + +                +      G+ R R GY V  S LLYAT G     
Sbjct: 305 FGAEADFQGSTQKDDRTAVFGSTVAYNQKLPWFGTARARLGYSV-GSTLLYATGGYAYGN 363

Query: 145 KYETGKAGEITPIAI----GGTAGVGVEVGG-----LSESLVARLEYRASKYSKVEGFYN 195
                        +     G   G GVE+       L  +  ++ EY            +
Sbjct: 364 VKTNIVTPLSNETSNRSRSGYAVGGGVEMPFSLFGLLGPNWTSKTEYLYVDLGS---TTD 420

Query: 196 TISLGVGM 203
             + G+G+
Sbjct: 421 VFAGGLGV 428



 Score = 70.5 bits (171), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 43/229 (18%), Positives = 70/229 (30%), Gaps = 49/229 (21%)

Query: 8   VGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGS 67
           + V +  + S  SAQAAD   RA +              V   +D+ G Y G +      
Sbjct: 4   LLVGAALVGSAVSAQAADLAVRAPY----------VKAPVAAIYDWTGFYIGGNVGVGVG 53

Query: 68  FGEEAHHNAGGSI---------------FAGYNVEDSCIM----YGVEGDVRYTVPVLAD 108
              ++H    G +                 GYN + + +      GVE D++ +      
Sbjct: 54  RNLQSHVFPAGGVANSSYLQPQGVIGGGQIGYNWQTNSVFGPLLIGVEADIQGSGMSDGR 113

Query: 109 -------------NIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAG--- 152
                        N +       ++R R G      ++ Y T G        T       
Sbjct: 114 TTLNTLNGVLGTVNYNQKLDWFTTVRGRIGIA-RGPVVSYFTGGFAAGDVKTTVTEVGLV 172

Query: 153 --EITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFYNTISL 199
              ++    G   G GVE   L  +   ++EY           + T SL
Sbjct: 173 PFNLSGTRTGWVIGSGVEA-ALGGNWTGKIEYLYLDLGNRTDVFGTQSL 220


>gi|254717240|ref|ZP_05179051.1| 22 kDa outer membrane protein precursor [Brucella ceti M13/05/1]
 gi|261219057|ref|ZP_05933338.1| conserved hypothetical protein [Brucella ceti M13/05/1]
 gi|260924146|gb|EEX90714.1| conserved hypothetical protein [Brucella ceti M13/05/1]
          Length = 221

 Score = 78.5 bits (192), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 43/186 (23%), Positives = 66/186 (35%), Gaps = 15/186 (8%)

Query: 17  SFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSFGEE---AH 73
              SA AAD +    +     V            HD++G Y G     + S       + 
Sbjct: 28  FAGSAFAADMMGGTDYTYNDPVAAGP--------HDWSGNYVGARVGGSSSKFPSPFASR 79

Query: 74  HNAGGSIFAGYNVEDSCIMYGV--EGDVRYTVPVLADNIHSLHGIGGSLRIRGGYEVSDS 131
             A G I  G N+++  I++G   EG+       +           G+ + + GY   D 
Sbjct: 80  TGALGGIVVGKNMQNGNIVFGAELEGNFAEAEHRIGHGGTLQQSWNGNAKGKVGYAF-DK 138

Query: 132 LLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVE 191
            L+Y T G  V +               G   G GVE   LS  L  + EY   +++ V+
Sbjct: 139 TLVYGTAGYGVTRFKAKDNTTSAPGWEGGVLIGAGVE-QALSGPLSVKAEYDFQRFNDVK 197

Query: 192 GFYNTI 197
              N I
Sbjct: 198 SQVNGI 203


>gi|316934026|ref|YP_004109008.1| putative outer-membrane protein precursor [Rhodopseudomonas
           palustris DX-1]
 gi|315601740|gb|ADU44275.1| putative outer-membrane protein precursor [Rhodopseudomonas
           palustris DX-1]
          Length = 246

 Score = 78.2 bits (191), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 36/179 (20%), Positives = 60/179 (33%), Gaps = 35/179 (19%)

Query: 39  PTIATNRYVPIRHDFNGPYAGLSALYNGS----------------FGEEAHHNAGGSIFA 82
           P       +P  +D++G Y G +  +  S                FGE  H  +GG++  
Sbjct: 28  PYTKAPPIIPAMYDWSGFYIGANGGWGSSRNCWDYLGTTAAPFAAFGEGCHDASGGTVGG 87

Query: 83  --GYNVEDSCIMYGVEGDVRYTVPVLADN--------IHSLHGIGGSLRIRGGYEVSDSL 132
             GYN +    ++GVE    +     ++           S     G    R GY   ++ 
Sbjct: 88  QIGYNWQVGTWVFGVEAQGNWADFKGSNASLRFTDTTNESKVDAFGLFTARVGYAW-NNA 146

Query: 133 LLYATVGPDVA-------QKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRA 184
           LLY   G  V        +        + +    G   G G+E  G + +    +EY  
Sbjct: 147 LLYVKGGAAVTSDKYTTYRTLAGTIIDDASETRWGAAVGGGLEY-GFTPNWSFAVEYDH 204


>gi|296445958|ref|ZP_06887908.1| OmpA domain protein transmembrane region-containing protein
           [Methylosinus trichosporium OB3b]
 gi|296256476|gb|EFH03553.1| OmpA domain protein transmembrane region-containing protein
           [Methylosinus trichosporium OB3b]
          Length = 275

 Score = 78.2 bits (191), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 39/201 (19%), Positives = 60/201 (29%), Gaps = 51/201 (25%)

Query: 53  FNGPYAGLSALYNGSFG----------------------EEAHHNAGGSIFAGYNVEDSC 90
           ++G Y GL+A Y                             ++    G    GYN +   
Sbjct: 41  WSGFYVGLNAGYTWDERGNVLVNSPANIWAVGASGSGALATSNDGFIGGGQIGYNYQFGQ 100

Query: 91  -IMYGVEGDVRYTVPVLADNIHSL--------------HGIGGSLRIRGGYEVSDSLLLY 135
             + GVE D++      +                        G++R R GY +S +LLLY
Sbjct: 101 TFVVGVEADIQGVGGSNSSATVGNFVTPVSSAITASKQLDYLGTVRGRAGYLISPTLLLY 160

Query: 136 ATVGPDVAQKYETGKAGE-------------ITPIAIGGTAGVGVEVGGLSESLVARLEY 182
            T G    Q        +              +   +G TAG GVE   +     A+ EY
Sbjct: 161 GTGGVAYGQANLNATVTQTGLNGATGSATVGFSDTRVGWTAGGGVEWLFM-PQWSAKAEY 219

Query: 183 RASKYSKVEGFYNTISLGVGM 203
                 +          GV +
Sbjct: 220 LYYDLGRASASNTLAFQGVNV 240


>gi|146340932|ref|YP_001205980.1| putative outer-membrane protein [Bradyrhizobium sp. ORS278]
 gi|146193738|emb|CAL77755.1| putative outer-membrane protein; putative secreted protein
           [Bradyrhizobium sp. ORS278]
          Length = 250

 Score = 78.2 bits (191), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 33/176 (18%), Positives = 61/176 (34%), Gaps = 34/176 (19%)

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPV---------LADNIH 111
           +  + G+   + +    G +  GYN +   I++G+EGD  +               D   
Sbjct: 70  AVGFAGTQRYDINGGFAGGVI-GYNWQVDNIVFGLEGDYHWADISGRSTEINLGAGDTYF 128

Query: 112 SLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAG--------EITPIAIGGTA 163
           +     G ++ R G+  +   L + + G  V        AG          +    G T 
Sbjct: 129 TKLRGFGDIKGRLGWA-AGPALFFVSGGAAVGDLQHRYDAGLFGPAFSASQSDWRWGWTI 187

Query: 164 GVGVEVGGLSESLVARLEYRASKYSKVEGFY--------------NTISLGVGMKF 205
           G G E    +++  A++EY    + K    Y              +T+ +GV   F
Sbjct: 188 GAGAEY-MFAQNWSAKVEYNYLDFGKSTLQYTPVAANRSEWNDTVHTVKVGVSYHF 242


>gi|163867546|ref|YP_001608745.1| hemin binding protein A [Bartonella tribocorum CIP 105476]
 gi|161017192|emb|CAK00750.1| hemin binding protein A [Bartonella tribocorum CIP 105476]
          Length = 290

 Score = 78.2 bits (191), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 28/120 (23%), Positives = 51/120 (42%), Gaps = 22/120 (18%)

Query: 107 ADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPD------------VAQKYETGKAGEI 154
           ++ +       G+ R+R G+  +D ++ Y   G              VA K  +  + + 
Sbjct: 172 SEGVGFKQKWAGATRVRVGFAAADRIMPYVAGGVAYTQLEAAHGQVKVADKTFSAGSSDE 231

Query: 155 TPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFY---------NTISLGVGMKF 205
           T   +G T G G++   ++++++ R EYR S Y K + F          N   +GV  KF
Sbjct: 232 TATMVGFTIGGGIDF-AMTDNVLLRAEYRYSDYGKKKFFAKEKEYNFKTNDFRVGVAYKF 290



 Score = 36.2 bits (82), Expect = 2.6,   Method: Composition-based stats.
 Identities = 15/85 (17%), Positives = 24/85 (28%), Gaps = 16/85 (18%)

Query: 37  VVPTIATNRYVPIRHDFNGPYAGLSALYNGSFGEEAH---------------HNAGGSIF 81
           ++P             + G Y G       S  +                      G  +
Sbjct: 26  IIPHEVAPVITAPSFSWTGFYIGGQIGGFSSKIDLKDKDKDTSVFKDLSPKLSGLIGGFY 85

Query: 82  AGYNVEDSC-IMYGVEGDVRYTVPV 105
           AG N +    I+ GVE DV ++   
Sbjct: 86  AGSNFDLGNGIILGVETDVIWSGKK 110


>gi|316932401|ref|YP_004107383.1| putative outer-membrane immunogenic protein [Rhodopseudomonas
           palustris DX-1]
 gi|315600115|gb|ADU42650.1| putative outer-membrane immunogenic protein precursor; putative
           secreted protein [Rhodopseudomonas palustris DX-1]
          Length = 235

 Score = 78.2 bits (191), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 38/202 (18%), Positives = 65/202 (32%), Gaps = 39/202 (19%)

Query: 39  PTIATNRYVP-IRHDFNGPYAGLSALYNGSFGEEAHHNAG----------GSIFAGYNVE 87
           P      Y P   +++ G Y G      G+F  +     G          G + AGY+ +
Sbjct: 28  PYTKAPAYAPAPIYNWTGFYIGGHIG--GAFSGDNSIGTGVTASDNGKFLGGVQAGYDWQ 85

Query: 88  D-SCIMYGVEGDVRYTVPVLA-----DNIHSLHGIG------GSLRIRGGYEVSDSLLLY 135
                + GVEG   +           D + + +          S+  R GY      LLY
Sbjct: 86  FAPNWVLGVEGQYSWLSGTNQSVAFVDGLGNSYLFSDNQRGLASVTGRLGYTW-GPALLY 144

Query: 136 ATVGPDVAQ----KYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKV- 190
              G   A         G    +     G T G G+E    + +   ++EY+   +  V 
Sbjct: 145 VKGGWAYADYSTSLTVNGFGVAVDSKTDGYTVGGGLEYL-FAPNWSGKIEYQYYDFGNVN 203

Query: 191 -------EGFYNTISLGVGMKF 205
                  +   + +  G+  +F
Sbjct: 204 LGNGFSAKNDEHVVKAGLNYRF 225


>gi|148255736|ref|YP_001240321.1| putative outer-membrane protein [Bradyrhizobium sp. BTAi1]
 gi|146407909|gb|ABQ36415.1| putative outer-membrane protein [Bradyrhizobium sp. BTAi1]
          Length = 248

 Score = 78.2 bits (191), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 28/146 (19%), Positives = 52/146 (35%), Gaps = 16/146 (10%)

Query: 63  LYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNI---------HSL 113
            + G+   + +    G +  GYN +   I++G+EGD  +        +          + 
Sbjct: 72  GFAGTQRYDINGGFAGGVI-GYNWQVDNIVFGLEGDYHWADINGRSGVITAGLGDSYFTK 130

Query: 114 HGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAI----GGTAGVGVEV 169
               G ++ R G+  +   L + + G  V            + I      G T G G E 
Sbjct: 131 LRGFGDIKGRLGWA-AGPALFFVSGGAAVGDLQHRYDNPAFSTIQNDWRWGWTIGAGAEY 189

Query: 170 GGLSESLVARLEYRASKYSKVEGFYN 195
              + +  A++EY    + K    YN
Sbjct: 190 -MFAPNWSAKVEYNYLDFGKSTLQYN 214


>gi|126729809|ref|ZP_01745622.1| outer membrane protein, putative [Sagittula stellata E-37]
 gi|126709928|gb|EBA08981.1| outer membrane protein, putative [Sagittula stellata E-37]
          Length = 220

 Score = 78.2 bits (191), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 40/212 (18%), Positives = 70/212 (33%), Gaps = 24/212 (11%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K  L + V+  AL +  SA + D              T           ++ G Y GL
Sbjct: 26  MKKHILTMTVAIAALGTAASAGSLDVTPVEPAPM-----TPVEVVPAAPVGNWTGGYTGL 80

Query: 61  S-ALYNGSFGEEAHHNAGGSIFAGYNVEDSC-IMYGVEGDVRYTVPVLADNIHSLHGIGG 118
           S      S G          +  GY+ +    I+ G E + +    +  +          
Sbjct: 81  SLGGAQASSGGSEESGMIYGLHGGYDYQFGNGIVLGGEAEFQGNNDLSVNGFDV--DNVS 138

Query: 119 SLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVA 178
             + R GY++    L+Y T G            GE T        G+G+E   +++    
Sbjct: 139 RAKARMGYDL-GQALVYGTAGVS----KVNTSIGEATSPVY----GLGMEY-KVTDKFSV 188

Query: 179 RLEYRASKYS-----KVEGFYNTISLGVGMKF 205
             EY    +        +   +++SL    +F
Sbjct: 189 GAEYLNEDFQDLGSTNTDLQQDSLSLRGNFRF 220


>gi|312113917|ref|YP_004011513.1| hypothetical protein Rvan_1143 [Rhodomicrobium vannielii ATCC
           17100]
 gi|311219046|gb|ADP70414.1| hypothetical protein Rvan_1143 [Rhodomicrobium vannielii ATCC
           17100]
          Length = 292

 Score = 77.8 bits (190), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 43/251 (17%), Positives = 66/251 (26%), Gaps = 80/251 (31%)

Query: 15  LASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNG-------- 66
           + +  SA AAD   R      G                + G Y G               
Sbjct: 1   MVAGNSALAADLYGRGGGLKDGPFYEAPAL--------WQGFYLGGHVGAAWSKADVDDT 52

Query: 67  --------SFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNI-------- 110
                     G+    +  G    GYN +    ++GVEGD+ Y     + ++        
Sbjct: 53  FIYVGDPTYKGDLNTTSLTGGGQLGYNFQRGNFVFGVEGDIGYLKVDASKDVAFRPTSCV 112

Query: 111 -----------------------HSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKY- 146
                                   +   + G +  R GY   D  L YA  G        
Sbjct: 113 GTYTSAPYTVNYDPKMCAVDTKYSASGDLYGDITGRLGYAF-DRTLFYAKGGVAFLNGEF 171

Query: 147 ----------------------ETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRA 184
                                  +      +   +G T GVGVE   L+ S   + EY+ 
Sbjct: 172 DAKYLGQNCASLGSDSHCLGNALSKFDYSHSETLVGWTIGVGVEY-KLTPSWSLKAEYQH 230

Query: 185 SKYSKVEGFYN 195
             +  +   YN
Sbjct: 231 FNFGSISYSYN 241


>gi|91975321|ref|YP_567980.1| putative outer membrane protein [Rhodopseudomonas palustris BisB5]
 gi|91681777|gb|ABE38079.1| putative outer membrane protein [Rhodopseudomonas palustris BisB5]
          Length = 242

 Score = 77.8 bits (190), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 39/211 (18%), Positives = 70/211 (33%), Gaps = 50/211 (23%)

Query: 39  PTIATNRYVPIR--HDFNGPYAGLSALYNGSFGEEAHHNAG----------GSIFAGYNV 86
           P      Y P    +++ G Y G      G+F  +     G          G + AGY+ 
Sbjct: 28  PYNKAPVYAPPVPIYNWTGFYIGGHIG--GAFAGDNSIGTGVTANSDGKFLGGVQAGYDW 85

Query: 87  ED-SCIMYGVEGDVRYTVPVLADNIHSLHGIG--------------GSLRIRGGYEVSDS 131
           +     + GVEG  +Y+    +++  +   +G               S+  R GY     
Sbjct: 86  QFAPSWVLGVEG--QYSWLSGSNDAVAFTVVGQPGTYTFSDNQRGLASVTGRLGYTW-GP 142

Query: 132 LLLYATVGPDVAQKYET---------GKAGEITPIAIGGTAGVGVEVGGLSESLVARLEY 182
            LLY   G   A    +               T    G T G G+E    +++   ++EY
Sbjct: 143 ALLYVKGGWAYADYKSSLTFTAPGGAAVGVSSTSSQDGYTVGAGLEYL-FAQNWSGKIEY 201

Query: 183 RASKYSKVE--------GFYNTISLGVGMKF 205
           +   +  V+           + +  G+  +F
Sbjct: 202 QYYDFGNVDLGAGFTAKNDQHVVKAGLNYRF 232


>gi|156739632|gb|ABU93476.1| Omp25 [Brucella neotomae]
          Length = 63

 Score = 77.8 bits (190), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 20/65 (30%), Positives = 34/65 (52%), Gaps = 2/65 (3%)

Query: 112 SLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGG 171
              GI GSLR R GY++ + ++ Y T G   +Q        + +   +G TAG G+E   
Sbjct: 1   VKQGIEGSLRARVGYDL-NLVMPYLTAGIAGSQIKLNNGLDDESKFRVGWTAGAGLEA-K 58

Query: 172 LSESL 176
           L++++
Sbjct: 59  LTDNI 63


>gi|86749831|ref|YP_486327.1| outer membrane protein [Rhodopseudomonas palustris HaA2]
 gi|86572859|gb|ABD07416.1| outer membrane protein [Rhodopseudomonas palustris HaA2]
          Length = 243

 Score = 77.8 bits (190), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 36/186 (19%), Positives = 59/186 (31%), Gaps = 32/186 (17%)

Query: 38  VPTIATNRYVPIRHDFNGPYAGLSALYNGSF---------------GEEAHHNAGGSIFA 82
             T A    +   +D++G Y G +  +  S                G      A      
Sbjct: 28  PYTKAPPPMIVAIYDWSGFYIGANGGWGTSRKSWDFYAPGALLLSEGSHDASGATAGGQV 87

Query: 83  GYNVEDSCIMYGVEGDVRYTVPVLAD--------NIHSLHGIGGSLRIRGGYEVSDSLLL 134
           GYN +    ++GVE    +     ++        + HS     G    R GY   ++ LL
Sbjct: 88  GYNWQMGSWVFGVEAQGNWADFKGSNVTLLGGLFDNHSKVEAFGLFTGRVGYAW-NNALL 146

Query: 135 YATVGPDVAQKY-------ETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKY 187
           YA  G  V           +    G  +    G + G G+E  G + +    +EY     
Sbjct: 147 YAKGGAAVVNDKYEFVRRADGLVTGTASETRWGASVGAGLEY-GFTPNWSFAVEYNHLFL 205

Query: 188 SKVEGF 193
            K +  
Sbjct: 206 DKKDVT 211


>gi|319408046|emb|CBI81700.1| Outer membrane protein, omp25/ropB family [Bartonella
           schoenbuchensis R1]
          Length = 273

 Score = 77.8 bits (190), Expect = 9e-13,   Method: Composition-based stats.
 Identities = 39/272 (14%), Positives = 78/272 (28%), Gaps = 89/272 (32%)

Query: 3   KLFLAVGVSSLALASFCSAQAA--DPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
            +   + + +L L S    +A+    ++                 +VP    + G Y G 
Sbjct: 1   MIRCLIIICALTLFSTSVVRASGYMVIQE------------PMPVFVPSTFSWEGLYLGG 48

Query: 61  SAL------------YNGSFGEEAHH-----------NAGGSIFAGYNVE--DSCIMYGV 95
                           +G                      G  +AG N+   D+ ++  V
Sbjct: 49  QVGGALGKLSVSSRVISGKNTVTKKSQIVSSDKYNLAGFIGGFYAGSNLRLDDNGLILSV 108

Query: 96  EGDVRYT--------------------------------------VPVLADNIHSLHGIG 117
           + D+ ++                                         +  N        
Sbjct: 109 DTDIVWSNQKNVQFGKRMIVGDQSARVHNALVSRFGHKKSGLVKVGDEVTYNTTRKEKWA 168

Query: 118 GSLRIRGGYEVSDSLLLYATVGPDVAQKYETG----------KAGEITPIAIGGTAGVGV 167
           G+ R+R G+  +D ++ Y   G    +   T                    IG T G GV
Sbjct: 169 GATRVRFGFA-ADRIMPYIAGGIAYTKVQITPWFLVNSANPLNLMTEKKAMIGYTLGAGV 227

Query: 168 EVGGLSESLVARLEYRASKYSKVEGFYNTISL 199
               +S++++ R EYR S + K +   + +++
Sbjct: 228 NF-AVSDNVILRGEYRYSDFGKKKFMESPVNV 258


>gi|39935882|ref|NP_948158.1| outer membrane protein [Rhodopseudomonas palustris CGA009]
 gi|39649736|emb|CAE28257.1| possible outer membrane protein [Rhodopseudomonas palustris CGA009]
          Length = 288

 Score = 77.8 bits (190), Expect = 9e-13,   Method: Composition-based stats.
 Identities = 35/194 (18%), Positives = 62/194 (31%), Gaps = 37/194 (19%)

Query: 39  PTIATNRYVPIRHDFNGPYAGLSALYNGSF----------------GEEAHHNAGG--SI 80
           P       +   +D++G Y G +  +  S                 GE  H  +GG    
Sbjct: 64  PYTKAPPIIAAAYDWSGFYVGANGGWGTSRNCWDYLGTTATPAVALGEGCHDASGGTAGG 123

Query: 81  FAGYNVEDSCIMYGVEGDVRYTVPVLADN----------IHSLHGIGGSLRIRGGYEVSD 130
             GYN + S  ++GVE    +     ++             +     G    R GY   +
Sbjct: 124 QVGYNWQISTWVFGVEAQGNWADFKGSNANLLVIPAPTTNQTKIDAFGLFTARVGYAW-N 182

Query: 131 SLLLYATVGPDVA-------QKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYR 183
           + L+Y   G  V        +        + +    G T G G+E  G + S    +EY 
Sbjct: 183 NALIYVKGGAAVTSDKYTRFRTATGVFNDDASETRWGATVGTGLEY-GFTPSWSFAVEYD 241

Query: 184 ASKYSKVEGFYNTI 197
                  +  ++ +
Sbjct: 242 HLFLGGRDLTFSPV 255


>gi|154246408|ref|YP_001417366.1| porin [Xanthobacter autotrophicus Py2]
 gi|154160493|gb|ABS67709.1| porin [Xanthobacter autotrophicus Py2]
          Length = 250

 Score = 77.8 bits (190), Expect = 9e-13,   Method: Composition-based stats.
 Identities = 33/189 (17%), Positives = 59/189 (31%), Gaps = 45/189 (23%)

Query: 51  HDFNGPYAGLSALYNG--------------------SFGEEAHHNAGGSIFAGYNVED-S 89
             + G Y G +  Y G                    +               GYN +  +
Sbjct: 38  FSWTGFYIGANVGYGGDKFTFDEVESYYYGAYPYYANSTSLNSSGFFAGGQIGYNYQFAN 97

Query: 90  CIMYGVEGDVRYTVPVLADNIHS---------------LHGIGGSLRIRGGYEVSDSLLL 134
            ++ GVE D++++     ++  S                    G++R R GY   D  L 
Sbjct: 98  NVVLGVETDLQWSGIEGKEDYSSVYIYGGYPYTSSYGASVDYFGTIRARIGYAF-DRFLP 156

Query: 135 YATVGPDVAQKYETG-------KAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKY 187
           Y T G    +   +G        + + +    G T G GVE   ++ +   + EY     
Sbjct: 157 YITGGAAYGKTKVSGSYAGEGFGSFDSSSTNWGWTVGGGVEY-AITNNWTFKTEYLYVDL 215

Query: 188 SKVEGFYNT 196
              +  Y +
Sbjct: 216 GSTDYTYGS 224


>gi|254706545|ref|ZP_05168373.1| 22 kDa outer membrane protein precursor [Brucella pinnipedialis
           M163/99/10]
 gi|256031839|ref|ZP_05445453.1| 22 kDa outer membrane protein precursor [Brucella pinnipedialis
           M292/94/1]
 gi|256160030|ref|ZP_05457728.1| 22 kDa outer membrane protein precursor [Brucella ceti M490/95/1]
 gi|261314005|ref|ZP_05953202.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10]
 gi|265988937|ref|ZP_06101494.1| outer membrane protein 22 [Brucella pinnipedialis M292/94/1]
 gi|265998403|ref|ZP_06110960.1| Omp22 [Brucella ceti M490/95/1]
 gi|261303031|gb|EEY06528.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10]
 gi|262553010|gb|EEZ08861.1| Omp22 [Brucella ceti M490/95/1]
 gi|264661134|gb|EEZ31395.1| outer membrane protein 22 [Brucella pinnipedialis M292/94/1]
          Length = 211

 Score = 77.8 bits (190), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 43/186 (23%), Positives = 66/186 (35%), Gaps = 15/186 (8%)

Query: 17  SFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSFGEE---AH 73
              SA AAD +    +     V            HD++G Y G     + S       + 
Sbjct: 18  FAGSAFAADMMGGTDYTYNDPVAAGP--------HDWSGNYVGARVGGSSSKFPSPFASR 69

Query: 74  HNAGGSIFAGYNVEDSCIMYGV--EGDVRYTVPVLADNIHSLHGIGGSLRIRGGYEVSDS 131
             A G I  G N+++  I++G   EG+       +           G+ + + GY   D 
Sbjct: 70  TGALGGIVVGKNMQNGNIVFGAELEGNFAEAEHRIGHGGTLQQSWNGNAKGKVGYAF-DK 128

Query: 132 LLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVE 191
            L+Y T G  V +               G   G GVE   LS  L  + EY   +++ V+
Sbjct: 129 TLVYGTAGYGVTRFKAKDNTTSAPGWEGGVLIGAGVE-QALSGPLSVKAEYDFQRFNDVK 187

Query: 192 GFYNTI 197
              N I
Sbjct: 188 SQVNGI 193


>gi|163868669|ref|YP_001609878.1| hemin binding protein E [Bartonella tribocorum CIP 105476]
 gi|161018325|emb|CAK01883.1| hemin binding protein E [Bartonella tribocorum CIP 105476]
          Length = 309

 Score = 77.4 bits (189), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 26/112 (23%), Positives = 43/112 (38%), Gaps = 21/112 (18%)

Query: 113 LHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYET-----------GKAGEITPIAIGG 161
                G+ R+R G   +  ++ Y   G    Q  +             K  ++T   +G 
Sbjct: 200 KQKWTGATRVRLGLS-AHRVMPYIAGGIAYGQFQDVLSTVITGDESFNKTSDVTKTMVGY 258

Query: 162 TAGVGVEVGGLSESLVARLEYRASKYSKVEGFY--------NTISLGVGMKF 205
           T G GV+   ++++LV R EYR S + K +           N    G+  KF
Sbjct: 259 TLGGGVDF-AMTDNLVVRAEYRYSDFGKKKFKDEIEIKYKTNDFRAGIAYKF 309



 Score = 36.9 bits (84), Expect = 1.9,   Method: Composition-based stats.
 Identities = 20/148 (13%), Positives = 36/148 (24%), Gaps = 36/148 (24%)

Query: 8   VGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLS-ALYNG 66
           +  S  +L S    QAAD V             + +         ++G Y G     ++ 
Sbjct: 6   ITASVFSLISPSILQAADVVAPEEPVH------VVSEVVTSSDFSWSGFYFGGQIGGFSS 59

Query: 67  SFGEEAHH----------------------------NAGGSIFAGYNVEDS-CIMYGVEG 97
                                                  G ++AG N +    ++ G++ 
Sbjct: 60  KISGTTRDVDTPLYPDEESKNKPWVPLEKQYKPELSGFVGGLYAGVNFDLGNNLIVGLDT 119

Query: 98  DVRYTVPVLADNIHSLHGIGGSLRIRGG 125
           D+  T                S     G
Sbjct: 120 DILLTEKKDTKTFIHTEESSASGSGTEG 147


>gi|27380404|ref|NP_771933.1| outer-membrane immunogenic protein [Bradyrhizobium japonicum USDA
           110]
 gi|27353568|dbj|BAC50558.1| bll5293 [Bradyrhizobium japonicum USDA 110]
          Length = 277

 Score = 77.0 bits (188), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 43/247 (17%), Positives = 73/247 (29%), Gaps = 69/247 (27%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K  LAV   +  +    S QAAD                     +   +++ G Y G 
Sbjct: 1   MKKFLLAV---ASVVLGTASVQAADLAAHYTKAPM-----------MAPAYNWTGFYVGG 46

Query: 61  SALYNGSFGEEA----------------------------HHNAGGSIFAGYNVEDSCIM 92
           +        + +                              +  G   AGYN + +  +
Sbjct: 47  NVGGQWGSSDPSTSTVFSPTGYFAASSVPAINTVGAQGINSSSVTGGFTAGYNWQVNHAV 106

Query: 93  YGVEGDVRYTVPVLAD----------------NIHSLHGIGGSLRIRGGYEVSDSLLLYA 136
            G+EGD+ Y     +                 +         ++R R G+  + + LLYA
Sbjct: 107 LGLEGDINYFGFKGSATGSALYPCCAPTGFTVSSSVSADWLATIRGRIGFLAAPTWLLYA 166

Query: 137 TVGPDVAQKYET----------GKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASK 186
           T G  +A+               ++  I    +G TAGVG E          + EY    
Sbjct: 167 TGGAAIAEVKGNFNFTDTFAGATESSAIRDTRLGWTAGVGTEY-AFGGGWSLKAEYLYVD 225

Query: 187 YSKVEGF 193
             +    
Sbjct: 226 LGRASAT 232


>gi|86751658|ref|YP_488154.1| outer membrane protein [Rhodopseudomonas palustris HaA2]
 gi|86574686|gb|ABD09243.1| outer membrane protein [Rhodopseudomonas palustris HaA2]
          Length = 238

 Score = 76.6 bits (187), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 35/201 (17%), Positives = 62/201 (30%), Gaps = 40/201 (19%)

Query: 41  IATNRYVPIRHDFNGPYAGLSALYNGSFGEEAHHNAG----------GSIFAGYNVED-S 89
                     +++ G Y G      G+F  +     G          G +  GY+ +   
Sbjct: 32  APVYAPPAPIYNWTGFYIGGHIG--GAFAGDNSIGTGVTAGSDGKFLGGVQVGYDWQFAP 89

Query: 90  CIMYGVEGDVRYTVPVLADNIHSLHGIGG------------SLRIRGGYEVSDSLLLYAT 137
             + GVEG   +          ++ G+ G            S+  R GY      LLY  
Sbjct: 90  SWVLGVEGQYSWLSGTNDAVSFTVPGVAGTYTYADNQRGLASVTGRLGYTW-GPALLYVK 148

Query: 138 VGPDVAQ-----KYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVE- 191
            G   A                T    G T G G+E    +++   ++EY+   +  V+ 
Sbjct: 149 GGWAYADYTSSLTLSGVGTVSSTSSQDGYTVGGGLEYL-FAQNWSGKIEYQYYDFGNVDL 207

Query: 192 -------GFYNTISLGVGMKF 205
                     + +  G+  +F
Sbjct: 208 GAGFTAKNDQHVVKAGLNYRF 228


>gi|27377055|ref|NP_768584.1| hypothetical protein bll1944 [Bradyrhizobium japonicum USDA 110]
 gi|27350198|dbj|BAC47209.1| bll1944 [Bradyrhizobium japonicum USDA 110]
          Length = 825

 Score = 76.6 bits (187), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 46/231 (19%), Positives = 68/231 (29%), Gaps = 61/231 (26%)

Query: 25  DPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSFGEEAH----------H 74
           D  +   +G     P +          ++ G Y G +          A            
Sbjct: 598 DTAQAKANGIDKEPPPVMPT-------NWAGVYLGGTIGAGKGRSHYADPFPTPVSGDYA 650

Query: 75  NAGGSIFAG---YNVEDSCIMYGVEGDVRYTVPVLADNIHSLH-------GIG------- 117
           + GG++F G    N +    + G+E    Y   V   N            G         
Sbjct: 651 DLGGAMFGGQIGINYQTGSWVLGLEAS-GYWANVQGTNTCFGAFPSPQIAGFNCGSQIDA 709

Query: 118 -GSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAI-------GGTAGVGVEV 169
            G+L  R GY   D  LLY   G    ++      G I+   +       G T G G+E 
Sbjct: 710 LGALTGRVGYAF-DRTLLYVKGGSAWDRQTNQFNTGGISGTILTNGNTNWGWTVGGGLEY 768

Query: 170 GGLSESLVARLEYRASKYSKV----------------EGFYNTISLGVGMK 204
             L  +    LEY+   + K                      T+SLGV  K
Sbjct: 769 -ALLPNWSMALEYKYYDFGKSPVFTTAGLGSVPLSPNSTTVQTVSLGVNYK 818



 Score = 60.0 bits (144), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 40/221 (18%), Positives = 60/221 (27%), Gaps = 53/221 (23%)

Query: 15  LASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIR-HDFNGPYAGLSAL---------- 63
              +  A AAD            V T       P    ++ G Y G              
Sbjct: 71  AGLYGPAHAADLP----------VKTAPPITAAPSTLWNWTGIYVGAHLGGAFGSSDWQT 120

Query: 64  ---------YNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVE-----GDVRY--TVPVLA 107
                      G  G        G    G N +    + G+E      DV         A
Sbjct: 121 ATGLQADFSNRGFPGSGNAEGLLGGGQIGVNYQFGTWVTGLEIAASAADVDGFAKCANRA 180

Query: 108 DNIHSLHGIG--------GSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAG------E 153
           DN + +            G++  R G    + LL+Y   G   A      +         
Sbjct: 181 DNRYGVISFTCDNRVTSLGTIAGRLGQTWGN-LLIYGKAGAAWATDESDARTSHYINKFN 239

Query: 154 ITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFY 194
            +    G   G+G+E    S +L A +EY    +   +  Y
Sbjct: 240 QSGTRWGWMGGLGLEY-AFSPNLSAFVEYDHFDFGSKDSNY 279


>gi|146339995|ref|YP_001205043.1| putative outer-membrane immunogenic protein [Bradyrhizobium sp.
           ORS278]
 gi|146192801|emb|CAL76806.1| conserved hypothetical protein; putative outer-membrane immunogenic
           protein precursor; putative secreted protein
           [Bradyrhizobium sp. ORS278]
          Length = 237

 Score = 76.6 bits (187), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 44/238 (18%), Positives = 74/238 (31%), Gaps = 47/238 (19%)

Query: 2   QKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLS 61
           +    AV +++LA+     A AAD   R +     + P  A        +D+ G Y G  
Sbjct: 3   RVFLSAVALTALAV----PAFAADMPARTYTKAPPMTPPQAI-------YDWTGFYIGGH 51

Query: 62  ALYNGSFGEEAHHNAG---GSIFAGYNVED-SCIMYGVEGDVRY------TVPVLADNIH 111
                + G     N     G +  G++ +     + G+E    +              + 
Sbjct: 52  LGGAFAGGNGLEGNNARFLGGVQGGFDYQFAPNWVLGIEAQYSWMDRNTTNFGFPGATVV 111

Query: 112 SLHGIG--GSLRIRGGYEVSDSLLLYATVGPDVAQKY--------ETGKAGEITPIAIGG 161
           +  G    GS+  R GY      LLYA  G                            G 
Sbjct: 112 TSTGANQLGSVTGRLGYTW-GPALLYAKGGYAWRDGNGLGVNVAGVPAGFTTSGNAKDGY 170

Query: 162 TAGVGVEVGGLSESLVARLEYRASKYSKVEGF--------------YNTISLGVGMKF 205
           T G G+E    + +  A+ EY+   +                     +T+ +GV  +F
Sbjct: 171 TVGAGLEY-MFAPNWSAKAEYQYYNFGNTTFTGGPAPVVGSRFNNEDHTVKVGVNYRF 227


>gi|312114546|ref|YP_004012142.1| outer membrane protein [Rhodomicrobium vannielii ATCC 17100]
 gi|311219675|gb|ADP71043.1| outer membrane protein [Rhodomicrobium vannielii ATCC 17100]
          Length = 250

 Score = 76.2 bits (186), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 51/224 (22%), Positives = 80/224 (35%), Gaps = 41/224 (18%)

Query: 3   KLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSA 62
            + L +  +  A+A   SA AAD  R    GG    P +AT         + G YAG++ 
Sbjct: 1   MIRLGIIGTVSAIALTVSANAADLYRAPAGGGLKDAPYVAT---------WTGFYAGVNG 51

Query: 63  LYNGSFGEE--------------AHHNAGGSIFAGYNVE---DSCIMYGVEGDVRYTVPV 105
            Y  S   +              +     G    GYN++      ++ G+E D++ +   
Sbjct: 52  GYAWSQSSDQLAYVDPNYPFYGLSPEGGFGGGQIGYNLQGFVHPNLVLGIEADIQGSDIS 111

Query: 106 LAD------NIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAG------- 152
            +          S     G++R R GY + DS L+YAT G           A        
Sbjct: 112 DSGVDSATYKYSSKVDWFGTVRGRLGYAI-DSALVYATGGFAYGGIKNDYDARHLGAGEF 170

Query: 153 EITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFYNT 196
           +    A G   G GVE   L+ +   + EY+     K      +
Sbjct: 171 KFDGNATGYVVGGGVEY-KLAPAWSLKAEYQYINLGKNNPVDTS 213


>gi|316933367|ref|YP_004108349.1| OmpA-like transmembrane region [Rhodopseudomonas palustris DX-1]
 gi|315601081|gb|ADU43616.1| OmpA-like transmembrane region [Rhodopseudomonas palustris DX-1]
          Length = 240

 Score = 76.2 bits (186), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 41/238 (17%), Positives = 72/238 (30%), Gaps = 41/238 (17%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M  +   +  ++  +A    A AAD             P     +   + +++ G Y G 
Sbjct: 1   MTTMKNTLLGAAAVIALSAPAFAADLP---PRPYTKAAPAYTAPQ---VVYNWTGFYVGG 54

Query: 61  SALYNGSFGEEAHHNAG---GSIFAGYNVEDS-CIMYGVEGDVRYTVPVLADNIHSLHGI 116
                 +       N+G   G +  G + + +   + G+E    +        I      
Sbjct: 55  HVGGAWAGDNSIPGNSGRFFGGVQGGADYQFATNWVIGIEAQYSWMSSNNTGVIFPGGST 114

Query: 117 G-------GSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAI--------GG 161
                   GS+  R GY      L+YA  G                P A         G 
Sbjct: 115 AVEDTRGLGSVTGRLGYAW-GPTLVYAKGGYAWRDSDLGVATAAGFPAAYTTSGSRNDGY 173

Query: 162 TAGVGVEVGGLSESLVARLEYRASKYSKV--------------EGFYNTISLGVGMKF 205
           T G G+E    + S  A++EY+  K+                     +T+  G+  +F
Sbjct: 174 TVGAGLEYL-FAPSWSAKVEYQYYKFGDTTFTGGPADVVGTSFRNDEHTVKAGINYRF 230


>gi|148258469|ref|YP_001243054.1| hypothetical protein BBta_7274 [Bradyrhizobium sp. BTAi1]
 gi|146410642|gb|ABQ39148.1| putative exported protein of unknown function [Bradyrhizobium sp.
           BTAi1]
          Length = 693

 Score = 76.2 bits (186), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 46/231 (19%), Positives = 76/231 (32%), Gaps = 68/231 (29%)

Query: 40  TIATNRYVPIRHDFNGPYAGLSALYNGSFGEEAHHNAGG--------------------- 78
            +     V    D+ G Y G    Y       +   A G                     
Sbjct: 35  PLPVQASVSSIFDWTGFYVGTHFGYAAGASNWSATQADGSAPRLMGRLDFYPQYDAFKGT 94

Query: 79  -----SIFAGYNVEDSC-IMYGVEGDVRYTVPVLAD-------NIHSLHG----IGGSLR 121
                 + AGYN + +  ++ GVE D+ +   V A           + +G      GS+R
Sbjct: 95  GSFSSGLQAGYNYQAASRLLLGVEADISFPNSVSATQTFSTTLGDQASYGETVLHAGSVR 154

Query: 122 IRGGYEVSDSLLLYATVGPD---------------VAQKYETGKAGEITPIAIGGTAGVG 166
            R GY   D+ L+Y T G                 +      G   + +   +G  AG G
Sbjct: 155 GRVGYAF-DNWLVYGTGGFGWSFDQFTRTQLMGSPMGGSAVPGTLEKHSLWRLGWVAGAG 213

Query: 167 VEVGGLSESLVARLEYRASKYSKV-------------EGFYNTISLGVGMK 204
           VE+  ++ S  A+LEY  S++                +   ++I LG+  +
Sbjct: 214 VELP-VAPSWTAKLEYLLSEFGGQSISFPAGAQKFEGDYASHSIRLGLNYQ 263


>gi|91977701|ref|YP_570360.1| putative outer membrane protein [Rhodopseudomonas palustris BisB5]
 gi|91684157|gb|ABE40459.1| putative outer membrane protein [Rhodopseudomonas palustris BisB5]
          Length = 237

 Score = 76.2 bits (186), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 41/231 (17%), Positives = 71/231 (30%), Gaps = 41/231 (17%)

Query: 8   VGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGS 67
           +  ++   A    A AAD       G R             + +++ G Y G +     +
Sbjct: 5   LLSAAAVFALTAPAFAADL------GPRTYTKAPPVYTPPEVVYNWTGFYIGGNVGGAFA 58

Query: 68  FGEEAHHNAG---GSIFAGYNVED-SCIMYGVEGDVRYTVPVLADNIHSLHGIG------ 117
                  +AG   G +  G++ +     + G+E    +        +  L  +       
Sbjct: 59  GSNNIQSDAGRFMGGVQGGFDYQFAPNWVVGLEAQYSWMASNNTGVLFPLGSVATENTRG 118

Query: 118 -GSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAI--------GGTAGVGVE 168
            GS+  R GY      LLYA  G                  A         G T G G+E
Sbjct: 119 LGSVTGRLGYSW-GPALLYAKGGYAFRDSSLGVNTAAGVQSAYTTSGNRNDGYTVGAGLE 177

Query: 169 VGGLSESLVARLEYRASKYSKVE--------------GFYNTISLGVGMKF 205
               + S  A++EY+  K+                     +T+  G+  +F
Sbjct: 178 Y-MFAPSWSAKVEYQYYKFDNTSFTGGPADVVGTTFRNDDHTVKAGINYRF 227


>gi|323136580|ref|ZP_08071661.1| FecR protein [Methylocystis sp. ATCC 49242]
 gi|322397897|gb|EFY00418.1| FecR protein [Methylocystis sp. ATCC 49242]
          Length = 438

 Score = 75.8 bits (185), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 33/164 (20%), Positives = 49/164 (29%), Gaps = 29/164 (17%)

Query: 52  DFNGPYAGLSALYNGSFGEEAH------HNAGGSIFAGYNVED-SCIMYGVEGDVRYTVP 104
           ++ G   G +        E A           G +  GYN +    I+ G E D  Y   
Sbjct: 231 NWGGLSIGFNVGTAIGNAEFADPVPMNGVGFLGGLKLGYNWQVLPNIVAGFETDAEYRSE 290

Query: 105 VLADNIHSLH------GIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETG--------- 149
           +               G  G+ R R GY   +  L+Y T G                   
Sbjct: 291 IGGSTNGHGTVSSTRGGYLGTFRGRLGYAF-NRWLVYGTGGLAYGHIIAPRTFSGANLLG 349

Query: 150 -----KAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYS 188
                   +  P   G T G GV+   L+ ++  + EY   K  
Sbjct: 350 PAYAFGTSQNNPFLAGWTVGGGVQF-ALTSNISVKAEYLYVKLQ 392


>gi|75677151|ref|YP_319572.1| hypothetical protein Nwi_2970 [Nitrobacter winogradskyi Nb-255]
 gi|74422021|gb|ABA06220.1| conserved hypothetical protein [Nitrobacter winogradskyi Nb-255]
          Length = 276

 Score = 75.8 bits (185), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 58/289 (20%), Positives = 89/289 (30%), Gaps = 97/289 (33%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M++L LA  +   A      A AAD             P+++T R V     + G Y G 
Sbjct: 1   MRRLLLAAVICGAA----HGAYAADMPDDFPFLRGSQPPSLSTVRTV-----WQGFYIGG 51

Query: 61  SALYNGS--------------------------------FGEEAHHNAGGSIFAGYNVED 88
            A Y  +                                 G  ++ N+G   F GYN++ 
Sbjct: 52  QASYGSADMDFKNSGKDLLERLLNHVDVESQFNLSSWPLGGTSSNRNSGFGGFLGYNLQM 111

Query: 89  SCIMYGVEGDVRYTVPVLADNIHSLHGIG------------------------GSLRIRG 124
             +++GVE    YT            G                          GSLR+R 
Sbjct: 112 EDVVFGVEA--NYTHSKFLGASSGSQGRSFSYPADYRTSAFVQSNASMQIMDFGSLRVRA 169

Query: 125 GYEVSDSLLLYATVGPDVAQKYETGKAG---------------------------EITPI 157
           GY +  S L YA  G  + Q      A                                 
Sbjct: 170 GYSL-GSFLPYAFGGVAMGQANIRRNASYNLHYQYVGTQIPPLPNLAGGGSLSDNANAHF 228

Query: 158 AIGGTAGVGVEVGGLSESLVARLEYRASKYSK-VEGFYNTISLGVGMKF 205
             G  AG+G++   + + L  R E+   +++  V+   NT+  G G +F
Sbjct: 229 IYGYAAGLGID-MMIVDGLFLRAEWEFLRFTAPVDTIVNTVRAGAGYRF 276


>gi|83308663|emb|CAJ01571.1| outer membrane protein [uncultured bacterium]
          Length = 276

 Score = 75.8 bits (185), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 47/246 (19%), Positives = 72/246 (29%), Gaps = 67/246 (27%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M + FL   V ++AL    +A AAD   RA        P I           + G Y G 
Sbjct: 1   MYRKFLLASVGAIALTG-SAAFAADLPSRAPPPVYLPPPPI---------FTWTGFYIGG 50

Query: 61  SALYNGSFGEEAHHNAG--------------------GSIFAGYNVE--------DSCIM 92
                   G  +                         G    G++ +         S ++
Sbjct: 51  QVGGAWGTGGSSFTAFDAVTGRFVDASFGGGNPSGVIGGGHIGFDYQIPTWNWFSSSGVV 110

Query: 93  YGVEGDVRYTVPVLADNI--------------HSLHGIGGSLRIRGGYEVSDSLLLYATV 138
            GVEG V  +       +               +   I GS+R R G    D +L+YAT 
Sbjct: 111 IGVEGSVDGSSLSKTTTVTLPGIFLNNGFATARTSADIQGSIRGRLGIAW-DRVLVYATG 169

Query: 139 GPDVA--------QKYETGKAG-----EITPIAIGGTAGVGVEVGGLSESLVARLEYRAS 185
           G               +            +    G T G G+E   L+ +     EYR +
Sbjct: 170 GVAFGGINSDIQVNGVDAAGVPFFGQRNRSNDRTGWTVGGGIEY-ALTPNWSVGAEYRFT 228

Query: 186 KYSKVE 191
            +  + 
Sbjct: 229 DFGTIS 234


>gi|49473905|ref|YP_031947.1| hemin binding protein b [Bartonella quintana str. Toulouse]
 gi|21689905|gb|AAM68130.1| hemin-binding protein B [Bartonella quintana]
 gi|49239408|emb|CAF25746.1| Hemin binding protein b [Bartonella quintana str. Toulouse]
          Length = 453

 Score = 75.8 bits (185), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 35/181 (19%), Positives = 62/181 (34%), Gaps = 41/181 (22%)

Query: 64  YNGSFGEEAHHNAGGSIFAGYNVEDSCIM-------YGVE------GDVRYTVPVLADNI 110
           ++        +  GGS  AG + +    +       YG+E        +       A+ +
Sbjct: 275 HSHRVNNPHGNPHGGSSAAGRSAQGEQTVNEKSASVYGIEEVKKVAASLGVDQGGRAETL 334

Query: 111 HS--LHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAG---------------E 153
                    G+ R+R G+  +D ++ Y   G    Q  +                     
Sbjct: 335 THTLKQNWAGATRLRIGFA-ADRIMPYVAGGIAYTQLQDIVSISLKEQDGEAVSRKNLTN 393

Query: 154 ITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSK---------VEGFYNTISLGVGMK 204
            T   IG T G G++   ++++++ R EYR S + K         V    N   +GV  K
Sbjct: 394 ETKTMIGYTLGGGIDF-AMTDNVLLRAEYRYSGFGKKKFAKEKLEVNYKTNDFRIGVAYK 452

Query: 205 F 205
           F
Sbjct: 453 F 453



 Score = 45.8 bits (107), Expect = 0.003,   Method: Composition-based stats.
 Identities = 28/153 (18%), Positives = 49/153 (32%), Gaps = 35/153 (22%)

Query: 7   AVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNG 66
            + VS  AL S  +AQAAD       G        +          + G YAG+     G
Sbjct: 6   LITVSIFALVSASAAQAADV------GIPHQSAPTSLPVIAAPAFTWTGFYAGIQI---G 56

Query: 67  SFGEEAHHNAGG--------------------SIFAGYNVEDS-CIMYGVEGDVRYTVPV 105
            F  +   +  G                     ++AG N++     ++ ++ D+ ++   
Sbjct: 57  GFSSKTDMSIVGKGKSVLLSKDLLPKLSGFESGLYAGSNIDLGDNFIFNIDTDLIWSGQK 116

Query: 106 LADNIHSLHGIGGSL-----RIRGGYEVSDSLL 133
               I        S+     R R    + + LL
Sbjct: 117 YTKTIALGASDNVSVDNLVTRSRRSLRLENQLL 149


>gi|115526777|ref|YP_783688.1| OmpA domain-containing protein [Rhodopseudomonas palustris BisA53]
 gi|115520724|gb|ABJ08708.1| OmpA domain protein transmembrane region-containing protein
           [Rhodopseudomonas palustris BisA53]
          Length = 228

 Score = 75.8 bits (185), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 34/190 (17%), Positives = 61/190 (32%), Gaps = 29/190 (15%)

Query: 43  TNRYVP-IRHDFNGPYAGLSAL--------YNGSFGEEAHHNAGGSIFAGYNVED-SCIM 92
              Y P   +++ G Y G                          G +  GY+ +     +
Sbjct: 31  APAYAPAPIYNWTGFYIGGHIGGAFVGDDSIATGVTRNNDGTFLGGVQGGYDYQFAPNWV 90

Query: 93  YGVEGDVRYTVPVLADNIHSLHGIG------GSLRIRGGYEVSDSLLLYATVGPDVAQ-- 144
           +G+E    +        +   +         GS+  R GY      LLYA  G   A   
Sbjct: 91  FGIEAQYSWLDSGTDPVLVGAYSFSDKQKGLGSVTGRIGYTW-GPALLYAKGGYAFADYD 149

Query: 145 --KYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVE-------GFYN 195
                 G    ++  + G T G G+E    + S  A++EY+   +  V+          +
Sbjct: 150 TTVTLGGVGAAVSSKSDGYTVGGGLEYL-FAPSWSAKVEYQYYDFGNVDFGTFSVKNDEH 208

Query: 196 TISLGVGMKF 205
            +  G+  +F
Sbjct: 209 VVKAGLNYRF 218


>gi|49475068|ref|YP_033109.1| hemin binding protein b [Bartonella henselae str. Houston-1]
 gi|49237873|emb|CAF27069.1| Hemin binding protein b [Bartonella henselae str. Houston-1]
          Length = 391

 Score = 75.8 bits (185), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 38/191 (19%), Positives = 68/191 (35%), Gaps = 41/191 (21%)

Query: 54  NGPYAGLSALYNGSFGEEAHHNAGGSIFAGYNVEDSCI-------MYGVE---GDVRYTV 103
           NG Y      ++      A +  G    AG   + + +       +YG+E    +     
Sbjct: 203 NGAYPHSMGAHSHVANPHASNPHGTQNMAGRTTQSTKVAEKNASGIYGIEQVKKEAYEHG 262

Query: 104 PVLADNIHS-----LHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYE----------- 147
                N+ +          G+ R+R G+ V D ++ Y   G   AQ ++           
Sbjct: 263 LSQYGNVETLSHTLKQNWAGATRVRVGFSV-DRVMPYFAGGIAYAQLHDTISISIKKNDE 321

Query: 148 ----TGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFY--------- 194
               +    +     IG T G GV+   ++++++ R EYR S + K +            
Sbjct: 322 SVVTSKNLTDEKKTMIGYTLGGGVDF-AMTDNVLLRAEYRYSDFGKKKFAKEKLEINYKT 380

Query: 195 NTISLGVGMKF 205
           N   +GV  KF
Sbjct: 381 NDFRVGVAYKF 391



 Score = 43.1 bits (100), Expect = 0.026,   Method: Composition-based stats.
 Identities = 25/135 (18%), Positives = 41/135 (30%), Gaps = 30/135 (22%)

Query: 7   AVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNG 66
            + VS  AL +  +A AAD       G        A+         + G YAG+ A   G
Sbjct: 6   LITVSIWALIAASTAHAADV------GIPRQSVLAASPVITAPTFTWTGFYAGIQA---G 56

Query: 67  SFGEEAH--------------------HNAGGSIFAGYNVEDS-CIMYGVEGDVRYTVPV 105
            F  +                          G  +AG N+      ++GV+ D+  +   
Sbjct: 57  GFSSKTDLSIVGKDKTVPLSKDLSPKLSGFEGGFYAGSNINLGDDFIFGVDTDLTLSGQK 116

Query: 106 LADNIHSLHGIGGSL 120
               I        ++
Sbjct: 117 HTKTIIIGVDDNAAV 131


>gi|110633591|ref|YP_673799.1| outer membrane protein, 31 kDa [Mesorhizobium sp. BNC1]
 gi|110284575|gb|ABG62634.1| outer membrane protein, 31 kDa [Chelativorans sp. BNC1]
          Length = 234

 Score = 75.8 bits (185), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 37/207 (17%), Positives = 57/207 (27%), Gaps = 39/207 (18%)

Query: 20  SAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNG------------- 66
           SA AAD V                        D+ G Y G     +              
Sbjct: 16  SAFAADAVYGDVPAAPVA-------EVAAESFDWTGLYLGAFGGVSTGDFKYEAGPTGGD 68

Query: 67  --SFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYT----------VPVLADNIHSLH 114
                + +     G    GY+ +    + G   D+  T              +    S  
Sbjct: 69  PLGGIDISGGGFIGGAQVGYDWQIGNWVIGGVADIAATNHDADISADIDGFGSAEAESKL 128

Query: 115 GIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAG-----EITPIAIGGTAGVGVEV 169
              G++R R GY   D  L+Y   G    +  +    G       +    G TAG GVE 
Sbjct: 129 KYLGTVRARAGYSF-DRTLVYGHGGFAYGETEQKIDLGGTELFNESQGRTGWTAGAGVEF 187

Query: 170 GGLSESLVARLEYRASKYSKVEGFYNT 196
             ++  +    EY      +   F + 
Sbjct: 188 -AVTNRISVGTEYSYVDLGEERVFEDA 213


>gi|319409089|emb|CBI82733.1| Hemin binding protein b [Bartonella schoenbuchensis R1]
          Length = 367

 Score = 75.8 bits (185), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 27/115 (23%), Positives = 51/115 (44%), Gaps = 25/115 (21%)

Query: 114 HGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYE--------------TGKAGEITPIAI 159
               G+ R+R G+ V+D ++ Y  VG   AQ  +              +    + T + +
Sbjct: 255 QKWSGATRMRIGF-VADRIMPYIAVGVTYAQLQDIFSRSVEVAGKEINSFNLSDETKMMV 313

Query: 160 GGTAGVGVEVGGLSESLVARLEYRASKYSK---------VEGFYNTISLGVGMKF 205
           G T G G++   ++++++ R+EYR S + K         ++   N   +GV  KF
Sbjct: 314 GYTLGGGIDF-AMADNVILRVEYRYSDFGKQKFAKDKLELDYKTNDFRVGVAYKF 367



 Score = 50.0 bits (118), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 19/123 (15%), Positives = 34/123 (27%), Gaps = 25/123 (20%)

Query: 7   AVGVSSLALASFCSAQAAD---PVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSA- 62
            V  S   L +    QAAD   P             ++ +         ++G Y G    
Sbjct: 6   LVSTSIFTLFTASMTQAADIRIPRESRPVVAPVEASSVVSPVIAAPIFSWDGFYLGGQIG 65

Query: 63  --------------LYNGSFGEEAHH------NAGGSIFAGYNVEDSC-IMYGVEGDVRY 101
                           +  +               G ++AG NV      + GV+ D+ +
Sbjct: 66  GFSSKSDRSLYAKQGSSREWAPVGKDALPQLSGFMGGLYAGANVSLGNSFVLGVDTDIAW 125

Query: 102 TVP 104
           +  
Sbjct: 126 SNK 128


>gi|319407469|emb|CBI81119.1| Hemin binding protein d [Bartonella sp. 1-1C]
          Length = 270

 Score = 75.5 bits (184), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 41/276 (14%), Positives = 77/276 (27%), Gaps = 87/276 (31%)

Query: 8   VGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLS-ALYNG 66
           +  S   L S   AQA D V    +      P +     +     + G Y G     ++G
Sbjct: 4   LTASVFTLFSISIAQATDFV--IPYQSHTDSPFV-----LSSAFSWQGFYFGARIGGFSG 56

Query: 67  SFGEEAHH-------------------NAGGSIFAGYNVEDSCI-MYGVEGDVRYTVPVL 106
                                         G ++AG ++    I + G + +V ++    
Sbjct: 57  PITSSIMDENNVERNIIFQDQSSPKLSGVVGGLYAGLDINIHNIFVVGCDTNVDWSGVKD 116

Query: 107 ADNIHS-------------------------LHGIGGSLRIRGGYEVSDSLLLYATVGPD 141
              I                                 ++R R G+   D ++ Y   G  
Sbjct: 117 TKVIDVIASLQADLKYGNGGGEVDFGIKQSLQQKWLSAIRWRVGFSF-DRVMPYVAGGVS 175

Query: 142 VAQ-----------------------KYETGKAGEITPIAIGGTAGVGVEVGGLSESLVA 178
           ++Q                       K     +       +G T G G++   ++++ + 
Sbjct: 176 LSQFRSTYSKFLVASNNNSSIRSLSEKPLPVSSTSNVNTMVGYTIGGGLDF-AITDNFIL 234

Query: 179 RLEYRASKYSKVEGFYNTIS---------LGVGMKF 205
           R EY  S + + E   + I           G+  KF
Sbjct: 235 RAEYNYSDFGRKELVNSKIKFSYKSNAFYFGLAYKF 270


>gi|15420172|gb|AAK97308.1|AF308166_1 Pap31 [Bartonella henselae phage 60457]
          Length = 219

 Score = 75.5 bits (184), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 36/223 (16%), Positives = 64/223 (28%), Gaps = 83/223 (37%)

Query: 40  TIATNRYVPIRHDFNGPYAGLSALYNGSFGEEAH-------------------HNAGGSI 80
            +A          + G Y G      G+F  +                         G I
Sbjct: 1   EVAPTVISAPAFSWTGFYIGGQV---GNFSSKVEITDPNKKDKLFSKDDTPKPSGFMGGI 57

Query: 81  FAGYNVEDSC-IMYGVEGDVRYTVP----------------------------------- 104
           +AG N++    ++ GVE D  +                                      
Sbjct: 58  YAGSNMDLGNNMILGVETDAVWADREDAKTSSAKVIREDELVNFKDSLKNANAVFAKDKT 117

Query: 105 --------VLADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGP------DVAQKYETGK 150
                      D++       G+ R+R G+  +D ++ Y   G        V+    T  
Sbjct: 118 MDDVKQDEKHTDSLALKEKWSGATRVRIGFTAADRIMPYVAGGVSYAQVQAVSSTKVTKA 177

Query: 151 AG----------EITPIAIGGTAGVGVEVGGLSESLVARLEYR 183
           A           + T   +G T G GV+   ++++++ R EYR
Sbjct: 178 ADDAEIASAQLFDKTKTLVGFTLGGGVDF-AMTDNVLLRAEYR 219


>gi|209966188|ref|YP_002299103.1| outer membrane protein [Rhodospirillum centenum SW]
 gi|209959654|gb|ACJ00291.1| outer membrane protein [Rhodospirillum centenum SW]
          Length = 231

 Score = 75.5 bits (184), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 36/205 (17%), Positives = 69/205 (33%), Gaps = 41/205 (20%)

Query: 41  IATNRYVPIRHDFNGPYAGLSALYNG--------------SFGEEAHHNAGGSIFAGYNV 86
             ++     +  F+G Y G +  Y                   +  +    G++F GY  
Sbjct: 28  ALSSAPALAQSPFDGGYVGAALGYAWMKPNGTTTFSNATTQKVDRTNDGVTGAVFLGYGK 87

Query: 87  EDSCIMYGVEGDVRYTVPVLADNIHSL-----HGIGGSLRIRGGYEVSDSLLLYATVGPD 141
               +  G+EG++  +       +         G    + +R G   +   L+Y  +G  
Sbjct: 88  TIDTLYLGIEGEIGISDQEKNSTLAGNTYNFDAGTSLGIALRAGLLATPDTLVYGRIGWQ 147

Query: 142 VAQKYETGKAG--------EITPIAIGGTAGVGVEVGGLSESLVARLEYRASKY------ 187
                 +G+ G        +      G   G GVE   L+E+++ARLEY  + Y      
Sbjct: 148 RTDLDVSGRLGSVAGTPTMDENEHLNGWRIGGGVE-HALTENVLARLEYNYTDYESYKVS 206

Query: 188 -------SKVEGFYNTISLGVGMKF 205
                  +  E   + +  G+  +F
Sbjct: 207 YGQGGARTNAEPHESAVRAGIAYRF 231


>gi|118593370|ref|ZP_01550754.1| outer membrane protein, putative [Stappia aggregata IAM 12614]
 gi|118434048|gb|EAV40705.1| outer membrane protein, putative [Stappia aggregata IAM 12614]
          Length = 208

 Score = 75.1 bits (183), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 34/144 (23%), Positives = 55/144 (38%), Gaps = 17/144 (11%)

Query: 77  GGSIFAGYNVEDSCIMYGVEGDVRYTV--PVLADNIHSLHGIGGSLRIRGGYEVSDSLLL 134
            G +  GYN      + G+EG+          + N+        + R+R GY   D  L 
Sbjct: 67  VGGVHVGYNHMLGQFVLGIEGEANLANFSDTTSANLDVDINWMIAARLRAGYAF-DRFLA 125

Query: 135 YATVGPDVAQ-KYETGKAG-EITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSK--- 189
           +AT G   ++  +E    G   +    G   G GVE G ++E +  R EY+   +     
Sbjct: 126 FATTGVSFSEVTFEIPGTGISDSNTHTGFLFGGGVE-GYVTEHISVRAEYQHHWFGNESY 184

Query: 190 --------VEGFYNTISLGVGMKF 205
                   +EG  + +  GV   F
Sbjct: 185 NVGAGAFDIEGDLDLLRAGVSYHF 208


>gi|12620644|gb|AAG60920.1|AF322013_39 ID525 [Bradyrhizobium japonicum]
          Length = 781

 Score = 75.1 bits (183), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 46/231 (19%), Positives = 68/231 (29%), Gaps = 61/231 (26%)

Query: 25  DPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSFGEEAH----------H 74
           D  +   +G     P +          ++ G Y G +          A            
Sbjct: 554 DTAQAKANGIDKEPPPVMPT-------NWAGVYLGGTIGAGKGRSHYADPFPTPVSGDYA 606

Query: 75  NAGGSIFAG---YNVEDSCIMYGVEGDVRYTVPVLADNIHSLH-------GIG------- 117
           + GG++F G    N +    + G+E    Y   V   N            G         
Sbjct: 607 DLGGAMFGGQIGINYQTGSWVLGLEAS-GYWANVQGTNTCFGAFPSPQIAGFNCGSQIDA 665

Query: 118 -GSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAI-------GGTAGVGVEV 169
            G+L  R GY   D  LLY   G    ++      G I+   +       G T G G+E 
Sbjct: 666 LGALTGRVGYAF-DRTLLYVKGGSAWDRQTNQFNTGGISGTILTNGNTNWGWTVGGGLEY 724

Query: 170 GGLSESLVARLEYRASKYSKV----------------EGFYNTISLGVGMK 204
             L  +    LEY+   + K                      T+SLGV  K
Sbjct: 725 -ALLPNWSMALEYKYYDFGKSPVFTTAGLGSVPLSPNSTTVQTVSLGVNYK 774



 Score = 58.9 bits (141), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 40/221 (18%), Positives = 60/221 (27%), Gaps = 53/221 (23%)

Query: 15  LASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIR-HDFNGPYAGLSAL---------- 63
              +  A AAD            V T       P    ++ G Y G              
Sbjct: 27  AGLYGPAHAADLP----------VKTAPPITAAPSTLWNWTGIYVGAHLGGAFGSSDWQT 76

Query: 64  ---------YNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVE-----GDVRY--TVPVLA 107
                      G  G        G    G N +    + G+E      DV         A
Sbjct: 77  ATGLQADFSNRGFPGSGNAEGLLGGGQIGVNYQFGTWVTGLEIAASAADVDGFAKCANRA 136

Query: 108 DNIHSLHGIG--------GSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAG------E 153
           DN + +            G++  R G    + LL+Y   G   A      +         
Sbjct: 137 DNRYGVISFTCDNRVTSLGTIAGRLGQTWGN-LLIYGKAGAAWATDESDARTSHYINKFN 195

Query: 154 ITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFY 194
            +    G   G+G+E    S +L A +EY    +   +  Y
Sbjct: 196 QSGTRWGWMGGLGLEY-AFSPNLSAFVEYDHFDFGSKDSNY 235


>gi|296444784|ref|ZP_06886747.1| hypothetical protein MettrDRAFT_0463 [Methylosinus trichosporium
           OB3b]
 gi|296257732|gb|EFH04796.1| hypothetical protein MettrDRAFT_0463 [Methylosinus trichosporium
           OB3b]
          Length = 1115

 Score = 74.7 bits (182), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 41/246 (16%), Positives = 63/246 (25%), Gaps = 70/246 (28%)

Query: 8   VGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGS 67
           +  S  A + FC   A   +       +                 + G +AGL+  Y  S
Sbjct: 24  IVASVAAYSLFCPLGAGSAIAAEPSAAKSAGAASPPM--------WTGFHAGLNGGYGWS 75

Query: 68  F-------------------------------------GEEAHHNAGGSIFAGYNVEDSC 90
                                                    A     G +  GY+     
Sbjct: 76  SDTKAQLTVTPLEPPLLYVPPDRVPPSDNFARDATRSIARSASGAFIGGLQLGYDWAFGE 135

Query: 91  -IMYGVEGDVRYTVPVLADNIH----------SLHGIGGSLRIRGGYEVSDSLLLYATVG 139
             + GVE D + +V    +             +     G+LR R G   + SLL+Y T G
Sbjct: 136 RYVVGVEADFQGSVGGHGEATTYSPSTVFVTANQLDYLGTLRGRLGVLATPSLLVYGTAG 195

Query: 140 PD-------------VAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASK 186
                           A  +      +     +G  AG GVE          + EY    
Sbjct: 196 AAYGGPATRTQITQPGAGVFGGYGESQTDRTRLGWAAGAGVE-WMFDPKWSLKAEYLHYD 254

Query: 187 YSKVEG 192
              + G
Sbjct: 255 LGSIGG 260



 Score = 65.1 bits (157), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 30/150 (20%), Positives = 48/150 (32%), Gaps = 33/150 (22%)

Query: 74   HNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLA------------------DNIHSLHG 115
               GG    G    ++  + G+E D+R +                               
Sbjct: 926  GFVGGFQIGGNQKLNARFVAGLEADLRGSFGNSGSRSQFGTSTSIGNTFLSFGQTTVRLN 985

Query: 116  IGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEIT--------------PIAIGG 161
              G++R R GY V+  + LYAT G   A    + +                      +G 
Sbjct: 986  YLGTIRPRLGYLVTPDVQLYATGGLAFAGLTSSAEMVTDRVGGITTTVGDPLYQDTRLGW 1045

Query: 162  TAGVGVEVGGLSESLVARLEYRASKYSKVE 191
            TAG GVE   L+ +  A+ EY      ++ 
Sbjct: 1046 TAGGGVE-WALAPNWTAKAEYLHYDLGQIR 1074


>gi|13474724|ref|NP_106293.1| outer membrane protein [Mesorhizobium loti MAFF303099]
 gi|14025479|dbj|BAB52079.1| outer membrane protein [Mesorhizobium loti MAFF303099]
          Length = 205

 Score = 74.7 bits (182), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 40/219 (18%), Positives = 71/219 (32%), Gaps = 33/219 (15%)

Query: 3   KLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSA 62
           ++ + V  + LA      A AAD                +     P    ++G Y G+  
Sbjct: 4   RVKIVVTAAGLAFCLLGPAMAADL---------------SPTYNDPPAFQWSGAYVGVHG 48

Query: 63  LYNGSFGEE---AHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLAD--NIHSLHGIG 117
               +         +   G + AGYN +    + G E +  Y      D           
Sbjct: 49  GTAFTGMPNPFAGRNGFSGGVQAGYNQQMGPTVLGAEIEGSYLGGAEHDVQGGKIKEKWR 108

Query: 118 GSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLV 177
           G+ + + G    D  LL+ T G  + +  +           +G   G G+E  G +  L 
Sbjct: 109 GAAKAKAGLSF-DQTLLFGTGGVALTKFDKGDNVSSADGWKVGYLLGAGIE-QGFAGGLS 166

Query: 178 ARLEYRASK-----------YSKVEGFYNTISLGVGMKF 205
           A++EY   +            SK     + +  G+  +F
Sbjct: 167 AKVEYDYVRTLGVETTSALGTSKTTIGSHELKAGINYRF 205


>gi|323138252|ref|ZP_08073324.1| putative outer-membrane immunogenic protein precursor
           [Methylocystis sp. ATCC 49242]
 gi|322396504|gb|EFX99033.1| putative outer-membrane immunogenic protein precursor
           [Methylocystis sp. ATCC 49242]
          Length = 255

 Score = 74.7 bits (182), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 48/215 (22%), Positives = 71/215 (33%), Gaps = 40/215 (18%)

Query: 5   FLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALY 64
              +   SLA+ +  SA AAD   R                  P    + G YAG++   
Sbjct: 3   KTLLTAVSLAVLAAGSAFAADLPSRKE--------APVYVPPPPPPPMWTGFYAGVNIGG 54

Query: 65  NGSFGEEAHH-----NAGGSI------------FAGYNVE-DSCIMYGVEGDVRYTVPVL 106
               G    +      A G +              GYN +     + GVE D + T    
Sbjct: 55  GWDAGNGNGNAWNLFGANGGVTNNMSGGVVGGGQVGYNYQITPMFLVGVETDFQGTSMGS 114

Query: 107 ADNIH------------SLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEI 154
             N +            +     G++R R G  ++ +LL+Y T G   A     G     
Sbjct: 115 GMNNNNWLWGWNGRAQGTSLDWFGTVRGRAGVTITPTLLVYGTGGFAYAGVQRNGGFQT- 173

Query: 155 TPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSK 189
           +    G TAG GVE      +  A+ EY  +  S 
Sbjct: 174 SATQTGWTAGGGVE-WMFMPNWSAKAEYLYTDVSG 207


>gi|192289353|ref|YP_001989958.1| porin [Rhodopseudomonas palustris TIE-1]
 gi|192283102|gb|ACE99482.1| porin [Rhodopseudomonas palustris TIE-1]
          Length = 243

 Score = 74.3 bits (181), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 41/210 (19%), Positives = 69/210 (32%), Gaps = 47/210 (22%)

Query: 39  PTIATNRYVP-IRHDFNGPYAGLSALYNGSFGEEAHHNAG----------GSIFAGYNVE 87
           P      Y P   +++ G Y G      G+F  +     G          G + AGY+ +
Sbjct: 28  PYTKAPAYAPAPVYNWTGFYIGGHIG--GAFSGDNSIGTGVTASDNGKFLGGVQAGYDWQ 85

Query: 88  D-SCIMYGVEGDVRY-----TVPVLADNIHSLHGIG---------GSLRIRGGYEVSDSL 132
                + GVEG   +             ++   G+           S+  R GY      
Sbjct: 86  FAPNWVLGVEGQYSWLSGTNQSVAFGGTLNGAPGVFTYADNQRGLASVTGRLGYTW-GPA 144

Query: 133 LLYATVGPDVAQKYET----GKAGEITPIAI-----GGTAGVGVEVGGLSESLVARLEYR 183
           LLY   G   A    +      AG    +AI     G T G G+E    + +   ++EY+
Sbjct: 145 LLYVKGGWAYADYSSSLTFVPNAGGFAAVAIDSKKDGYTVGGGLEYL-FAPNWSGKIEYQ 203

Query: 184 ASKYSKVE--------GFYNTISLGVGMKF 205
              +  V+           + +  G+  +F
Sbjct: 204 YYDFGNVDLGNGFSAKNDEHVVKAGLNYRF 233


>gi|146337818|ref|YP_001202866.1| putative outer membrane protein A-like (OmpA-like) [Bradyrhizobium
           sp. ORS278]
 gi|146190624|emb|CAL74626.1| Conserved hypothetical protein; putative outer membrane Protein
           A-like (OmpA-like) [Bradyrhizobium sp. ORS278]
          Length = 673

 Score = 74.3 bits (181), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 43/202 (21%), Positives = 66/202 (32%), Gaps = 39/202 (19%)

Query: 25  DPVRRAHHGGRGVVPTIATNRYVPIR-------HDFNGPYAGLSALYNGSFGEEA----- 72
             V      G G + T      +P++        D+ G Y G  A Y             
Sbjct: 19  MLVAGTMLAGLGPLATSVAAADLPVKARMAQTVFDWTGLYVGAHAGYTRDHASATLSDPT 78

Query: 73  --------HHNAGGSIFAGYNV-EDSCIMYGVEGDVRYTVPVLAD-----------NIHS 112
                    +   G + AGYN    S ++ G+EGD  +   + ++           ++  
Sbjct: 79  GVASAGSRFNGLTGGVQAGYNWVTRSGLLLGLEGDFSFPNYLTSNHTVAMLGTPGASVSE 138

Query: 113 LHGIGGSLRIRGGYEVSDSLLLYATVG--PDVAQKYETGKAGEITP---IAIGGTAGVGV 167
           L     + R R GY  +   L YAT G      +   T  AG         +G  AG G+
Sbjct: 139 LWDYVATARGRVGYA-NGDWLAYATGGVAWTGGRFINTDPAGNTEKRLTTRLGWVAGAGI 197

Query: 168 EVGGLSESLVARLEYRASKYSK 189
           E    +     RLEY    +  
Sbjct: 198 E-RAFAPDWSWRLEYLYYGFEN 218


>gi|75677026|ref|YP_319447.1| outer membrane autotransporter barrel [Nitrobacter winogradskyi
           Nb-255]
 gi|74421896|gb|ABA06095.1| outer membrane autotransporter barrel [Nitrobacter winogradskyi
           Nb-255]
          Length = 652

 Score = 74.3 bits (181), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 29/204 (14%), Positives = 47/204 (23%), Gaps = 43/204 (21%)

Query: 31  HHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYN-----------GSFGEEAHHNAGGS 79
                G              +++ G Y G S               G+          G 
Sbjct: 410 PDQVAGAPLFAKAPAMGVAPYNWTGFYIGASTGVLNGRTDWSFPGFGTGANPRFAGFAGG 469

Query: 80  IFAGYNVEDSCIMYGVEGDVRYTVPVLADN--------IHSLHGIGGSLRIRGGYEVSDS 131
              GY+ +    + G+EG    +    A +          +     G+   + GY +   
Sbjct: 470 GQIGYDWQTGPWVVGIEGAFNASNANGARSCPNALFYTCRNEIDWLGTATAKLGYALWSR 529

Query: 132 LLLYATVGPDVAQKYETGK-----------------------AGEITPIAIGGTAGVGVE 168
            L+Y   G                                      +  A+G T G G E
Sbjct: 530 SLVYLRGGAAFGNTRIVSTCNTGPNGQYIDYSIPALITQPGCGASSSRTAVGWTIGYGAE 589

Query: 169 VGGLSESLVARLEYRASKYSKVEG 192
              LS +   R E           
Sbjct: 590 F-ALSRNWTVRAESNYFDLGTERH 612


>gi|323136029|ref|ZP_08071112.1| hypothetical protein Met49242DRAFT_0499 [Methylocystis sp. ATCC
           49242]
 gi|322399120|gb|EFY01639.1| hypothetical protein Met49242DRAFT_0499 [Methylocystis sp. ATCC
           49242]
          Length = 582

 Score = 73.9 bits (180), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 44/253 (17%), Positives = 71/253 (28%), Gaps = 74/253 (29%)

Query: 2   QKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLS 61
           + +       +L  A FC+     P   A        P        P    + G Y G +
Sbjct: 5   KSVTRRFAACALTFAGFCA-----PASGADLPSFKGAPVAP-----PPVFTWTGLYVGFN 54

Query: 62  ALYNGSFGEEAHHNA---------------------------GGSIF---AGYNVE-DSC 90
             +  +  +     +                           GG  F   AGYN +    
Sbjct: 55  FGHTWTASDPVSIGSVNPFDLSGAGFGPASALGATGAVDARLGGYFFGGQAGYNWQFSEK 114

Query: 91  IMYGVEGDVRYTVPVLADNIHS-----------------LHGIGGSLRIRGGYEVSDSLL 133
           ++ G E D++        ++ S                      G++R R GY V+ + +
Sbjct: 115 LIAGFEADIQGAGVRGGGHLASILPAPAGFAVSGVKLSRGLEYFGTVRGRFGYAVTPTFM 174

Query: 134 LYATVGPDVAQ---------------KYETGKAGEITPIAIGGTAGVGVEVGGLSESLVA 178
            Y T G                            +     +G T G G EV  LS ++ A
Sbjct: 175 AYVTGGLAYGGVTADSAIRQSLTPSLLLAEPGKLDYFDNRVGWTVGAGGEV-ALSRNISA 233

Query: 179 RLEYRASKYSKVE 191
           +LEY       V 
Sbjct: 234 KLEYLYYDLGGVT 246


>gi|319898376|ref|YP_004158469.1| Hemin binding protein E [Bartonella clarridgeiae 73]
 gi|319402340|emb|CBI75879.1| Hemin binding protein E [Bartonella clarridgeiae 73]
          Length = 299

 Score = 73.9 bits (180), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 26/110 (23%), Positives = 42/110 (38%), Gaps = 19/110 (17%)

Query: 113 LHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYE--------TGKAGEITPIAIGGTAG 164
                G+ R+R G+  +D ++ Y   G    +  +             + +   IG T G
Sbjct: 192 KEKWTGATRVRIGFA-ADRIMPYVAGGISYVELQDTLSVVIGTEENKADESKTMIGYTFG 250

Query: 165 VGVEVGGLSESLVARLEYRASKYSKV---------EGFYNTISLGVGMKF 205
            GV+   L+ S++ R EYR S + K              N   +GV  KF
Sbjct: 251 GGVDF-ALTNSIIVRTEYRYSDFGKKKFAKEEVDLSYKTNNFRVGVAYKF 299


>gi|90424253|ref|YP_532623.1| putative outer membrane protein [Rhodopseudomonas palustris BisB18]
 gi|90106267|gb|ABD88304.1| putative outer membrane protein [Rhodopseudomonas palustris BisB18]
          Length = 247

 Score = 73.9 bits (180), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 44/212 (20%), Positives = 67/212 (31%), Gaps = 40/212 (18%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K  L   V  +AL     A AAD   R +              YV   +D++G Y G 
Sbjct: 1   MKKFLLGT-VGVVALGLAAPAVAADLPARTYTK---------APAYVAAVYDWSGFYIGA 50

Query: 61  SALYNGSF------------GEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRY------- 101
           +A +  S             G      A      GY  +    ++G+E    +       
Sbjct: 51  NAGWGNSRDSRFDETFGLDLGAHDADGAVAGGQIGYRWQTGTWVFGLEAQGDWADLSGNH 110

Query: 102 -TVPVLADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEIT----- 155
               V  + + S     G    + GY   ++ LLY   G  V  +               
Sbjct: 111 LNPLVFDNRLSSKTDAFGLFTGQIGYAW-NNALLYVKGGAAVTDRKYDFTVDSTGAPISS 169

Query: 156 ---PIAIGGTAGVGVEVGGLSESLVARLEYRA 184
                   GT GVG+E  G + +    +EY  
Sbjct: 170 TGYKTRWSGTVGVGLEY-GFAPNWSFGVEYDH 200


>gi|27376315|ref|NP_767844.1| outer-membrane immunogenic protein [Bradyrhizobium japonicum USDA
           110]
 gi|27349455|dbj|BAC46469.1| outer-membrane immunogenic protein precursor [Bradyrhizobium
           japonicum USDA 110]
          Length = 241

 Score = 73.9 bits (180), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 39/208 (18%), Positives = 61/208 (29%), Gaps = 38/208 (18%)

Query: 34  GRGVVPTIATNRYVPIRHDFNGPYAGLSAL--------YNG-SFGEEAHHNAGGSIFAGY 84
           G           YV   +++ G Y G            +NG S G   +    G +  G 
Sbjct: 26  GNRNYYKAPAPAYVAPIYNWTGFYLGAHVGGAFSSDNNFNGLSTGNNGNGRFLGGVQVGA 85

Query: 85  NVE-DSCIMYGVEGDVRYTVPVLADNIHSLHGIG------GSLRIRGGYEVSDSLLLYAT 137
           + + +   + GVEG   +    +                 GS+  R GY      LLY  
Sbjct: 86  DWQFNPNFVVGVEGQYSWLSGSVGAVFPGGVAYTNDQRGLGSITGRVGYTW-GPGLLYVK 144

Query: 138 VGPDVAQKYETGKAGE-------ITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKV 190
            G   +   E    G              G T G G+E    + +  A+ EY+   +   
Sbjct: 145 GGYAYSDNNEKVTVGGVPTGFIIDGDHRNGYTVGAGLEY-MFAPNWSAKAEYQYYNFGDA 203

Query: 191 -------------EGFYNTISLGVGMKF 205
                            +T   GV  +F
Sbjct: 204 HFTAGPLAGTGNFTTDDHTFKAGVNYRF 231


>gi|254503257|ref|ZP_05115408.1| OmpA-like transmembrane domain, putative [Labrenzia alexandrii
           DFL-11]
 gi|222439328|gb|EEE46007.1| OmpA-like transmembrane domain, putative [Labrenzia alexandrii
           DFL-11]
          Length = 184

 Score = 73.9 bits (180), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 32/162 (19%), Positives = 59/162 (36%), Gaps = 17/162 (10%)

Query: 47  VPIRHDFNGPYAGLSALYN---------GSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEG 97
            P    + GPY G  A  +         G   + +  +A   +F GYN E S ++ GVEG
Sbjct: 2   APAGSIWAGPYLGFEAGGSQTVTEVKAGGQKKDYSRFDAAFGVFGGYNWEVSRVILGVEG 61

Query: 98  DVRYTVPVLADN------IHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKA 151
              Y              I +      + + R G  + ++ + Y ++G            
Sbjct: 62  AATYIGDTKKGQHPVLGTIETGSKWSVTAKTRVGLPI-NNFMPYVSLGVAATDHSLKANG 120

Query: 152 GEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGF 193
              + + +G   G GVEV  + ++   R +Y  +  +  +  
Sbjct: 121 RTESSVGLGAVLGAGVEV-AMHDNWRLRADYTLTGIADTKDT 161


>gi|319898546|ref|YP_004158639.1| Hemin binding protein B [Bartonella clarridgeiae 73]
 gi|319402510|emb|CBI76053.1| putative Hemin binding protein B [Bartonella clarridgeiae 73]
          Length = 609

 Score = 73.9 bits (180), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 21/115 (18%), Positives = 38/115 (33%), Gaps = 24/115 (20%)

Query: 113 LHGIGGSLRIRGGYEVSDSLLLYATVGPD-----VAQKYETGKAGEIT---------PIA 158
                G+ RIR G   +   + Y   G               + G+              
Sbjct: 497 KQKWSGATRIRLGLA-AGRFMPYIAGGVAYTKIQGTFSKLIKEIGKENTSSNLFDSVETM 555

Query: 159 IGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFY--------NTISLGVGMKF 205
           IG T   G +   +++ ++ R EYR S + + +           N + +G+  KF
Sbjct: 556 IGYTLSGGFDF-AMTDRVLIRSEYRYSDFGEKKFKKINSKYYKINDVRIGLAYKF 609



 Score = 49.3 bits (116), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 18/131 (13%), Positives = 34/131 (25%), Gaps = 33/131 (25%)

Query: 7   AVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLS-ALYN 65
            V +S  +       Q AD +                   V   + + G Y G     ++
Sbjct: 6   LVTISVFSFILASRVQGADIINHQDSRSI-----------VAPVYSWKGFYLGGQIGGFS 54

Query: 66  GSFGEEAHH-------------------NAGGSIFAGYNVEDSC-IMYGVEGDVRYTVPV 105
           G      H                       G  +AG N +     + GV+ D+ ++   
Sbjct: 55  GLTTFNYHKYDNIEKWNSIDEDLSSEIFGFTGGFYAGSNFDFGNGFILGVDTDIVFS-NK 113

Query: 106 LADNIHSLHGI 116
               +   +  
Sbjct: 114 KDTKVFVKNKF 124


>gi|91977226|ref|YP_569885.1| putative outer membrane protein [Rhodopseudomonas palustris BisB5]
 gi|91683682|gb|ABE39984.1| putative outer membrane protein [Rhodopseudomonas palustris BisB5]
          Length = 241

 Score = 73.9 bits (180), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 33/184 (17%), Positives = 56/184 (30%), Gaps = 31/184 (16%)

Query: 39  PTIATNRYVPIRHDFNGPYAGLSALYNGSFGEEAHHNAGG--------------SIFAGY 84
           P       +   +D++G Y G +  +  S      +  GG                  GY
Sbjct: 28  PYAKAPPIIAAVYDWSGFYIGANGGWGTSRKSWDFYTVGGLAAEGSHDASGATAGGQIGY 87

Query: 85  NVEDSCIMYGVEGDVRYTVPVLAD--------NIHSLHGIGGSLRIRGGYEVSDSLLLYA 136
           N +    ++G+E    +     ++        +  S     G    R GY   ++ LLYA
Sbjct: 88  NWQAGSWVFGLEAQGNWADFKGSNVTLLGGLFDNQSRIDAFGLFTGRVGYAW-NNALLYA 146

Query: 137 TVGPDVAQKY-------ETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSK 189
             G  V           +    G  +    G   G G E  G + +    +EY      K
Sbjct: 147 KGGAAVVNDKYDFIRRADGFVTGTASETRWGAAVGAGFEY-GFTPNWSFAVEYDHLFLDK 205

Query: 190 VEGF 193
            +  
Sbjct: 206 KDVT 209


>gi|260426559|ref|ZP_05780538.1| conserved hypothetical protein [Citreicella sp. SE45]
 gi|260421051|gb|EEX14302.1| conserved hypothetical protein [Citreicella sp. SE45]
          Length = 199

 Score = 73.5 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 35/204 (17%), Positives = 68/204 (33%), Gaps = 18/204 (8%)

Query: 11  SSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALY----NG 66
           S + L    +   A  +         V P        P+  D+ GP  G    Y      
Sbjct: 5   SLILLPFLATPALAGSLEPTPVEPAPVAPLAPVAS--PVTGDWTGPSVGAQLGYGSVDTD 62

Query: 67  SFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGSLRIRGGY 126
             G+++       + A Y+ +    + G    V+Y    +             +  R GY
Sbjct: 63  GAGDDSEDGMVYGLRAFYDHDFGNWVAG--AGVQYDATDIDLGDAGDLDGIARVGGRVGY 120

Query: 127 EVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASK 186
           ++    ++Y T G   A    T         + G   G GVE   +S+++    E   ++
Sbjct: 121 DL-GRTMVYGTGGYAHA---TTDGGSLDAGSSGGYYVGAGVET-FVSDNVTLNGEVNYNE 175

Query: 187 YSKVEGFYNTI-----SLGVGMKF 205
           +S  +     +     ++G+  +F
Sbjct: 176 FSDFDDDDLEVGATTATVGINYRF 199


>gi|296444331|ref|ZP_06886296.1| porin [Methylosinus trichosporium OB3b]
 gi|296257978|gb|EFH05040.1| porin [Methylosinus trichosporium OB3b]
          Length = 277

 Score = 73.5 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 36/181 (19%), Positives = 61/181 (33%), Gaps = 44/181 (24%)

Query: 48  PIRHDFNGPYAGLSALYNG----------------SFGEEAHHNAGGSIFAGYNVE-DSC 90
           P    + GPY GL+   +                 +    ++    G +  GYN +    
Sbjct: 36  PPVFSWTGPYVGLNLGGSWITRNNDWNNWGGWGWNNNNSGSNGGVSGGLQIGYNYQLSPM 95

Query: 91  IMYGVEGD--------------------VRYTVPVLADNIHSLHGIGGSLRIRGGYEVSD 130
            + G+E D                    V ++     +N        G++R R G  + D
Sbjct: 96  FVVGLETDFQGTSIGGGNNNNNWWGYGGVGWSNWWNNNNNE-RVPWFGTVRGRLGVALLD 154

Query: 131 -SLLLYATVGPDVAQKYETGK----AGEITPIAIGGTAGVGVEVGGLSESLVARLEYRAS 185
             LL+Y T G    +           G    +  G TAG G+E   L  +  A++EY  +
Sbjct: 155 SRLLIYGTGGFGYGEVNRNDLFSWWGGNNGQLRTGWTAGGGIEWAFL-PNWSAKIEYLYT 213

Query: 186 K 186
           +
Sbjct: 214 E 214


>gi|146341076|ref|YP_001206124.1| putative outer-membrane protein [Bradyrhizobium sp. ORS278]
 gi|146193882|emb|CAL77899.1| putative outer-membrane protein precursor [Bradyrhizobium sp.
           ORS278]
          Length = 237

 Score = 73.5 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 37/206 (17%), Positives = 71/206 (34%), Gaps = 35/206 (16%)

Query: 4   LFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAG--LS 61
           +   + +++  +       AAD   R          T A    +   +D++G Y G    
Sbjct: 1   MKKLLLMTTALVVLASPTLAADLAAR--------PYTKAPAPMMAAIYDWSGFYIGANGG 52

Query: 62  ALYNGSFGE-------EAHHNAGGSI--FAGYNVEDSCIMYGVEGDVRYTV-------PV 105
             ++ +  +        +H ++GG+I    GY  +   +++GVE    +          +
Sbjct: 53  GGWSHNTWDLVGGGREGSHDSSGGTIGGQFGYRWQMGPVVFGVEAQGNWADFTGDNVSAL 112

Query: 106 LADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPD-------VAQKYETGKAGEITPIA 158
            A    +     G    + GY   +++LLYA  G         +            T   
Sbjct: 113 FATRNRTKTDAFGLFTGQVGYAF-NNVLLYAKGGAAVTSNKYTITNAVTGAFLASNTDSR 171

Query: 159 IGGTAGVGVEVGGLSESLVARLEYRA 184
            GG  G G+E  G + +    +EY  
Sbjct: 172 WGGVVGAGLEY-GFAPNWSVGVEYDH 196


>gi|240850342|ref|YP_002971735.1| hemin binding protein E [Bartonella grahamii as4aup]
 gi|240267465|gb|ACS51053.1| hemin binding protein E [Bartonella grahamii as4aup]
          Length = 330

 Score = 73.5 bits (179), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 26/112 (23%), Positives = 42/112 (37%), Gaps = 21/112 (18%)

Query: 113 LHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYET-----------GKAGEITPIAIGG 161
                G+ R+R G+  +  ++ Y   G    Q  +             +  + T   IG 
Sbjct: 221 KQKWTGATRVRVGFS-AGRVMPYIAGGVAYGQFQDILSTVITGGEPFNRTSDATKTMIGY 279

Query: 162 TAGVGVEVGGLSESLVARLEYRASKYSKVEGFY--------NTISLGVGMKF 205
           T G GV+   +++ LV R EYR S + K +           N    G+  KF
Sbjct: 280 TLGGGVDF-AMTDHLVVRAEYRYSDFGKKKFKDEIEVKYKTNDFRAGIAYKF 330


>gi|323137480|ref|ZP_08072557.1| Carbohydrate-selective porin OprB [Methylocystis sp. ATCC 49242]
 gi|322397106|gb|EFX99630.1| Carbohydrate-selective porin OprB [Methylocystis sp. ATCC 49242]
          Length = 722

 Score = 73.1 bits (178), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 41/216 (18%), Positives = 65/216 (30%), Gaps = 67/216 (31%)

Query: 48  PIRHDFNGPYAGLSALYNG-------------------SFGEEAHHNAGG-------SIF 81
           P    + G YAG +  +                      FG  +  +A G        +F
Sbjct: 41  PSVFTWTGLYAGANFGHAWASKNAIGLRSTNLVDLTTIGFGPASALSASGVADARLNGLF 100

Query: 82  AG----YNVEDS-CIMYGVEGDVRYT--------------------VPVLADNIHSLHGI 116
           AG    YN + +   + GVE D++                        V + ++      
Sbjct: 101 AGGQVGYNWQFAKQFVVGVEADIQGASVDGGGGLANVAAARLAPPAWAVTSASLRRNLEY 160

Query: 117 GGSLRIRGGYEVSDSLLLYATVGPDVAQKY---------------ETGKAGEITPIAIGG 161
             +LR R GY  + +LLLYAT G    +                 +    GE     +G 
Sbjct: 161 IATLRGRFGYAATPTLLLYATGGIAHGRARAGIELEQSLTSSDFDDAEVEGEHYGNLMGF 220

Query: 162 TAGVGVEVGGLSESLVARLEYRASKYSKVEGFYNTI 197
             G G+E       +  +LEY       +      I
Sbjct: 221 VIGGGLEA-AFGRHVSGKLEYLYYDLGTLRLGTPRI 255


>gi|115524895|ref|YP_781806.1| putative outer membrane protein [Rhodopseudomonas palustris BisA53]
 gi|115518842|gb|ABJ06826.1| putative outer membrane protein [Rhodopseudomonas palustris BisA53]
          Length = 247

 Score = 73.1 bits (178), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 44/214 (20%), Positives = 69/214 (32%), Gaps = 42/214 (19%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+++ L   V  +AL     A AAD             P +     +   +D++G Y G 
Sbjct: 1   MKRILLG-SVGLIALGMAAPAFAADL----PARTYTKAPPM-----IAAIYDWSGFYIGA 50

Query: 61  SALYN---------------GSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPV 105
           +  +                GS G      A      GY  +    ++G+E    +    
Sbjct: 51  NGGWGSSRSSWDYLGPGLAVGSEGSHDADGAVAGGQIGYRWQAGTWVFGLEAQGNWADLS 110

Query: 106 LA--------DNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKA------ 151
            +        D I +     G    + GY   ++ LLY   G  V               
Sbjct: 111 GSNISSLFITDTIRTKVDAFGLFTGQFGYAW-NNALLYVKGGAGVVSSKYDAFTTATGAA 169

Query: 152 -GEITPIAIGGTAGVGVEVGGLSESLVARLEYRA 184
            G       GGTAGVG+E  G + +    +EY  
Sbjct: 170 LGSANSTRWGGTAGVGLEY-GFAPNWSVAVEYDH 202


>gi|209886119|ref|YP_002289976.1| outer membrane protein Omp31 [Oligotropha carboxidovorans OM5]
 gi|209874315|gb|ACI94111.1| outer membrane protein Omp31 [Oligotropha carboxidovorans OM5]
          Length = 237

 Score = 72.8 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 33/148 (22%), Positives = 55/148 (37%), Gaps = 27/148 (18%)

Query: 84  YNVED--SCIMYGVEG-------DVRYTVPVLADNIHSLHGIGGSLRIRGGYEVSDSLLL 134
           YN +   S  ++G+E        D+ +  P           + GS+  R GY V+D LL+
Sbjct: 90  YNWQGFGSPFVFGLEAEIAGSGIDLSFVDPADGSGASYKLNMFGSVTGRVGYAVNDMLLI 149

Query: 135 YATVGPDVAQKYETGKAGEI----TPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKV 190
           YA  G   A+   +   G      +    G T G G+E   ++ +   + EY  + Y K 
Sbjct: 150 YAKGGYAWARTKLSVVDGADSFSSSATHSGYTIGAGLEY-MMARNWSTKAEYLYADYGKA 208

Query: 191 E-------------GFYNTISLGVGMKF 205
                            +T+  G+   F
Sbjct: 209 TYGPAPDGDTGRIGLSNHTVKFGINYHF 236


>gi|86749319|ref|YP_485815.1| putative outer membrane protein [Rhodopseudomonas palustris HaA2]
 gi|86572347|gb|ABD06904.1| putative outer membrane protein [Rhodopseudomonas palustris HaA2]
          Length = 237

 Score = 72.8 bits (177), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 41/231 (17%), Positives = 72/231 (31%), Gaps = 42/231 (18%)

Query: 9   GVSSLALASF-CSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGS 67
            +S++AL +    A AAD             P         + +++ G Y G +     +
Sbjct: 5   LLSAVALGALGAPAFAADL---GPRPAYTKAPPATAPT---VVYNWTGFYIGGNVGGAFA 58

Query: 68  FGEEAHHNAG---GSIFAGYNVED-SCIMYGVEGDVRYTVPVLADNIHSLHGIG------ 117
                  ++G   G +  G++ +     + G+E    +        I             
Sbjct: 59  GSNNLQSDSGRFMGGVQGGFDYQFAPNWVVGLEAQYSWMASNNTGVIFPAGSTATENTRG 118

Query: 118 -GSLRIRGGYEVSDSLLLYATVGPDVAQKYE-------TGKAGEITPIAI-GGTAGVGVE 168
            GS+  R GY      LLYA  G                  A   +     G T G G+E
Sbjct: 119 LGSVTGRIGYTW-GPALLYAKGGYAFRDSSLGVATAGGIPAAYSTSGSRNDGYTVGAGLE 177

Query: 169 VGGLSESLVARLEYRASKYSKV--------------EGFYNTISLGVGMKF 205
               + S  A++EY+  K+                     +T+  G+  +F
Sbjct: 178 Y-MFAPSWSAKVEYQYYKFDNTAFTSGPADMVGTTFRNDDHTVKAGINYRF 227


>gi|75674527|ref|YP_316948.1| carbohydrate-selective porin OprB [Nitrobacter winogradskyi Nb-255]
 gi|74419397|gb|ABA03596.1| carbohydrate-selective porin OprB [Nitrobacter winogradskyi Nb-255]
          Length = 674

 Score = 72.8 bits (177), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 46/206 (22%), Positives = 71/206 (34%), Gaps = 43/206 (20%)

Query: 29  RAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSF------------GEEAHHNA 76
           +         P +   R +    D++G Y G  A + G              G       
Sbjct: 35  QNGFAQAADFPAVRKARPLTAI-DWSGFYVGGHAGFGGGRSAATLFDPAPAAGRNVFGGL 93

Query: 77  GGSIFAGYNVEDSC-IMYGVEGDVRYTVPVLAD-----------NIHSLHGIGGSLRIRG 124
            G I AGYNV     ++ G+E DV +   + ++           +I       G+ R R 
Sbjct: 94  IGGIQAGYNVRLPSGLLLGLEADVSFPSYIESNSFVSGLATARSDITHQWDFIGTARARF 153

Query: 125 GYEVSDSLLLYATVGPD-VAQKYETG-KAGEITP---IAIGGTAGVGVEVGGLSESLVAR 179
           GY  +   L YAT G      +Y     +G+         G  AG G+E    +    AR
Sbjct: 154 GYA-AGPWLAYATGGLAFAGDRYLNDLPSGDQEKMLDARFGWVAGAGLEY-AFAPYWSAR 211

Query: 180 LEYRASKYSKVEGFYNTISLGVGMKF 205
           LEY   ++            G G++F
Sbjct: 212 LEYLHYQFE-----------GTGVQF 226


>gi|86749064|ref|YP_485560.1| outer membrane protein [Rhodopseudomonas palustris HaA2]
 gi|86572092|gb|ABD06649.1| outer membrane protein [Rhodopseudomonas palustris HaA2]
          Length = 254

 Score = 72.8 bits (177), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 38/216 (17%), Positives = 58/216 (26%), Gaps = 54/216 (25%)

Query: 16  ASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL--SALY--------- 64
                A AAD   +A        P+            + G Y G      +         
Sbjct: 17  LGSSMALAADMAMKAPVKAVPYAPSP----------SWTGLYVGGHLGGGWVDETATFVS 66

Query: 65  ---------NGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLAD------- 108
                     G+     H    G + AGYN +    + G+ GD  +T   +         
Sbjct: 67  STSINLIDPLGTSYPIDHSGFLGGVQAGYNYQIQNWVIGIAGDFSWTSAKVDTVTASLLV 126

Query: 109 -----NIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAG----------E 153
                +  +      +   R GY   + LL Y   G         G A           +
Sbjct: 127 PGAQVHTQAKTDWYATATGRVGYAFGN-LLAYGKGGAAWIHSVHGGFADFGAAGIVPFSD 185

Query: 154 ITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSK 189
           +T    G T GVG+E    +       EY    +  
Sbjct: 186 VTTTRAGWTVGVGLE-WAFAPHWSVFGEYNYMDFGT 220


>gi|319785546|ref|YP_004145022.1| outer membrane protein [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
 gi|317171434|gb|ADV14972.1| outer membrane protein [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
          Length = 205

 Score = 72.4 bits (176), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 42/217 (19%), Positives = 72/217 (33%), Gaps = 33/217 (15%)

Query: 5   FLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALY 64
            + +  S+LA+     A AAD                +     P    ++G Y G+    
Sbjct: 6   KIILTASALAMCLLGPAMAADL---------------SPAYNDPPAFQWSGAYVGVHGGT 50

Query: 65  NGSFGEE---AHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLAD--NIHSLHGIGGS 119
             +         +   G   AGYN +    + G E +  Y      D           G+
Sbjct: 51  AFTGMPNPFAGRNGLSGGFQAGYNQQMGPAVLGAEIEGSYLGGAEHDVRGGKIKEKWRGA 110

Query: 120 LRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVAR 179
            + + G    D  LL+ T G  + +  +  K   I    +G   G G+E  G +  L A+
Sbjct: 111 AKAKAGLSF-DQTLLFGTGGVAMTKFDKGDKVNGIDGWKLGYLVGGGIE-QGFAGGLSAK 168

Query: 180 LEYRASKYSKVEGF-----------YNTISLGVGMKF 205
           +EY   +   VE              + +  G+  +F
Sbjct: 169 VEYDYVRTPGVETTSALGKSKATIGSHELKAGINYRF 205


>gi|86749266|ref|YP_485762.1| outer membrane protein [Rhodopseudomonas palustris HaA2]
 gi|86572294|gb|ABD06851.1| outer membrane protein [Rhodopseudomonas palustris HaA2]
          Length = 274

 Score = 72.4 bits (176), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 48/242 (19%), Positives = 77/242 (31%), Gaps = 50/242 (20%)

Query: 12  SLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAG------------ 59
           +L    F +A A   +  A        P       V     +NG Y G            
Sbjct: 25  ALKTFLFGTAAALVMMSSASAADLAARPYTKAAPIVAPVLTWNGFYIGGQGGYGWGSSDE 84

Query: 60  ---LSALYNGSFGEEAHHNAGG--SIFAGYNVEDSCIMYGVEGDVRYTV----------- 103
               +A     FG + +  +GG      GYN +   +++G+EGD  +             
Sbjct: 85  TVFAAANTPAFFGSQKYDTSGGFAGGVVGYNWQSGAVVFGLEGDYHWADINGTSSVINVG 144

Query: 104 -PVLADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGE-----ITPI 157
            P L D   +     G ++ R GY  +   L + + G  V         G          
Sbjct: 145 PPNLGDTYSTKLRGFGDIKGRLGYA-AGPALWFVSGGAAVGDLQHRYDGGAANTFVQNKT 203

Query: 158 AIGGTAGVGVEVGGLSESLVARLEYRASKYSKV--------------EGFYNTISLGVGM 203
             G T G GVE    + S  A+LEY      +               +  ++T+ +G+  
Sbjct: 204 KWGYTVGAGVEY-MFAPSWSAKLEYNYIDLGRSTIQYTAAPTNRSEWKDTFHTVKVGINY 262

Query: 204 KF 205
            F
Sbjct: 263 HF 264


>gi|312115943|ref|YP_004013539.1| porin [Rhodomicrobium vannielii ATCC 17100]
 gi|311221072|gb|ADP72440.1| porin [Rhodomicrobium vannielii ATCC 17100]
          Length = 291

 Score = 72.0 bits (175), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 53/280 (18%), Positives = 76/280 (27%), Gaps = 87/280 (31%)

Query: 8   VGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGS 67
           V  S+LA   F    +A        GG G           P    + G Y G       +
Sbjct: 6   VRASALAAGVFAIIGSASAADIYGGGGYGGYKDAPIIVAAPA---WTGFYVGGHLGAAWT 62

Query: 68  FGEEAHH------------------------------NAGGSIFAGYNVEDS-CIMYGVE 96
             E   +                               A G    GYN +     + G+E
Sbjct: 63  NLETRRNTYWDRDPLPTGVAAAPYDYSTFGGNGLGTTGAFGGGQFGYNWQTGGNFVLGIE 122

Query: 97  GDVR--------------YTVPVLAD-------NIHSLHGIGGSLRIRGGYEVSDSLLLY 135
            DV               Y  P L         N+ S  GI G +  R GY   ++ LLY
Sbjct: 123 VDVGGLQGDNERTFAAATYDGPALDAIDHIAVVNVKSQGGIYGDVTGRLGYAWGNT-LLY 181

Query: 136 ATVGPD--VAQKYETGKAGEITP-----------IAIGGTAGVGVEVGGLSESLVARLEY 182
              G               +I                G TAG G+E    + +   ++EY
Sbjct: 182 LKGGFAWLATDLKVRAAITDIDGETDYYNRSFDNTLTGWTAGGGLEYQ-FNPNWTMKVEY 240

Query: 183 RASKYS-----------------KVEGFYNTISLGVGMKF 205
               +S                 K +   +T+ LG   +F
Sbjct: 241 LHFDFSLDDNNWRWDEGNNWKIFKNDVTADTVKLGFNYRF 280


>gi|296445833|ref|ZP_06887785.1| putative outer-membrane immunogenic protein precursor [Methylosinus
           trichosporium OB3b]
 gi|296256661|gb|EFH03736.1| putative outer-membrane immunogenic protein precursor [Methylosinus
           trichosporium OB3b]
          Length = 277

 Score = 72.0 bits (175), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 50/238 (21%), Positives = 76/238 (31%), Gaps = 56/238 (23%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K  +A  + +LA     SA AAD   R            A     P    + G Y GL
Sbjct: 1   MKKYVVAASMLALAF-GMGSASAADLPSRKD--------APAFLPPPPPPPMWTGFYVGL 51

Query: 61  SALYNGSFGEE----------------------------AHHNAGGSIFAGYNVED-SCI 91
           +A Y  +                                ++    G    GYN +  +  
Sbjct: 52  NAGYGWTNNNTVTQSYADTGSAGFGAQALGGNFPWNASVSNDGFIGGGQIGYNAQVYNSF 111

Query: 92  MYGVEGD----------VRYTVPVLADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPD 141
           + G+E D            Y  P  + +I       G++R R GY V+ +LL YAT G  
Sbjct: 112 VVGLEADMQGVASDRQAASYYGPTASASISRSLDYLGTVRGRVGYLVTPTLLAYATGGLA 171

Query: 142 VAQKYETG-------KAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEG 192
             Q   +G        +   +   +G + G G E   +     A+ EY          
Sbjct: 172 YGQANLSGAYYGTATGSDSFSDTRVGYSVGGGFEWLFM-PHWSAKAEYLYYDLGNATT 228


>gi|316932990|ref|YP_004107972.1| carbohydrate-selective porin OprB [Rhodopseudomonas palustris DX-1]
 gi|315600704|gb|ADU43239.1| Carbohydrate-selective porin OprB [Rhodopseudomonas palustris DX-1]
          Length = 696

 Score = 71.6 bits (174), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 51/239 (21%), Positives = 75/239 (31%), Gaps = 68/239 (28%)

Query: 19  CSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSFGEEAHHNAGG 78
             A AAD VR A    R                D++G Y G            +   AGG
Sbjct: 44  APAAAADLVRTAPLAPR-------------AVFDWSGFYIGAHFSAVAGHSNWSSAPAGG 90

Query: 79  ---------------------SIFAGYNVEDSC-IMYGVEGDVR-------YTVPVLADN 109
                                 + AGYN       + GVE D+         T   L   
Sbjct: 91  SGSIDLFDAFQLFKGTGSYVVGLQAGYNWMLPSRWLIGVEADLNSPNTLGGNTGNTLPSG 150

Query: 110 IHSLHG----IGGSLRIRGGYEVSDSLLLYATVGPDVAQKYET---GKAGEITPIA---- 158
               H     +GG++R R GY +    L Y T G   +          A      A    
Sbjct: 151 TVGGHDHQALLGGTVRGRLGYALGG-WLPYVTAGFAWSYDRLRWPPDPALAQQETALLWR 209

Query: 159 IGGTAGVGVEVGGLSESLVARLEYRASKYSK-------------VEGFYNTISLGVGMK 204
           +G +AG G+++  LS +  AR EY A+ +                +   + + LG+  +
Sbjct: 210 LGWSAGAGIDLP-LSPAWSARAEYLATGFGNGTVSFPIAGERVTSDVLTHAVRLGLNYR 267


>gi|134095715|ref|YP_001100790.1| hypothetical protein HEAR2547 [Herminiimonas arsenicoxydans]
 gi|133739618|emb|CAL62669.1| Conserved hypothetical protein [Herminiimonas arsenicoxydans]
          Length = 278

 Score = 71.6 bits (174), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 43/190 (22%), Positives = 70/190 (36%), Gaps = 49/190 (25%)

Query: 55  GPYAGLSALYNGS-------FGEEAHHNAGG--SIFAGYNVEDSCIMYGVEGDVRYTVPV 105
           G +AG+    +G+        G  A  + GG      GYN     I  G+E D+++T   
Sbjct: 60  GYFAGVGGDASGAIAQASSLTGRYASSHKGGAVGAHLGYNWPSGKIFLGLESDIQFTDLK 119

Query: 106 LADNIHSLHGIGG--------------------SLRIRGGYEVSDSLLLYATVGPDVAQ- 144
               +++++ + G                    +LR R GY V+D  LLY T G  V + 
Sbjct: 120 DNAALNTINPVTGYPGNPMSANVRQVNTVDYLVTLRGRIGY-VNDQWLLYGTGGVAVGRV 178

Query: 145 ----------------KYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYS 188
                            ++   AG  +   +G   G G E   ++++   R+EY      
Sbjct: 179 NTNINYKGSYLSAPTIVFDDLNAGSRS-TRLGFVLGAGAEY-AIAKNWAVRVEYLYYDLG 236

Query: 189 KVEGFYNTIS 198
           K    YN  S
Sbjct: 237 KSSQSYNVTS 246


>gi|85715276|ref|ZP_01046259.1| hypothetical protein NB311A_05248 [Nitrobacter sp. Nb-311A]
 gi|85697922|gb|EAQ35796.1| hypothetical protein NB311A_05248 [Nitrobacter sp. Nb-311A]
          Length = 283

 Score = 71.6 bits (174), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 58/289 (20%), Positives = 87/289 (30%), Gaps = 97/289 (33%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M++L LA  +   A      A AAD               ++T R V     + G Y G 
Sbjct: 8   MRRLLLAAVICGAA----QGAYAADMPDDLPFLRGSQPAGLSTVRTV-----WQGFYIGG 58

Query: 61  SALYNGS--------------------------------FGEEAHHNAGGSIFAGYNVED 88
            A Y  +                                 G  ++ ++G   F GYNV+ 
Sbjct: 59  QASYGSADMDFKNSGKDLLERLLNNLDVEGQYHLSTWPLGGTSSNRSSGFGGFLGYNVQM 118

Query: 89  SCIMYGVEGDVRYTVPVLADNIHSLHGIG------------------------GSLRIRG 124
              ++GVE    YT            G                          GSLR+RG
Sbjct: 119 EDAVFGVEA--NYTHGKFFGASSGSQGRSFNYPTNYLTSAFVQSNASMQITDFGSLRVRG 176

Query: 125 GYEVSDSLLLYATVGPDVAQKYETGKAG---------------------------EITPI 157
           GY      L YA  G  + +      A                                 
Sbjct: 177 GYSF-GCFLPYAFAGVAMGRADIRRNASYSLYYQYIGTQIPPLPDLSGSSSLSDNANAHF 235

Query: 158 AIGGTAGVGVEVGGLSESLVARLEYRASKYSK-VEGFYNTISLGVGMKF 205
             G  AG+G+++    +SL  R E+   +++  V+   NT+  GVG +F
Sbjct: 236 IYGYAAGLGIDMMIF-DSLFLRAEWEFLRFTAPVDTIVNTVRAGVGYRF 283


>gi|312115598|ref|YP_004013194.1| hypothetical protein Rvan_2889 [Rhodomicrobium vannielii ATCC
           17100]
 gi|311220727|gb|ADP72095.1| hypothetical protein Rvan_2889 [Rhodomicrobium vannielii ATCC
           17100]
          Length = 249

 Score = 71.6 bits (174), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 43/213 (20%), Positives = 74/213 (34%), Gaps = 36/213 (16%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K F+A   ++   A   SA A D   ++ +    +V    T         + G Y GL
Sbjct: 1   MKKTFVAAASAAAIFAMSGSALAGDLYAKSGYKDAPIVVAEPT---------WTGFYIGL 51

Query: 61  SAL-------------------YNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGV------ 95
                                 + G     +     G++  GY+ +   I+ GV      
Sbjct: 52  GVGGQAVNHELSASDFDAGDEEWIGDLNGVSGTGVIGTVEVGYDRQFGNIVAGVFFNYDF 111

Query: 96  EGDVRYTVPVLADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYET-GKAGEI 154
             DV  ++ +   N+++      +   R GY V+   L Y   G   +         G  
Sbjct: 112 GDDVSSSLRIEDLNVNAKQTDSWTAGGRLGYLVNPGTLAYVLGGYTQSTFELGFPGFGSA 171

Query: 155 TPIAIGGTAGVGVEVGGLSESLVARLEYRASKY 187
                G T G G+E   LS +   + EYR +++
Sbjct: 172 DDTFAGWTVGGGLETR-LSGNWYLKGEYRFTEF 203


>gi|296447741|ref|ZP_06889657.1| OmpA domain protein transmembrane region-containing protein
           [Methylosinus trichosporium OB3b]
 gi|296254773|gb|EFH01884.1| OmpA domain protein transmembrane region-containing protein
           [Methylosinus trichosporium OB3b]
          Length = 248

 Score = 71.6 bits (174), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 36/160 (22%), Positives = 54/160 (33%), Gaps = 27/160 (16%)

Query: 51  HDFNGPYAGLSALYNGSFGEEAHHN--------AGGSIFAGYNVE-DSCIMYGVEGDVRY 101
             + G Y G  A      G   +            G    GYN      ++ G+E D  Y
Sbjct: 41  FSWRGFYLGGFAGALLGDGTFTYFEQTPMRGAALVGGGTIGYNWMWTPTLLVGIEADFGY 100

Query: 102 TVPVLADNIH------SLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGE-- 153
              V ++ ++      +  G+ G+ R R GY  +   L YAT G      +         
Sbjct: 101 RGQVYSERVNRVYPGPTDGGVLGTARARLGYAFAPRWLSYATAGFAYGTDFPPRGFTSTM 160

Query: 154 ---------ITPIAIGGTAGVGVEVGGLSESLVARLEYRA 184
                     T +  G TAG GVE    S+ +  + EY  
Sbjct: 161 PLTFGVQNTGTTVRAGWTAGAGVEY-AWSDLISVKAEYLY 199


>gi|217979538|ref|YP_002363685.1| putative outer-membrane immunogenic protein precursor [Methylocella
           silvestris BL2]
 gi|217504914|gb|ACK52323.1| putative outer-membrane immunogenic protein precursor [Methylocella
           silvestris BL2]
          Length = 200

 Score = 71.6 bits (174), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 38/145 (26%), Positives = 55/145 (37%), Gaps = 22/145 (15%)

Query: 39  PTIATNRYVPIRHDFNGPYAGLSALYNGSFGEEAHHNAGG-----------SIFAGYNVE 87
           P  A     P    + G YAG++    G   E A ++  G               GYN +
Sbjct: 35  PKEAPLYTPPPEFSWTGFYAGVNIG-GGLSAENAFNSFSGINASRAGGVVGGGQVGYNYQ 93

Query: 88  -DSCIMYGVEGDVRYTVPVLADNI----HSLHGIGGSLRIRGGYEVSDS-LLLYATVGPD 141
                + G+E +   +    ++N     H      G+ R R G+ V D  LL+Y T G  
Sbjct: 94  LTPLFVVGIENEFLGSSISTSNNDWNRPHVTVPFFGTARGRAGFTVFDPHLLVYGTGGLA 153

Query: 142 VAQKYETGKAGEITPIAIGGTAGVG 166
             Q  + G    I  + IG TAG G
Sbjct: 154 FGQVNDAG----INKLRIGWTAGSG 174


>gi|91978029|ref|YP_570688.1| carbohydrate-selective porin OprB [Rhodopseudomonas palustris
           BisB5]
 gi|91684485|gb|ABE40787.1| Carbohydrate-selective porin OprB [Rhodopseudomonas palustris
           BisB5]
          Length = 724

 Score = 71.6 bits (174), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 50/230 (21%), Positives = 78/230 (33%), Gaps = 55/230 (23%)

Query: 27  VRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSFGE---------------E 71
           V      G G+V         P   D+NG Y G    Y     +               +
Sbjct: 69  VVTTPAAGGGIVVKAPAAG-GPAVFDWNGFYIGGHFSYVAGRSDWTAQPAGVSGTIDLFD 127

Query: 72  AHHNAGG------SIFAGYNVEDSC-IMYGVEGDVRYTVPVLA-----------DNIHSL 113
           A     G       + AGYNV      + G+E D+     +                   
Sbjct: 128 AFDAFKGTGSYTLGLQAGYNVLLPSRWLLGLEADLTSPNRIGGNASISPPTGTIGGHDHQ 187

Query: 114 HGIGGSLRIRGGYEVSDSLLLYATVGPDVA----QKYETGKAGEITPIA--IGGTAGVGV 167
             + G++R R GY + D  L YAT G   +    +      A E T +   +G  AG GV
Sbjct: 188 TQLAGTVRGRLGYAL-DGWLPYATAGFAWSYDRLRWPSEAAATEETALLWRLGWAAGAGV 246

Query: 168 EVGGLSESLVARLEYRASKYSK-------------VEGFYNTISLGVGMK 204
           E+  LS +  AR+EY A+ + +              +   + + LG+  +
Sbjct: 247 ELP-LSPAWTARVEYLATGFGRDTARFPIAGHQIESDALIHAVRLGLNYR 295


>gi|323139011|ref|ZP_08074071.1| porin [Methylocystis sp. ATCC 49242]
 gi|322395765|gb|EFX98306.1| porin [Methylocystis sp. ATCC 49242]
          Length = 291

 Score = 71.2 bits (173), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 47/259 (18%), Positives = 75/259 (28%), Gaps = 79/259 (30%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K+  +V V +L   S   A AAD   R                  P    + G Y GL
Sbjct: 1   MRKIAFSVAVLALTAGS---ALAADLPSRK---------EAPVYVPPPPPPMWVGFYVGL 48

Query: 61  SALYNGSFGEEA-------------------------------HHNAGGSIFAGYNVED- 88
           +A    +    +                               +    G    GYN +  
Sbjct: 49  NAGGTWAASTNSASDAWGLANGGTPIHGWVAAASAASWQNGGNNSGFIGGGQIGYNWQFM 108

Query: 89  SCIMYGVEGDVRY--------------------TVPVLADNIHSLHGIGGSLRIRGGYEV 128
           +  + GVE D++                     T  V   N  S     G++R R G+  
Sbjct: 109 NSFIAGVEADIQGVAGNSPNRDIFGSSFDPISGTNIVTFGNRSSRLDYLGTVRGRLGWLF 168

Query: 129 SDSLLLYATVGPDVAQKYETG--------------KAGEITPIAIGGTAGVGVEVGGLSE 174
           + ++L+Y T G        +                +       +G TAG G+E      
Sbjct: 169 TPTMLVYGTGGLAYGGVSTSATFVTSEIGFPFNSVASASFADTRVGWTAGGGIE-WMFMP 227

Query: 175 SLVARLEYRASKYSKVEGF 193
           +  A++EY       V   
Sbjct: 228 NWSAKVEYLYYDLGTVSAT 246


>gi|299135509|ref|ZP_07028695.1| OmpA domain protein transmembrane region-containing protein [Afipia
           sp. 1NLS2]
 gi|298589733|gb|EFI49942.1| OmpA domain protein transmembrane region-containing protein [Afipia
           sp. 1NLS2]
          Length = 229

 Score = 71.2 bits (173), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 39/230 (16%), Positives = 71/230 (30%), Gaps = 43/230 (18%)

Query: 8   VGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSAL---- 63
           +  +++A  S  S  AAD   R +              YV   +++ G Y G        
Sbjct: 1   LLAATVAALSSTSVFAADLAARHYTK---------APAYVAPIYNWTGFYIGAQVGGAFQ 51

Query: 64  -------YNGSFGEEAHHNAGGSIFAGYNVED-SCIMYGVEGDVRYTV-------PVLAD 108
                    G  G     +  G    G N +     + G+EG+               A+
Sbjct: 52  GSSGYNATAGVVGTRDDSSFIGGGVVGANYQFAPNWVVGLEGEFNGLSNNRHTFTDATAN 111

Query: 109 NIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQ--KYETGKAGEITPIAIGGTAGVG 166
            +   +    S+  R GY      ++YA  G          +     +     G T G G
Sbjct: 112 TVSIKNDWLASVTGRLGYTW-GPGMIYAKGGVAFRDNGGVTSNVVALVDRNDTGYTVGAG 170

Query: 167 VEVGGLSESLVARLEYRASKY-----------SKVEGFYNTISLGVGMKF 205
           +E    + +  A++EY+   +           +      +T+  G+   F
Sbjct: 171 LEY-MFAPAWSAKVEYQYYNFDHTNVAFATNTASYRDDLHTVKAGINYHF 219


>gi|85714944|ref|ZP_01045929.1| outer membrane autotransporter barrel protein [Nitrobacter sp.
           Nb-311A]
 gi|85698141|gb|EAQ36013.1| outer membrane autotransporter barrel protein [Nitrobacter sp.
           Nb-311A]
          Length = 654

 Score = 70.8 bits (172), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 29/181 (16%), Positives = 50/181 (27%), Gaps = 43/181 (23%)

Query: 51  HDFNGPYAGLSALYN-----------GSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDV 99
           +++ G Y G SA              G+     +    G    GY+ +    + G+EG +
Sbjct: 432 YNWTGLYIGASAGVLNGRNDWSFPGLGTRTNPRYAGFAGGGQIGYDWQIGTWVVGLEGSL 491

Query: 100 RYTVPVLADNI--------HSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGK- 150
             +    A +          +     G+   + GY + +  L+Y   G            
Sbjct: 492 MGSNARGARSCPNALFYTCENEMNWLGTATAKLGYTIWNRSLVYLRGGAAFGNTRIVTNC 551

Query: 151 ----------------------AGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYS 188
                                     +  A G T G+G E   L+ S   R E       
Sbjct: 552 NTGPDRGYIDYSIPAVIAQPGCGANSSKTAAGWTVGLGTEF-ALTRSWTVRAESNYFDLG 610

Query: 189 K 189
            
Sbjct: 611 T 611


>gi|86749852|ref|YP_486348.1| hypothetical protein RPB_2735 [Rhodopseudomonas palustris HaA2]
 gi|86572880|gb|ABD07437.1| conserved hypothetical protein [Rhodopseudomonas palustris HaA2]
          Length = 570

 Score = 70.5 bits (171), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 44/220 (20%), Positives = 69/220 (31%), Gaps = 55/220 (25%)

Query: 10  VSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSFG 69
           +S+  L    ++QAAD  R          P             + G Y G      G   
Sbjct: 8   LSAALLTPSGTSQAADLAR----------PAAPLAG---AVWTWTGFYVGAHLG-AGFGT 53

Query: 70  EEAHHNAGGSIF--------------AGYNVEDSC--IMYGVEGD------------VRY 101
            +  +  G SI+              AGYN +      + G+E D            + Y
Sbjct: 54  VKVDNPYGPSIYGDTIRVPKALAGLQAGYNWQVPGSPWVLGIELDASALDADGTDTCLAY 113

Query: 102 TVPVLADNIHSLHGIGGSLRIRGG--YEVSDSLLLYATVGPDV----------AQKYETG 149
           +   ++ N        G++  R G  +      L Y   G  V          A  Y   
Sbjct: 114 SGQFVSANCRVREHALGTVTGRIGRVFGPQGRSLAYLKGGAAVLAGDLTMTTNAVDYLNQ 173

Query: 150 KAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSK 189
            A ++     G T G G+E  GLS     + EY  + + +
Sbjct: 174 PAAKLDATRWGWTVGAGLEY-GLSSGWTVKAEYDYAAFGR 212


>gi|254510731|ref|ZP_05122798.1| conserved hypothetical protein [Rhodobacteraceae bacterium KLH11]
 gi|221534442|gb|EEE37430.1| conserved hypothetical protein [Rhodobacteraceae bacterium KLH11]
          Length = 228

 Score = 70.5 bits (171), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 33/173 (19%), Positives = 58/173 (33%), Gaps = 18/173 (10%)

Query: 41  IATNRYVPIRHDFNGPYAGLSALY---NGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEG 97
            A         ++ G Y G    Y   + +          G I  GY+ +    + G   
Sbjct: 66  AAGPALAQSSGNWTGFYGGAQIGYADIDTNVSGVDGDGLIGGIILGYDYDLGDWVVGGGF 125

Query: 98  DVRYTVPVLADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPI 157
           D  ++   L+            ++ R GY+V+   LLY T G   A   +T   G     
Sbjct: 126 DYDWSDVDLSSAATVESVWR--IKARAGYKVNPQGLLYGTAGYADA---DTDNLGSD--- 177

Query: 158 AIGGTAGVGVEVGGLSESLVARLEYRASKYSK-----VEGFYNTISLGVGMKF 205
             G   G G E   ++ ++    E    ++       V+    T+ + V  +F
Sbjct: 178 -NGWFIGAGYE-QIVAPNISVGGELLYHEFDDFNSTGVDVDATTLQVRVAYRF 228


>gi|163849581|ref|YP_001637624.1| porin [Methylobacterium extorquens PA1]
 gi|163661186|gb|ABY28553.1| porin [Methylobacterium extorquens PA1]
          Length = 283

 Score = 70.5 bits (171), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 48/252 (19%), Positives = 76/252 (30%), Gaps = 73/252 (28%)

Query: 4   LFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSAL 63
           +   V   S A     +A AAD  +R        +P             ++G YAG++A 
Sbjct: 1   MLKTVLARSAAAFVSTAAVAADLPQREQTPVFAQIPA----------FTWSGFYAGIAAG 50

Query: 64  Y----------------------NGSFGEEAHHNAGGSIFA--GYNVED---SCIMYGVE 96
           Y                         FG       G ++    GYN +    +  + G+E
Sbjct: 51  YAFSGRQTVRTTDFTPIGQAVLAASGFGAVRSEQEGATVAGGFGYNYQFTPGTGFVAGIE 110

Query: 97  GDVRYTVPVLADNIHSLHG-------------IGGSLRIRGGYEVSDSLLLYATVGPDVA 143
            D++YT    +    +  G               G++R R GY   + +L+Y T G    
Sbjct: 111 TDIQYTDLDSSRATSASVGGTTFFLSGRQSLNFLGTVRGRLGYAF-NRVLVYGTGGFAYG 169

Query: 144 Q-------------KYETGKAGEITPIAIGGTAGVGVEVGGLSES---------LVARLE 181
                               AG    +  G   G GVE    +ES         ++ + E
Sbjct: 170 NVNYEINANVTSALGTIPFDAGRFNNVETGYVYGGGVEYAMPTESFLNFFSANAVIIKAE 229

Query: 182 YRASKYSKVEGF 193
           Y          F
Sbjct: 230 YLHYDLGSRSVF 241


>gi|296447975|ref|ZP_06889882.1| porin [Methylosinus trichosporium OB3b]
 gi|296254542|gb|EFH01662.1| porin [Methylosinus trichosporium OB3b]
          Length = 308

 Score = 70.5 bits (171), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 45/234 (19%), Positives = 63/234 (26%), Gaps = 74/234 (31%)

Query: 32  HGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGS------------------FGEEAH 73
           H     +P+IA     P    + G Y G +  Y                     FG  + 
Sbjct: 18  HAVAADLPSIAPPPPPPPVFSWTGAYLGANGGYIWGARNGVDSYGVAVIDKDPLFGATSA 77

Query: 74  HNAG-----------GSIFAGYNVE-DSCIMYGVEGDVRYTVPVLADN------------ 109
              G           G   AGYN +     + GVEGDV+ T    ++             
Sbjct: 78  LGVGNVAAPNLNGAFGGGQAGYNYQVSPRFVIGVEGDVQGTAVQGSEGRYRLLTVPNLPR 137

Query: 110 --------IHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQ--------------KYE 147
                   +        ++R R G+ V    LLY T G    +                 
Sbjct: 138 YSIGTQTQVDRNIDYLATVRGRVGFAVLPDALLYLTGGLAFGRVSQRVTQTQSVYWAGST 197

Query: 148 TGKAGEI---------TPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEG 192
              A                +G  AG GVE      +  A+LEY       V  
Sbjct: 198 NFPADSDGFGFAASQFAQTRVGWAAGGGVE-WAFRGNWSAKLEYLYYDLGGVRS 250


>gi|209885046|ref|YP_002288903.1| hypothetical protein OCAR_5916 [Oligotropha carboxidovorans OM5]
 gi|209873242|gb|ACI93038.1| conserved hypothetical protein [Oligotropha carboxidovorans OM5]
          Length = 574

 Score = 70.1 bits (170), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 42/217 (19%), Positives = 69/217 (31%), Gaps = 46/217 (21%)

Query: 15  LASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSFGEEAHH 74
            A  C A +A            VVP  A+    P+  ++ G Y G      G    +  +
Sbjct: 11  TALACLAVSALAFTNVEAREARVVPVSAS----PVLWNWTGFYLGAHLG-AGFGTSKVDN 65

Query: 75  NAGGSIF--------------AGYNVEDSC--IMYGVEGDVR------------YTVPVL 106
             G SI+               GYN + +    ++GVE DV             Y+   +
Sbjct: 66  PYGPSIYGDTIRLPGGFAGLQGGYNWQGAGSPWVFGVEADVSAVNADGTNTCLAYSGQFV 125

Query: 107 ADNIHSLHGIGGSLRIRGGYEVSD--SLLLYATVGPDVAQK----------YETGKAGEI 154
           + N  +     GS+  R G  +S     L Y   G                Y    + E 
Sbjct: 126 SANCRARQQAMGSITGRIGRTISPDGRTLAYIKGGTAFMSGDLSLTTNAPDYILQPSSER 185

Query: 155 TPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVE 191
                G   G G+E   ++ +   + EY  + +   +
Sbjct: 186 RDTRWGWMLGAGLE-HAITGAWSVKAEYAYANFGHRD 221


>gi|159185257|ref|NP_355480.2| outer membrane protein [Agrobacterium tumefaciens str. C58]
 gi|159140518|gb|AAK88265.2| outer membrane protein [Agrobacterium tumefaciens str. C58]
          Length = 209

 Score = 70.1 bits (170), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 40/219 (18%), Positives = 66/219 (30%), Gaps = 24/219 (10%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M  +  ++   ++A+A   +A +AD                           ++G Y G 
Sbjct: 1   MSIIKKSLAAVTIAVAIASNAYSADLTNYNTQQSFDYGNQ--------PAFSWSGAYVGA 52

Query: 61  SALYNGSFGEEAHHNAG--GSIFAGYNVEDSCIMYGVEGDVRY-TVPVLADNIHSLHGIG 117
                           G  G + AGYN +    + G E +  Y        N        
Sbjct: 53  HGGVASPKFSPLASGRGLTGGVQAGYNFQFGSGVVGAEVEGSYLGNDARVPNGRLRERFR 112

Query: 118 GSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLV 177
           G+ +++ G  + D  LLY T G    +  +            G   G GVE       L 
Sbjct: 113 GAAKLKAGVAL-DHTLLYGTAGLTTTKFKDGNGVTGPDGWKQGYLVGAGVE-QSFGGGLS 170

Query: 178 ARLEYRASKYSKV-----------EGFYNTISLGVGMKF 205
           A+ EY       V           +   + I  G+  +F
Sbjct: 171 AKFEYNYVSTGNVATTTSSGRSKTDVSDHVIKAGLNYRF 209


>gi|192291529|ref|YP_001992134.1| OmpA domain protein transmembrane region-containing protein
           [Rhodopseudomonas palustris TIE-1]
 gi|192285278|gb|ACF01659.1| OmpA domain protein transmembrane region-containing protein
           [Rhodopseudomonas palustris TIE-1]
          Length = 246

 Score = 69.7 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 40/195 (20%), Positives = 62/195 (31%), Gaps = 36/195 (18%)

Query: 39  PTIATNRYVPIRHDFNGPYAGLSALYNGSF----------------GEEAHHNAGG--SI 80
           P       +   +D++G Y G +  +  S                 GE  H  +GG    
Sbjct: 28  PYTKAPPIIAAAYDWSGFYVGANGGWGTSRNCWDYLGTTATPAVALGEGCHDASGGTAGG 87

Query: 81  FAGYNVEDSCIMYGVEGDVRYTVPVLAD---------NIHSLHGIGGSLRIRGGYEVSDS 131
            AGYN + S  ++GVE    +     ++            S     G    R GY   ++
Sbjct: 88  QAGYNWQISNWVFGVEAQGNWADFKGSNVSLLVVPGTTNDSKIDAFGLFTARVGYAW-NN 146

Query: 132 LLLYATVGPDVAQKYET-------GKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRA 184
            LLY   G  V     T             +    G   G G+E  G S +    +EY  
Sbjct: 147 ALLYVKGGAAVTSDKYTVYGNRTGAITDTASETRWGAAVGGGLEY-GFSPAWTFGVEYDH 205

Query: 185 SKYSKVEGFYNTISL 199
                 +  + T S+
Sbjct: 206 LFMGSRDITFATTSI 220


>gi|312114480|ref|YP_004012076.1| porin [Rhodomicrobium vannielii ATCC 17100]
 gi|311219609|gb|ADP70977.1| porin [Rhodomicrobium vannielii ATCC 17100]
          Length = 288

 Score = 69.7 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 40/247 (16%), Positives = 67/247 (27%), Gaps = 72/247 (29%)

Query: 3   KLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSA 62
            L      S++AL +              +      P++     + +   + G Y G   
Sbjct: 2   TLTKFALASTVALGTLAI-------AAQANAADIYTPSMKDAPIIVVPPTWTGFYFGGHL 54

Query: 63  LYNGSFGEEAHHN-------------------------AGGSIFAGYNVEDS-CIMYGVE 96
               +  E   +                           GG  F GYN +     + G+E
Sbjct: 55  GAAWTQLETRKNEYWDGYDDSDLSFATFGGKNLNDQSAFGGGQF-GYNWQTGGNFVLGIE 113

Query: 97  GDVR--------------YTVPVLAD-------NIHSLHGIGGSLRIRGGYEVSDSLLLY 135
            D+               Y     +        N+ S  G  G +  R GY   ++ LLY
Sbjct: 114 VDIGGLGSDNERTFLATTYNDVTFSSAYSTAVVNVKSEGGFYGDVTGRLGYAWGNT-LLY 172

Query: 136 ATVGPDVAQKYET---------------GKAGEITPIAIGGTAGVGVEVGGLSESLVARL 180
           A  G    Q                     +        G T G G+E   L+ +   ++
Sbjct: 173 AKGGFAWIQPELKVRTVVSIDDDPNGTYTSSHTYDDTLTGWTIGGGLEFL-LNPNWSVKV 231

Query: 181 EYRASKY 187
           EY    +
Sbjct: 232 EYLHYDF 238


>gi|146340933|ref|YP_001205981.1| putative outer-membrane protein [Bradyrhizobium sp. ORS278]
 gi|146193739|emb|CAL77756.1| putative outer-membrane protein; putative secreted protein
           [Bradyrhizobium sp. ORS278]
          Length = 251

 Score = 69.7 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 47/233 (20%), Positives = 83/233 (35%), Gaps = 46/233 (19%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M++L   +G ++        A AAD   R      G++ TI         +D++G Y GL
Sbjct: 1   MRRL--LLGATTSLALGLAPAIAADLPARTFTKAPGMIATI---------YDWSGFYLGL 49

Query: 61  SALYNGSFGEEAHHNAGGSIFA------------------GYNVEDSCIMYGVEGDVRYT 102
           +A    +     ++   G + A                  GY  +    ++GVEG   + 
Sbjct: 50  NAGGGSARTCWTNNVTVGGVAATNAEGCHDATGALAGGQIGYRWQAGSWVFGVEGQGNWA 109

Query: 103 VPVLAD------NIHSLHGIGGS--LRIRGGYEVSDSLLLYATVGPDVAQKYETG----- 149
               ++       + +   + G   L  + GY   +++L Y   G  VA +   G     
Sbjct: 110 NLKGSNTSQLAPAVTNQTKVNGVGLLTGQIGYAW-NNVLWYVKGGAAVAGEKYNGLATAT 168

Query: 150 --KAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFYNTISLG 200
                + +    G T G GVEV G +++     EY           ++ I  G
Sbjct: 169 GTAFDQASATRWGATVGTGVEV-GFAKNWSVGAEYEHIFMGNKNLNFSGIPAG 220


>gi|92117214|ref|YP_576943.1| OmpA-like transmembrane region [Nitrobacter hamburgensis X14]
 gi|91800108|gb|ABE62483.1| OmpA-like transmembrane region [Nitrobacter hamburgensis X14]
          Length = 238

 Score = 69.7 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 39/204 (19%), Positives = 65/204 (31%), Gaps = 38/204 (18%)

Query: 38  VPTIATNRYVPIR--HDFNGPYAGLSALYNGSFGEEAHHNAG---GSIFAGYNVED-SCI 91
             T A   Y P +  +++ G Y G               + G   G +  G + +  +  
Sbjct: 27  PYTKAPPPYTPPQAVYNWTGFYIGGHLGGAFGGDSSLSGSDGRFLGGVQGGADYQFANNW 86

Query: 92  MYGVEGDVRYTVPVLADNIHSLHGIG-------GSLRIRGGYEVSDSLLLYATVGPDV-- 142
           + G E    +        +     I        GS+  R GY      LLYA  G     
Sbjct: 87  VLGAEAQYSWLTNNNGGAVFPGGNIVTGNDRGLGSVTGRLGYAW-GPTLLYAKGGYAFRD 145

Query: 143 AQKYETGKAGEITPIA------IGGTAGVGVEVGGLSESLVARLEYRASKYSKV------ 190
           ++   T  AG     A       G T G G+E    + +  A++EY+   + K       
Sbjct: 146 SRLGVTDAAGVPLAFATTGNRDNGYTVGAGLEY-MFAPNWSAKVEYQYYNFGKTTFAAGS 204

Query: 191 ---------EGFYNTISLGVGMKF 205
                        +T+  G+  +F
Sbjct: 205 PTDIVGTSFRNDDHTVKAGLNYRF 228


>gi|323137744|ref|ZP_08072820.1| porin [Methylocystis sp. ATCC 49242]
 gi|322397041|gb|EFX99566.1| porin [Methylocystis sp. ATCC 49242]
          Length = 506

 Score = 69.3 bits (168), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 45/217 (20%), Positives = 69/217 (31%), Gaps = 39/217 (17%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+KL   V  ++L+      A AA+               + T+ Y+     F G     
Sbjct: 1   MRKLAPIVVFTALSF----PAFAAEAPSEEDAPPAAPPRPLWTSFYIGFNRGFGGGVLDS 56

Query: 61  SALY--------NGSFGEEAHHNAGGSIFAGYNVEDSC-IMYGVEGDVRYTV-------- 103
              +          +               GY    +   + G+E D +++         
Sbjct: 57  DVGFVSAVPGLSTATTTTNRASGFIAGGQFGYTYSFANHFVLGLESDFQWSDMRSSHQAT 116

Query: 104 -------PVLADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETG------- 149
                   +   +IHS     GS R R GY V   LL Y T G    Q   +G       
Sbjct: 117 TFATNPALITNADIHSGIDWFGSTRARAGYSV-GRLLPYVTGGVAYGQVQSSGVQFLGSG 175

Query: 150 --KAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRA 184
               G  T   +G   G G+E   L+ +L A+ EY  
Sbjct: 176 LATTGSRTNTRVGWAMGGGIEF-ALNSNLSAKAEYLY 211



 Score = 69.3 bits (168), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 38/186 (20%), Positives = 56/186 (30%), Gaps = 44/186 (23%)

Query: 49  IRHDFNGPYA--------------------GLSALYNGSFGEEAHHNAGGSIFAGYNVE- 87
             +D+ G Y                     G   L   +          G    GYN + 
Sbjct: 276 PSYDWTGFYVGINGGYGGGVVTGSTTFVQPGAPGLAETTTASNRTAGYVGGAQGGYNYQL 335

Query: 88  DSCIMYGVEGDVRYTVPVLA--------------DNIHSLHGIGGSLRIRGGYEVSDSLL 133
              I+ GVE D +++                    N  +     G+ R+R GY  S + L
Sbjct: 336 TKNIVVGVETDAQWSDVKAQHQAATIGGPLGFVYTNTPNDVSWFGTTRLRAGYA-SGNAL 394

Query: 134 LYATVGPD-------VAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASK 186
            Y T G          +Q       G  +    G   G G     L+++L  R EY    
Sbjct: 395 SYVTGGVAYGEVNAHGSQISGGVFGGSASQNKAGWALGGGAMY-ALTKNLSMRAEYLYVS 453

Query: 187 YSKVEG 192
           +S V G
Sbjct: 454 FSGVSG 459


>gi|116254616|ref|YP_770452.1| putative outer-membrane immunogenic protein precursor [Rhizobium
           leguminosarum bv. viciae 3841]
 gi|115259264|emb|CAK10397.1| putative outer-membrane immunogenic protein precursor [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 226

 Score = 69.3 bits (168), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 45/226 (19%), Positives = 76/226 (33%), Gaps = 34/226 (15%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           +++   +VGVS L      +A  AD            VP+  +    P    + G YAGL
Sbjct: 14  IKRKIFSVGVSMLMACGASAADLAD----------HSVPSAPS-YDAPGTFSWAGAYAGL 62

Query: 61  SALYNGSFGEEAHHNAGGSIFA--GYNVEDSCIMYGVEGDVRY-TVPVLADNIHSLHGIG 117
                 S     ++    ++ A  GYN +    ++G E +  Y    V     +      
Sbjct: 63  HGGVAASKFNPFNNGRAPAVGAQVGYNFQAGSGVFGAELEGSYLNNEVRVPVGNVESRFR 122

Query: 118 GSLRIRGGYEVSDSLLLYATVGPDVAQKY---ETGKAGE----ITPIAIGGTAGVGVEVG 170
           G+ + + G    D   +Y T G    +         + +          G   G GVE  
Sbjct: 123 GAAKAKAGLGF-DRTFVYGTAGVTTTEFEGHRLVSGSDKWKSGPDSWKHGYLFGGGVE-H 180

Query: 171 GLSESLVARLEYRAS-----------KYSKVEGFYNTISLGVGMKF 205
             S  + A++EY                S+ +   N I  G+  +F
Sbjct: 181 AFSGGVSAKIEYNYVINNAVPTTSGGISSRSDLNDNVIEAGLNFRF 226


>gi|312113978|ref|YP_004011574.1| outer-membrane immunogenic protein precursor; secreted protein
           [Rhodomicrobium vannielii ATCC 17100]
 gi|311219107|gb|ADP70475.1| putative outer-membrane immunogenic protein precursor; putative
           secreted protein [Rhodomicrobium vannielii ATCC 17100]
          Length = 243

 Score = 69.3 bits (168), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 49/219 (22%), Positives = 75/219 (34%), Gaps = 41/219 (18%)

Query: 5   FLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALY 64
              + V +L +A+     A D  + A  G +          YV +  ++ G Y G +  Y
Sbjct: 4   KAILTVVTLTVAATGGVNATDIAKSAPGGLKDAP-------YVEVPWNWAGAYYGATIGY 56

Query: 65  NGSFGEEAH-------------HNAGGSIFA---GYNVE-DSCIMYGVEGDVRYTVPVLA 107
            GS G +A              ++  G +     GYN +     + G E D  +      
Sbjct: 57  -GSGGSKASVTANANDEHGVDTNDPDGVLLGGTIGYNYQIAPTWLIGAEADFSWLGLQGD 115

Query: 108 ------DNIHSLHGIGG--SLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPI-- 157
                 D  +   G  G  +LR R GY +    L+Y T G       ET           
Sbjct: 116 QGKAVFDGHYWTGGWDGLFTLRGRLGYTM-GRTLIYGTAGYAALHTNETISGNNTNESSF 174

Query: 158 ----AIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEG 192
                 G   G GVE   L+E L  + EY  + +  + G
Sbjct: 175 GTDWRSGWVVGGGVE-HFLTERLSVKAEYLHAGFEDLTG 212


>gi|146343440|ref|YP_001208488.1| putative outer-membrane immunogenic protein [Bradyrhizobium sp.
           ORS278]
 gi|146196246|emb|CAL80273.1| conserved hypothetical protein; putative outer-membrane immunogenic
           protein precursor; putative secreted protein
           [Bradyrhizobium sp. ORS278]
          Length = 242

 Score = 69.3 bits (168), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 37/210 (17%), Positives = 59/210 (28%), Gaps = 39/210 (18%)

Query: 33  GGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGS---------FGEEAHHNAGGSIFAG 83
           G R          YV   +++ G Y G       S          G  ++    G + AG
Sbjct: 25  GARSYPYATKAPAYVAPIYNWTGFYLGAHLGGAFSSDNNFSGLGTGNNSNGRFLGGVQAG 84

Query: 84  YNVED-SCIMYGVEGDVRYTVPVLADNIHSLHGIG------GSLRIRGGYEVSDSLLLYA 136
            + +     + G EG   +    +       +         GS+  R GY      LLY 
Sbjct: 85  ADWQFAPTWVIGAEGQYSWLSGSVGAAFPGGYVYNNSQRGLGSITGRVGYTW-GPGLLYV 143

Query: 137 TVGPDVAQKYET-------GKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSK 189
             G   +   E                   G T G G+E    + +  A+ EY+   +  
Sbjct: 144 KGGYAYSDNNEKVTLAGNQVGFATSGDHRNGWTVGGGIEY-MFAPNWSAKAEYQYYNFGS 202

Query: 190 V--------------EGFYNTISLGVGMKF 205
                              +T   GV  +F
Sbjct: 203 ATFAAPAALVPTGSFTTDDHTFKAGVNYRF 232


>gi|85714675|ref|ZP_01045662.1| possible outer membrane protein [Nitrobacter sp. Nb-311A]
 gi|85698560|gb|EAQ36430.1| possible outer membrane protein [Nitrobacter sp. Nb-311A]
          Length = 222

 Score = 68.9 bits (167), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 33/176 (18%), Positives = 56/176 (31%), Gaps = 28/176 (15%)

Query: 51  HDFNGPYAGL----------SALYNGSFGEEAHHNAGGSIFAGYNVE-DSCIMYGVEGDV 99
           +++ G Y G           +    G           G +  GY+ +     ++G+E   
Sbjct: 41  YNWTGFYLGGHIGGAFGGANNIFAPGVAFNNNDGVFMGGVQVGYDTQFSPNWVFGLEA-- 98

Query: 100 RYTVPVLADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAI 159
                 L       +   GS+  R GY      LLY   G   A    T   G       
Sbjct: 99  --NYSFLDTGSFFANRGLGSVTGRLGYTW-GPALLYVKGGYGWADSRFTNGFGGNGGRDG 155

Query: 160 GGTAGVGVEVGGLSESLVARLEYRASKYSKV----------EGFYNTISLGVGMKF 205
             T G G+E    +++   ++EY+      V              +TI +G+  +F
Sbjct: 156 -YTVGGGLEYL-FTQNWSGKVEYQYYDLGTVNLVAPVVANFRNDQHTIKVGLNYRF 209


>gi|323138453|ref|ZP_08073522.1| porin [Methylocystis sp. ATCC 49242]
 gi|322396249|gb|EFX98781.1| porin [Methylocystis sp. ATCC 49242]
          Length = 502

 Score = 68.9 bits (167), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 42/217 (19%), Positives = 68/217 (31%), Gaps = 49/217 (22%)

Query: 21  AQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNG-------------- 66
           + AA P          +    +     P    + G + G +  + G              
Sbjct: 8   SFAALPTIALSAQAADLPAQKSPPPAPPPVFSWTGFHLGFNRGFGGAVSEARVALAAPGL 67

Query: 67  ------SFGEEAHHNAGGSIFAGYNVEDSC-IMYGVEGDVRYTVPVLA------------ 107
                 +F + +    GG I  GY+ +    ++ GVE D++++    +            
Sbjct: 68  GGTATRTFDQASGWFVGGQI--GYDYQFENGVVLGVETDMQWSDIRSSHQATTIASNPLL 125

Query: 108 ---DNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGK---------AGEIT 155
               +        G+ R R GY     +L Y T G    Q    G           G   
Sbjct: 126 LTNADTSHSLDWFGTTRGRVGYSF-GRMLPYLTGGVAYGQVEARGAQALAAGLVSVGGAR 184

Query: 156 PIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEG 192
              +G  AG G++   LS  L AR EY   +   V G
Sbjct: 185 ETNVGWAAGAGLDF-ALSPRLSARAEYLYLQLPGVSG 220



 Score = 48.5 bits (114), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 25/125 (20%), Positives = 39/125 (31%), Gaps = 23/125 (18%)

Query: 89  SCIMYGVEGDVRYTV--------------PVLADNIHSLHGIGGSLRIRGGYEVSDSLLL 134
              + GVE D +++                 +  +  +     G+ R R G       L 
Sbjct: 336 DRFVVGVETDAQWSGVQAWHQATTVGGPNGYVFTDTPNAMTWFGTTRARLGLA-RGYSLS 394

Query: 135 YATVGPD-------VAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKY 187
           Y T G           Q       G      +G T G G E   L+ +L  R +Y    +
Sbjct: 395 YVTGGVAYGEITASGTQAAGALFTGAGARSQVGWTVGSGTEY-ALAPNLSLRADYLYVSF 453

Query: 188 SKVEG 192
           + V G
Sbjct: 454 AGVSG 458


>gi|85713860|ref|ZP_01044849.1| possible outer membrane protein [Nitrobacter sp. Nb-311A]
 gi|85698986|gb|EAQ36854.1| possible outer membrane protein [Nitrobacter sp. Nb-311A]
          Length = 224

 Score = 68.9 bits (167), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 32/176 (18%), Positives = 56/176 (31%), Gaps = 28/176 (15%)

Query: 51  HDFNGPYAGL----------SALYNGSFGEEAHHNAGGSIFAGYNVE-DSCIMYGVEGDV 99
           +++ G Y G           +    G           G +  GY+ +     ++G+E   
Sbjct: 43  YNWTGFYLGGHIGGAFGGANNIFAPGVAFNNNDGVFMGGVQVGYDTQFSPNWVFGLEA-- 100

Query: 100 RYTVPVLADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAI 159
                 L       +   GS+  R GY      LLY   G   A    T   G       
Sbjct: 101 --NYSFLDTGSFFANRGLGSVTGRLGYTW-GPALLYVKGGYGWADSRFTNGFGGNGGRDG 157

Query: 160 GGTAGVGVEVGGLSESLVARLEYRASKYSKV----------EGFYNTISLGVGMKF 205
             T G G+E    +++   ++EY+      V              +T+ +G+  +F
Sbjct: 158 -YTVGGGLEYL-FTQNWSGKVEYQYYDLGTVNLVAPVVANFRNDQHTVKVGLNYRF 211


>gi|296445629|ref|ZP_06887584.1| outer membrane protein Omp31 precursor [Methylosinus trichosporium
           OB3b]
 gi|296256874|gb|EFH03946.1| outer membrane protein Omp31 precursor [Methylosinus trichosporium
           OB3b]
          Length = 225

 Score = 68.9 bits (167), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 35/167 (20%), Positives = 57/167 (34%), Gaps = 22/167 (13%)

Query: 48  PIRHDFNGPYAGLSALYNGSFGEEAHHNAGG-------SIFAGYNVEDS-CIMYGVEGDV 99
           P    + G Y G+   Y     ++   +  G        +  GYN       + G+E D 
Sbjct: 38  PPAFTWRGFYVGVHGGYGFGAFQDNGRSLLGEPNGWLVGVTGGYNYTFGPNFLIGLEADF 97

Query: 100 RYTVPVLAD----NIHSLHGIGG--SLRIRGGYEVSDSLLLYATVGPDV------AQKYE 147
            ++           +    G+    +LR R G  + D  L+Y T G              
Sbjct: 98  DFSGGKGGGSPIAGVVGSSGVDNIMTLRPRAGM-IFDRALVYVTGGFAGVVASGTVGNVY 156

Query: 148 TGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFY 194
            G  G+ +    G   G G+E  GL+ +L A+ EY  +       F 
Sbjct: 157 NGFFGQQSQYLSGWALGAGIEY-GLAPNLSAKAEYLFTSVGGERYFE 202


>gi|170751779|ref|YP_001758039.1| porin [Methylobacterium radiotolerans JCM 2831]
 gi|170658301|gb|ACB27356.1| porin [Methylobacterium radiotolerans JCM 2831]
          Length = 279

 Score = 68.9 bits (167), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 47/220 (21%), Positives = 64/220 (29%), Gaps = 58/220 (26%)

Query: 6   LAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYN 65
           L V  +   +A   SA AAD  RRA                      + G Y G++A Y 
Sbjct: 5   LRVTTALAGVAFAGSAFAADLPRRAAPPPVFTP---------VPVFTWTGAYFGINAGYA 55

Query: 66  ------------------------GSFGEEAHHNAGGSIFAGYNVE---DSCIMYGVEGD 98
                                    SF   +     G    GYN +    S ++ GVE D
Sbjct: 56  FDASDRNTGNTFAVPFPYAAPGTVASFRNRSQDGFSGGGQIGYNWQITPGSGVVIGVEAD 115

Query: 99  VRYTVPVLADNIH------------------SLHGIGGSLRIRGGYEVSDSLLLYATVGP 140
            +Y       N                    S     G++R R GY   D  L+Y T G 
Sbjct: 116 AQYLDFGRNRNNAFVSGAVAPGYYLTDPRGLSSLDFFGTVRGRLGYAF-DRTLVYGTGGF 174

Query: 141 DVAQKYETGKAG---EITPIAIGGTAGVGVEVGGLSESLV 177
                      G          G  AG G+E    ++S +
Sbjct: 175 AYGSGSADRSFGGYAGNDSFRTGWAAGGGIEYALPTDSFL 214


>gi|255264610|ref|ZP_05343952.1| putative outer membrane protein [Thalassiobium sp. R2A62]
 gi|255106945|gb|EET49619.1| putative outer membrane protein [Thalassiobium sp. R2A62]
          Length = 207

 Score = 68.5 bits (166), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 45/180 (25%), Positives = 72/180 (40%), Gaps = 17/180 (9%)

Query: 40  TIATNRYVPIRHDFNGPY-------AGLSALYNGSFGEEAHHNAGGSIFAGYNVEDSCIM 92
            +          D++G Y       AG +  Y+     +         F G N + S ++
Sbjct: 30  PVIAIPPTSNVTDWSGSYCGLSYSSAGGTLSYSFGSPYDYVDETAIGGFCGNNWQRSNLV 89

Query: 93  YGVEGDV-RYTVPVLADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKA 151
           YG E +V   ++     N+    G    LR R GY + D  L+Y  +G   ++    G A
Sbjct: 90  YGGELNVTGGSLGHDDINVVGELGTRIELRTRVGYALGD-ALVYGFLGYGRSEITWGGNA 148

Query: 152 GEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKY------SKVEGFYNTISLGVGMKF 205
                +A GGT G+GV+   +++S+ A  E    +         V    N ISL +G KF
Sbjct: 149 PGEYGVA-GGTYGLGVDY-MVTDSMFASFEVSNLELKETVTTGIVTHDINVISLRIGWKF 206


>gi|218533177|ref|YP_002423993.1| porin [Methylobacterium chloromethanicum CM4]
 gi|218525480|gb|ACK86065.1| porin [Methylobacterium chloromethanicum CM4]
          Length = 299

 Score = 68.5 bits (166), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 45/302 (14%), Positives = 74/302 (24%), Gaps = 114/302 (37%)

Query: 10  VSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNG--- 66
           ++ L       A AAD       G     P  A         D++G Y G    Y+    
Sbjct: 6   LALLTTVLVSPALAADLDYGVLRGYDDDYPAPA------PIIDWSGFYVGGHGGYSSAAL 59

Query: 67  SFGE-----------------------------EAHHNAGGSIFAGYNVEDSCIMYGVEG 97
            FG                                   A   +FAG N +   ++ G E 
Sbjct: 60  GFGNAFQPIVANALRYTVAEAEMNASHLLAARATHSGGASYGVFAGVNYQFEDVVVGFEA 119

Query: 98  DVRY----------------------TVPVLADNIHSLHGIGGSLRIRGGYEVSDSLLLY 135
           D  Y                      +   L+    +     G++R R GY   +  L +
Sbjct: 120 DYTYFGQSGTTSDQIARYMITKDNFLSTVNLSGQASTKIQDYGTIRGRLGYAFGN-FLPF 178

Query: 136 ATVGPDVAQKYETGK--------------------------------------------- 150
            T G  + +                                                   
Sbjct: 179 VTGGLALGRATVRDTVTIQDYGYNNTTYAANQTGTTKSYIDNDGYSVFFQNNPPGSIPAP 238

Query: 151 ----AGEITPIAIGGTAGVGVEVGGLSESLVARLEYRA---SKYSKVEGFYNTISLGVGM 203
                        G   G G+E   ++ + + R EY+    + +   +   NT+  G  +
Sbjct: 239 GTVHGTTKKVTVAGIAVGGGLEY-AITPNFLLRGEYQYVLFNDFQGHKAELNTVRGGAAV 297

Query: 204 KF 205
           KF
Sbjct: 298 KF 299


>gi|319405308|emb|CBI78922.1| putative Hemin binding protein b [Bartonella sp. AR 15-3]
          Length = 367

 Score = 68.5 bits (166), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 23/115 (20%), Positives = 39/115 (33%), Gaps = 24/115 (20%)

Query: 113 LHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQ------------KYETGKAGEIT--PIA 158
                G+ RIR G   +  ++ Y   G    +              E   A         
Sbjct: 255 KQKWIGTSRIRLGLS-AGRVMPYIAGGIAYTKIQGTFAKSIKEIGKENTSASSFDSAETM 313

Query: 159 IGGTAGVGVEVGGLSESLVARLEYRASKYSKVE--------GFYNTISLGVGMKF 205
           IG T G G +   +++ ++ R EYR S + + +           N   +G+  KF
Sbjct: 314 IGYTLGGGFDF-AMTDRILLRSEYRYSDFGEKKFNKINLKYYKTNDFRVGLAYKF 367



 Score = 45.8 bits (107), Expect = 0.003,   Method: Composition-based stats.
 Identities = 24/120 (20%), Positives = 40/120 (33%), Gaps = 32/120 (26%)

Query: 10  VSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSF- 68
           VS LA++     QAAD V          VP+   +   P+ + + G Y G       SF 
Sbjct: 3   VSILAISLTSRIQAADIV----------VPSNLKSISAPV-YSWEGFYLGGQMGSFSSFT 51

Query: 69  ------------GEEAHHNAG-------GSIFAGYNVEDSC-IMYGVEGDVRYTVPVLAD 108
                             +         G  FAG+N +     + G++ D+ ++      
Sbjct: 52  TLQYNDIDKTKKWNSIDEDFSSDLSGITGGFFAGFNFDWGNRFVLGIDTDIVFSNKRNTK 111


>gi|209885358|ref|YP_002289215.1| outer-membrane immunogenic protein [Oligotropha carboxidovorans
           OM5]
 gi|209873554|gb|ACI93350.1| outer-membrane immunogenic protein [Oligotropha carboxidovorans
           OM5]
          Length = 173

 Score = 68.5 bits (166), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 32/165 (19%), Positives = 52/165 (31%), Gaps = 23/165 (13%)

Query: 39  PTIATNRYVPIRHDFNGPYAGLSAL--YNGS----------FGEEAHHNAGGSIFAGYNV 86
            T A    V   +++ G Y G      + G+           G     +  G    G N 
Sbjct: 11  YTKAPPAPVAPIYNWTGLYIGAQVGGAFQGNSGFVTDNPLVTGNRDDSSFLGGGVLGANY 70

Query: 87  E-DSCIMYGVEGDVR------YTVPVLADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVG 139
           +     + G+EG+        YT     D I   +    S+  R GY      ++Y   G
Sbjct: 71  QFSPNWVLGIEGEFNGLSNNRYTFTDGFDGIRVKNDWLASVTGRLGYTW-GPGMIYPKGG 129

Query: 140 PDVAQKYETGKAGEI--TPIAIGGTAGVGVEVGGLSESLVARLEY 182
                            +    G T G G+E    + +  A++EY
Sbjct: 130 VAFRDNGGIAATTPFLVSRDTSGYTVGAGLEY-MFAPAWSAKIEY 173


>gi|39936789|ref|NP_949065.1| hypothetical protein RPA3728 [Rhodopseudomonas palustris CGA009]
 gi|39650646|emb|CAE29169.1| conserved unknown protein [Rhodopseudomonas palustris CGA009]
          Length = 670

 Score = 68.5 bits (166), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 44/215 (20%), Positives = 66/215 (30%), Gaps = 55/215 (25%)

Query: 43  TNRYVPIRHDFNGPYAGLSALYNGSFGEEAHHNAGG---------------------SIF 81
                    D++G Y G            +   AGG                      + 
Sbjct: 29  APEAPRAVFDWSGFYIGAHFSAVAGHSNWSSTPAGGSGSIDLFDAFQLFKGTGSYVIGLQ 88

Query: 82  AGYNVEDSC-IMYGVEGDVR-------YTVPVLADNIHSLHG----IGGSLRIRGGYEVS 129
           AGYN       + G+E D+         T   L       H     +GG++R R GY   
Sbjct: 89  AGYNWMLPSRWLIGIEADLNSPNTLGGNTGNTLPSGTVGGHDHQALLGGTVRGRVGYAF- 147

Query: 130 DSLLLYATVGPDVAQKYET---GKAGEITPIA----IGGTAGVGVEVGGLSESLVARLEY 182
           D  L Y T G   +          +      A    +G  AG GV+V  LS +  AR EY
Sbjct: 148 DGWLPYVTAGFAWSYDRLRWPPDPSLAQQETALLWRLGWAAGAGVDVP-LSPAWSARAEY 206

Query: 183 RASKYS-------------KVEGFYNTISLGVGMK 204
            A+ +                +   + + LG+  +
Sbjct: 207 LATGFGSGTVSFPIAGQSVSSDVLTHAVRLGLNYR 241


>gi|192292615|ref|YP_001993220.1| carbohydrate-selective porin OprB [Rhodopseudomonas palustris
           TIE-1]
 gi|192286364|gb|ACF02745.1| Carbohydrate-selective porin OprB [Rhodopseudomonas palustris
           TIE-1]
          Length = 670

 Score = 68.5 bits (166), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 44/215 (20%), Positives = 66/215 (30%), Gaps = 55/215 (25%)

Query: 43  TNRYVPIRHDFNGPYAGLSALYNGSFGEEAHHNAGG---------------------SIF 81
                    D++G Y G            +   AGG                      + 
Sbjct: 29  APEAPRAVFDWSGFYIGAHFSAVAGHSNWSSTPAGGSGSIDLFDAFQLFKGTGSYVIGLQ 88

Query: 82  AGYNVEDSC-IMYGVEGDVR-------YTVPVLADNIHSLHG----IGGSLRIRGGYEVS 129
           AGYN       + G+E D+         T   L       H     +GG++R R GY   
Sbjct: 89  AGYNWMLPSRWLIGIEADLNSPNTLGGNTGNTLPSGTVGGHDHQALLGGTVRGRVGYAF- 147

Query: 130 DSLLLYATVGPDVAQKYET---GKAGEITPIA----IGGTAGVGVEVGGLSESLVARLEY 182
           D  L Y T G   +          +      A    +G  AG GV+V  LS +  AR EY
Sbjct: 148 DGWLPYVTAGFAWSYDRLRWPPDPSLAQQETALLWRLGWAAGAGVDVP-LSPAWSARAEY 206

Query: 183 RASKYS-------------KVEGFYNTISLGVGMK 204
            A+ +                +   + + LG+  +
Sbjct: 207 LATGFGSGTVSFPIAGQSVSSDVLTHAVRLGLNYR 241


>gi|91978079|ref|YP_570738.1| putative outer membrane protein [Rhodopseudomonas palustris BisB5]
 gi|91684535|gb|ABE40837.1| putative outer membrane protein [Rhodopseudomonas palustris BisB5]
          Length = 235

 Score = 68.1 bits (165), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 36/182 (19%), Positives = 64/182 (35%), Gaps = 32/182 (17%)

Query: 40  TIATNRYVPIRHDFNGPYAGLSA---------LYNG----SFGEEAHHNAG--GSIFAGY 84
            +     VP  +++ G Y G++           Y G    +  + AH+  G  G +  G+
Sbjct: 26  PLKAAPPVPALYNWTGVYIGINGSAVLSDKRWDYFGPLLPTGDDGAHNFTGLFGGVQVGF 85

Query: 85  NVEDSCIMYGVEGDVRYTVPVLADN--------IHSLHGIGGSLRIRGGYEVSDSLLLYA 136
           + +    ++GVE    +       +          +L    G +  R GY + ++ LLY 
Sbjct: 86  DYQVGSWVFGVEAQGDWGRARGTSDSLLFANQTNRTLIDAFGLINGRFGYAL-NNALLYV 144

Query: 137 TVGPDVAQKYETGKAGE-------ITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSK 189
             G  V Q+     A +        +    G T G G+E    SE +    EY       
Sbjct: 145 KGGAGVVQEKYDVFATDTGVTFTNASETRWGSTVGAGLE-LAFSEHISVAAEYNHIFLGS 203

Query: 190 VE 191
            +
Sbjct: 204 RD 205


>gi|310816178|ref|YP_003964142.1| outer membrane protein [Ketogulonicigenium vulgare Y25]
 gi|308754913|gb|ADO42842.1| outer membrane protein [Ketogulonicigenium vulgare Y25]
          Length = 202

 Score = 68.1 bits (165), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 35/163 (21%), Positives = 64/163 (39%), Gaps = 15/163 (9%)

Query: 52  DFNGPYAGLSALYNGSFG-----EEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVL 106
            + G YAG +  Y  + G      E+    G ++  GY+ +    + G+  +  Y     
Sbjct: 46  TWAGAYAGAALTYGETEGSVGGTSESIDGVGVALRGGYDWQFGSWVLGLGAEYAYNNEDG 105

Query: 107 AD-NIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGV 165
                 +      ++  R GY + D+ L Y + G   +     G + +      G T GV
Sbjct: 106 DVFGATAERKDSAAVFARAGYAL-DTWLPYVSAGYTWSDAEVAGTSYD----LEGATYGV 160

Query: 166 GVEVGGLSESLVARLEYRASKYSKVEGFY---NTISLGVGMKF 205
           GVE    ++++    EY  + +  V+G       + LGV  +F
Sbjct: 161 GVE-KLFTQNISGFAEYSFADFDDVQGVSVEGQGVKLGVNYRF 202


>gi|149914031|ref|ZP_01902563.1| hypothetical protein RAZWK3B_18548 [Roseobacter sp. AzwK-3b]
 gi|149812315|gb|EDM72146.1| hypothetical protein RAZWK3B_18548 [Roseobacter sp. AzwK-3b]
          Length = 189

 Score = 68.1 bits (165), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 34/178 (19%), Positives = 61/178 (34%), Gaps = 20/178 (11%)

Query: 22  QAADPVRRAHHGGRGVVPTIATNR-------YVPIRHDFNGPYAGLSALY---NGSFGEE 71
            AA  +           P               P   D+ GPY G    +   + +    
Sbjct: 1   MAALALATGPALAGSATPPEPDPVISTPAPPPAPSSPDWTGPYVGGQIGWGNVDTNLPGV 60

Query: 72  AHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGSLRIRGGYEVSDS 131
           +  +  G + AGY+ +    + G   D  +    L     +L  +   ++ RGGY++ + 
Sbjct: 61  SGDDVIGGLIAGYDYDFGQWVVGGGLDYDWADIGLGAGNPTLENVF-RVKARGGYKIGNG 119

Query: 132 LLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSK 189
            LLY T G   A   +T   G+      G   G G E   ++ ++    E    ++  
Sbjct: 120 -LLYGTGGWAQA---DTSTLGDDD----GYFIGAGYE-HMVTPNVSLGGEVLYHEFDN 168


>gi|27382806|ref|NP_774335.1| outer-membrane immunogenic protein [Bradyrhizobium japonicum USDA
           110]
 gi|27355979|dbj|BAC52960.1| blr7695 [Bradyrhizobium japonicum USDA 110]
          Length = 288

 Score = 68.1 bits (165), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 34/176 (19%), Positives = 54/176 (30%), Gaps = 31/176 (17%)

Query: 38  VPTIATNRYVPIRHDFNGPYAGLSALY------------NGSFGEEAHHNAGGSIFA--G 83
             T A    V   +D+ G Y G +  +             G+        +GG +    G
Sbjct: 64  PYTKAPPPVVAPIYDWTGFYIGANGGWGQSHSCVDFVTALGTVASGCGDRSGGVVGGQIG 123

Query: 84  YNVEDSCIMYGVEGDVRYTVPVLAD--------NIHSLHGIGGSLRIRGGYEVSDSLLLY 135
           Y  + S  ++G+E    +               +  +     G    + G+   +S LLY
Sbjct: 124 YRWQTSQFVFGLEAQGDWADLKNTRVSLFNPTLSTTAKTDAIGLFTGQLGWAW-NSALLY 182

Query: 136 ATVGPDVAQKYET-------GKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRA 184
              G  V     T                  GGT GVG E  G + +    +EY  
Sbjct: 183 VKGGAAVTSNRLTIFDNTTGIGLVSADNTRWGGTLGVGFEY-GFTPNWSVGVEYDH 237


>gi|86748027|ref|YP_484523.1| outer membrane autotransporter [Rhodopseudomonas palustris HaA2]
 gi|86571055|gb|ABD05612.1| outer membrane autotransporter [Rhodopseudomonas palustris HaA2]
          Length = 638

 Score = 67.8 bits (164), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 37/221 (16%), Positives = 59/221 (26%), Gaps = 45/221 (20%)

Query: 29  RAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYN-----------GSFGEEAHHNAG 77
            A                V   +++ G + G S               G+  +     A 
Sbjct: 410 EAVAAAPLYTKAAKAPILVHSAYNWTGFFVGGSFGVLNGRTDWTFQPGGTTTDPRFAGAI 469

Query: 78  GSIFAGYNVEDSCIMYGVEGDVRYTVPVLAD--------NIHSLHGIGGSLRIRGGYEVS 129
           G    GY+ +    + GVEG +  T    A            +     G+   + GY   
Sbjct: 470 GGGQIGYDYQFGKWVVGVEGALNATNANGARPCPSSVFFTCETNVSWMGTATAKLGYAFW 529

Query: 130 DSLLLYATVGPDVAQKYETGK--------------AGEITPIAIGGTAGVGVEVGGLSES 175
           D  L Y   G        T                    +    G T G+G E   LS++
Sbjct: 530 DRSLWYVRGGGAFGDLKVTTTCNTGPFNPLGLAGCGENASRSRAGWTIGIGSEF-ALSKN 588

Query: 176 LVARLEYRASKYS---------KVEGFYNTI--SLGVGMKF 205
              R E                 ++   N    ++GV  +F
Sbjct: 589 WTVRTETNYFDMGRERYVLPTSTIDVKQNGFISTVGVNYRF 629


>gi|27380621|ref|NP_772150.1| outer-membrane immunogenic protein [Bradyrhizobium japonicum USDA
           110]
 gi|27353786|dbj|BAC50775.1| outer-membrane immunogenic protein precursor [Bradyrhizobium
           japonicum USDA 110]
          Length = 237

 Score = 67.8 bits (164), Expect = 9e-10,   Method: Composition-based stats.
 Identities = 38/201 (18%), Positives = 67/201 (33%), Gaps = 44/201 (21%)

Query: 43  TNRYVPIR--HDFNGPYAGLSALYNGSFGEEAHHNAG-----GSIFAGYNVED-SCIMYG 94
              Y P +  +++ G Y G      G+F  ++   +      G +  G++ +     + G
Sbjct: 33  APAYTPPQVIYNWTGFYIGGHVG--GAFAGDSSFQSSDARFLGGVQGGFDYQFAPNWVVG 90

Query: 95  VEGDVRYTVPVLADN---------IHSLHGIGGSLRIRGGYEVSDSLLLYATVGPD---V 142
           VE   +Y+     +N         + S     GS+  R GY      L+YA  G      
Sbjct: 91  VEA--QYSWLPTNNNGVTFPLGTQVTSNTDQLGSVTGRIGYTW-GPALVYAKGGYAWRNG 147

Query: 143 AQKYETGKAGEI-TPIAI---GGTAGVGVEVGGLSESLVARLEYRASKYSKV-------- 190
                     +  T       G T G G+E    + S  A+ EY+   +           
Sbjct: 148 GLGVNVAGVPQGFTATGNNKDGYTVGAGLEY-MFAPSWSAKAEYQYYNFGSTTFTSGPAD 206

Query: 191 ------EGFYNTISLGVGMKF 205
                     +T+ +GV  +F
Sbjct: 207 IVGVRGREDEHTVKVGVNYRF 227


>gi|319405140|emb|CBI78746.1| Hemin binding protein D [Bartonella sp. AR 15-3]
          Length = 295

 Score = 67.8 bits (164), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 24/110 (21%), Positives = 39/110 (35%), Gaps = 19/110 (17%)

Query: 113 LHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAG--------EITPIAIGGTAG 164
                G+ R+R G+  +  ++ Y   G       +                   +G T G
Sbjct: 188 KEKWTGATRVRIGFS-AGHIMPYIAAGVSYVDLKDILSVSLFEREAETVEGKKMVGYTFG 246

Query: 165 VGVEVGGLSESLVARLEYRASKYSKV---------EGFYNTISLGVGMKF 205
            GV+V  + +++V R EYR S + K              N   +GV  KF
Sbjct: 247 GGVDVAMI-DNVVMRAEYRYSDFGKKKFAKGEVELSYKTNDFRVGVAYKF 295


>gi|188584272|ref|YP_001927717.1| porin [Methylobacterium populi BJ001]
 gi|179347770|gb|ACB83182.1| porin [Methylobacterium populi BJ001]
          Length = 274

 Score = 67.4 bits (163), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 42/229 (18%), Positives = 73/229 (31%), Gaps = 65/229 (28%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+   + +G++   L+   +A AAD  RRA       +P             + G Y G+
Sbjct: 1   MRNSLILIGLTGALLS--STALAADLPRRAEPPVFTPIP----------VFAWTGAYLGI 48

Query: 61  SALYNGSFGEEAH------------------------HNAGGSIFAGYNVE---DSCIMY 93
           +A Y  +  +                                    GYN +    +  ++
Sbjct: 49  NAGYAYTESDTLRTAGIGALQANVTNDLRRAAVGLPQDGFTVGGQGGYNFQLTPGTGFVF 108

Query: 94  GVEGDVRY----------------TVPVLADNIHSLHGIGGSLRIRGGYEVSDSLLLYAT 137
           G+E D +Y                   VL +   +     G++R R GY   D +L+Y T
Sbjct: 109 GLEVDAQYMDLQRSRTETIFRPAFNPNVLTNVYAADLDFLGTVRGRIGYAF-DRVLVYGT 167

Query: 138 VGPDVA---------QKYETGKAGEITPIAIGGTAGVGVEVGGLSESLV 177
            G                    AG  + +  G   G G+E    ++S +
Sbjct: 168 GGFAYGTVSQGVTFQTGAPVTYAGARSGVETGYAYGGGIEYALPTDSFL 216


>gi|27379782|ref|NP_771311.1| outer-membrane immunogenic protein [Bradyrhizobium japonicum USDA
           110]
 gi|27352935|dbj|BAC49936.1| bll4671 [Bradyrhizobium japonicum USDA 110]
          Length = 282

 Score = 67.4 bits (163), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 34/217 (15%), Positives = 60/217 (27%), Gaps = 46/217 (21%)

Query: 8   VGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIR-HDFNGPYAGLSALYNG 66
           + +++  L+    A AAD +                   VP     + G Y G       
Sbjct: 48  LVLTAALLSLATPAFAADIIA-----------PAPVKAPVPAAIFTWTGFYIGAHGGGAW 96

Query: 67  S-------------FGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADN---- 109
           S             +              G N +   ++ G+EG   ++   L       
Sbjct: 97  SKWTGIDPTDPTAVWTSVTASGGIVGGQIGGNYQIGNVVVGLEGTGAWSSVTLNAGGPFG 156

Query: 110 ------IHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYET---------GKAGEI 154
                 +   +    ++  R G    D +LLYA  G    +               +   
Sbjct: 157 GGAGFTLSLKNDYIATVAGRFGVAF-DRVLLYAKGGAAFTRDKYNANNGLAGALAGSASG 215

Query: 155 TPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVE 191
           +    G  AG GVE      +   R EY    ++ + 
Sbjct: 216 SFNRTGWLAGGGVE-WMFMPNWSVRAEYNYMGFAAIT 251


>gi|116255059|ref|YP_770894.1| putative outer membrane protein precursor [Rhizobium leguminosarum
           bv. viciae 3841]
 gi|115259707|emb|CAK11704.1| putative outer membrane protein precursor [Rhizobium leguminosarum
           bv. viciae 3841]
          Length = 216

 Score = 67.4 bits (163), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 38/193 (19%), Positives = 64/193 (33%), Gaps = 23/193 (11%)

Query: 2   QKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLS 61
           ++  + V VS+L      +A  AD            VP+  +    P    + G YAGL 
Sbjct: 5   KRKIVFVIVSTLMARGASAADLAD----------HSVPSAPS-YDAPGTFSWAGAYAGLH 53

Query: 62  ALYNGSFGEEAHHNAGGSIFA--GYNVEDSCIMYGVEGDVRY-TVPVLADNIHSLHGIGG 118
                      +++   ++ A  GYN +    ++G E +  Y    V            G
Sbjct: 54  GGVAAPKFNPFNNDRAPAVGAQVGYNFQAGPGVFGAELEGSYLNNEVRVPGGKVESRFRG 113

Query: 119 SLRIRGGYEVSDSLLLYATVGPDVAQKYETGK-AGEIT------PIAIGGTAGVGVEVGG 171
           + + + G  + D   +Y T G    +        G             G   G GVE   
Sbjct: 114 AAKAKAGLGL-DRTFIYGTAGVTTTEFEGRRPVFGSDKWKSGPESWKQGYLFGGGVE-HA 171

Query: 172 LSESLVARLEYRA 184
               + A++EY  
Sbjct: 172 FPGGVSAKIEYNY 184


>gi|83308666|emb|CAJ01574.1| outer membrane protein [uncultured bacterium]
          Length = 304

 Score = 67.4 bits (163), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 35/169 (20%), Positives = 55/169 (32%), Gaps = 43/169 (25%)

Query: 65  NGSFGEEAHHNAGGSIFAGYNVEDSC----IMYGVEGDV-------------------RY 101
            GS     H    G    GYN + +      + G+E D+                    +
Sbjct: 86  TGSISPVNHSGFIGGGQVGYNYQFNNSWSSWVAGIEADIQGVAASNSAHLVFGQAFVPGF 145

Query: 102 TVPVLADNIHSLH--GIGGSLRIRGGYEVSDSLLLYATVGPD---------VAQKYETGK 150
               +  N+ S       G++R R G+ +  +LL Y T G           + Q  E   
Sbjct: 146 AGSPIDQNLSSSMTGDFLGTVRGRLGFTIIPTLLFYGTGGLAYGQTDSRTSITQIVENDP 205

Query: 151 A--------GEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVE 191
           A        G I+   +G TAG G E    + +   ++EY       V 
Sbjct: 206 ALPNHYSSFGSISNSRVGWTAGGGGEWL-FAPNWSVKVEYLYYNLGSVS 253


>gi|323137952|ref|ZP_08073026.1| putative outer-membrane immunogenic protein precursor
           [Methylocystis sp. ATCC 49242]
 gi|322396671|gb|EFX99198.1| putative outer-membrane immunogenic protein precursor
           [Methylocystis sp. ATCC 49242]
          Length = 302

 Score = 67.4 bits (163), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 43/263 (16%), Positives = 66/263 (25%), Gaps = 83/263 (31%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+ +  +  ++   +     A AAD            +P +      P    + G Y GL
Sbjct: 1   MKSIASSAVLTLSLIGG--GAFAADL----SSHKLPPLPELPAMETTP----WAGFYIGL 50

Query: 61  SALYNGSFG---------------------------------EEAHHNAGGSIFAGYNVE 87
           +A    +                                           G    GYN  
Sbjct: 51  NAGGAWNASTAVNLLSAPVFVAPGIGEEIWAATSSFAASRALSTQAAGFIGGGQLGYNWR 110

Query: 88  -DSCIMYGVEGDVRYTVPVLADNIHSLH--------------------GIGGSLRIRGGY 126
                + GVE D++          +                          G++R R GY
Sbjct: 111 FSETFIAGVEADIQGVAGGANSARNVSLLPTPAAGLSYLTTLSASKRLDYLGTVRGRIGY 170

Query: 127 EVSDSLLLYATVGPDVAQKYETGK------------------AGEITPIAIGGTAGVGVE 168
            V+ +LL YAT G                             AG  +    G T G G+E
Sbjct: 171 LVTPTLLAYATGGLAYGGVTARADFFQTIPNDTPGFELLAINAGRFSNTRAGWTVGGGLE 230

Query: 169 VGGLSESLVARLEYRASKYSKVE 191
               S+    + EY       V 
Sbjct: 231 WMFSSD-WSLKAEYLYYDLGGVT 252


>gi|323137959|ref|ZP_08073033.1| hypothetical protein Met49242DRAFT_2421 [Methylocystis sp. ATCC
           49242]
 gi|322396678|gb|EFX99205.1| hypothetical protein Met49242DRAFT_2421 [Methylocystis sp. ATCC
           49242]
          Length = 837

 Score = 67.4 bits (163), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 29/151 (19%), Positives = 44/151 (29%), Gaps = 34/151 (22%)

Query: 75  NAGGSIFAGYNVE-DSCIMYGVEGDV----RYTVPVLADNIHSLHG-------------- 115
              G +  G N       + GVE D+      T         +  G              
Sbjct: 642 GFIGGLQLGANWNFSGNFLAGVETDLHGVSGNTDTKWQLTSANGGGDTFLTYEQRTATLN 701

Query: 116 IGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETG-------KAGEITP-------IAIGG 161
             G++R R GY  + +LL+Y T G                      T          +G 
Sbjct: 702 YLGTVRGRLGYLATPTLLVYGTGGMAYGGVVSNTAIFTRRVGGTSQTQVNPVFQDTLVGW 761

Query: 162 TAGVGVEVGGLSESLVARLEYRASKYSKVEG 192
           +AG GVE   L  +  A+++Y          
Sbjct: 762 SAGGGVEWMFL-PNWSAKVDYLHYDLGNARA 791


>gi|220979417|gb|ACL97990.1| outer membrane protein B3 [Rhizobium leguminosarum bv. viciae]
          Length = 216

 Score = 67.0 bits (162), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 40/194 (20%), Positives = 67/194 (34%), Gaps = 23/194 (11%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           +++   +VGVS L      +A  AD            VP+  +    P    + G YAGL
Sbjct: 4   IKRKIFSVGVSMLMACGASAADLAD----------HSVPSAPS-YDAPGTFSWAGAYAGL 52

Query: 61  SALYNGSFGEEAHHNAGGSIFA--GYNVEDSCIMYGVEGDVRY-TVPVLADNIHSLHGIG 117
                 S     ++    ++ A  GYN +    ++G E +  Y    V     +      
Sbjct: 53  HGGVAASKFNPFNNGRAPAVGAQVGYNFQAGSGVFGAELEGSYLNNEVRVPVGNVESRFR 112

Query: 118 GSLRIRGGYEVSDSLLLYATVGPDVAQKY---ETGKAGE----ITPIAIGGTAGVGVEVG 170
           G+ + + G    D   +Y T G    +         + +          G   G GVE  
Sbjct: 113 GAAKAKAGLGF-DRTFVYGTAGVTTTEFEGHRLVSGSDKWKSGPDSWKHGYLFGGGVE-H 170

Query: 171 GLSESLVARLEYRA 184
             S  + A++EY  
Sbjct: 171 AFSGGVSAKIEYNY 184


>gi|115524371|ref|YP_781282.1| OmpA domain-containing protein [Rhodopseudomonas palustris BisA53]
 gi|115518318|gb|ABJ06302.1| OmpA domain protein transmembrane region-containing protein
           [Rhodopseudomonas palustris BisA53]
          Length = 235

 Score = 67.0 bits (162), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 34/203 (16%), Positives = 63/203 (31%), Gaps = 40/203 (19%)

Query: 39  PTIATNRYVPI--RHDFNGPYAGLSALYNGSFGEEAHHNAG---GSIFAGYNVEDS-CIM 92
           P      Y      +++ G Y G       +  +    + G     +  G + + +   +
Sbjct: 27  PATKAPAYTAPEIVYNWTGFYIGGHVGGAFAGDDNITGSDGRFLAGVQGGADYQFARNWV 86

Query: 93  YGVEGDVRYTVPVLADN----------IHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDV 142
            G+E   +Y+      N          +   +   GS+  R GY      LLYA  G   
Sbjct: 87  VGIEA--QYSWLPTDGNGGLLYPGNTLVTQDNRGLGSVTGRLGYSW-GPALLYAKGGYAF 143

Query: 143 AQKYETGKAGEITPIAI------GGTAGVGVEVGGLSESLVARLEYRASKYSK------- 189
                        P A       G + G G+E    + +  A++EY+   +         
Sbjct: 144 RDSSIDVSNLGAQPFATSGNKKDGYSVGGGLEYL-FAPNWSAKVEYQYYNFGNTSFTGGP 202

Query: 190 -------VEGFYNTISLGVGMKF 205
                  V    +T+  G+  +F
Sbjct: 203 PDIVGSSVRNDEHTVKAGINYRF 225


>gi|119383601|ref|YP_914657.1| putative outer membrane protein [Paracoccus denitrificans PD1222]
 gi|119373368|gb|ABL68961.1| putative outer membrane protein [Paracoccus denitrificans PD1222]
          Length = 199

 Score = 67.0 bits (162), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 41/196 (20%), Positives = 68/196 (34%), Gaps = 28/196 (14%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K+  A   S +A  ++     A PV                   +    D+ G YAGL
Sbjct: 1   MKKVGYAALASLIAGGAYAGGYVA-PVVEQPVV-------APAPVTITPESDWTGFYAGL 52

Query: 61  SALY-NGSFGE-----EAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLH 114
                +G  G      +     G  + AGY  +    + G E D       ++ + +   
Sbjct: 53  QYGKGSGDLGNRGALADFGDYDGYGLHAGYQRDLGRFVLGGELDYN----KISPDENYDD 108

Query: 115 GIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSE 174
           G    LR+R G ++    L Y T+G             + +    G T G+G +   ++E
Sbjct: 109 GDLTRLRLRAGADM-GRFLPYVTLGAA------KISVDDFSET--GLTYGLGADF-KVTE 158

Query: 175 SLVARLEYRASKYSKV 190
                 EY  S +  V
Sbjct: 159 RFTVGAEYSRSDFKDV 174


>gi|114706584|ref|ZP_01439485.1| outer membrane protein, 31 kDa [Fulvimarina pelagi HTCC2506]
 gi|114537976|gb|EAU41099.1| outer membrane protein, 31 kDa [Fulvimarina pelagi HTCC2506]
          Length = 243

 Score = 67.0 bits (162), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 29/158 (18%), Positives = 54/158 (34%), Gaps = 27/158 (17%)

Query: 65  NGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLA-------------DNIH 111
           +G+  E       G + AGY+V+    + G   D+  T                  ++ +
Sbjct: 66  DGTGFETTAGGGLGGVQAGYDVQLGRAVLGGVADISLTGIDADVSTRERAGGVETTNSAN 125

Query: 112 SLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGE-------------ITPIA 158
           +     G++R R GY  SD +L Y   G    +   T    E              +   
Sbjct: 126 TELDYLGTVRARAGYAASDRVLAYGHGGLAYGRTDTTISESERRGGVTNTQTESRKSDTK 185

Query: 159 IGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFYNT 196
            G   G G+E    ++++  + EY      K   + ++
Sbjct: 186 YGYAVGAGLEYKA-TDNVSLQTEYGYHDLGKDRLYSDS 222


>gi|126736404|ref|ZP_01752146.1| outer membrane protein, putative [Roseobacter sp. CCS2]
 gi|126714225|gb|EBA11094.1| outer membrane protein, putative [Roseobacter sp. CCS2]
          Length = 211

 Score = 66.6 bits (161), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 32/156 (20%), Positives = 56/156 (35%), Gaps = 24/156 (15%)

Query: 46  YVPIRHDFNGPYAGLS-----------ALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYG 94
                 D++G YAG                  SF +    +   S FAGY ++    + G
Sbjct: 27  PTVALADWSGAYAGAQLDVLTGDEVSLGFAAQSFEDVIETDTIISGFAGYQLQQGDFVIG 86

Query: 95  VEGDVRYTVPVLADNIHSLHGIGGSLR-----IRGGYEVSDSLLLYATVGPDVAQKYETG 149
            E  +     V  +++    G+   +R      R GY++ D  L+Y   G   ++  +  
Sbjct: 87  GELSLGQANGVRFEDVD---GLDTDVRLVDVKARVGYDLGD-ALVYGVAGFSQSRLLDID 142

Query: 150 KA---GEITPIAIGGTAGVGVEVGGLSESLVARLEY 182
           +    G     + G   G GV+   ++E      EY
Sbjct: 143 EDDLEGLDLETSTGVNYGFGVDYR-VTEQFTVGAEY 177


>gi|326387856|ref|ZP_08209462.1| porin [Novosphingobium nitrogenifigens DSM 19370]
 gi|326207902|gb|EGD58713.1| porin [Novosphingobium nitrogenifigens DSM 19370]
          Length = 200

 Score = 66.6 bits (161), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 32/173 (18%), Positives = 59/173 (34%), Gaps = 19/173 (10%)

Query: 51  HDFNGPYAGLSALYNGSFGEEAHHNAGG------------SIFAGYNVED-SCIMYGVEG 97
             FNGP+ G    +  +         G              +F G +       + G + 
Sbjct: 27  KTFNGPFIGAQGGWEENSVNNPSTGVGPTNLYGTGDTGTLGVFVGQDYRILKNFVIGGQA 86

Query: 98  DVRY--TVPVLADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEI- 154
           +V +     +              L +R GY + D  LLY   G    +      A    
Sbjct: 87  EVNFPINSHITDGTTTVDPKRSVDLSLRAGYVLRDKTLLYVRGGYSNVRASTIINAETPI 146

Query: 155 --TPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFYNTISLGVGMKF 205
             +    G   G G+E   +++ +  R+EYR +  S+  G ++   L +G+ +
Sbjct: 147 YVSGSQNGWMLGGGIE-QYVTKHITGRMEYRYTNLSEGAGKFDRHQLLLGVAY 198


>gi|240141692|ref|YP_002966172.1| putative outer-membrane immunogenic protein precursor
           [Methylobacterium extorquens AM1]
 gi|240011669|gb|ACS42895.1| putative outer-membrane immunogenic protein precursor
           [Methylobacterium extorquens AM1]
          Length = 299

 Score = 66.2 bits (160), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 47/302 (15%), Positives = 74/302 (24%), Gaps = 114/302 (37%)

Query: 10  VSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNG--- 66
           ++ L       A AAD       G     P  A         D++G Y G    Y+    
Sbjct: 6   LALLTTVLVSPALAADLDYGVLRGYDDDYPAPA------PIIDWSGFYVGGHGGYSSAAL 59

Query: 67  SFGE-----------------------------EAHHNAGGSIFAGYNVEDSCIMYGVEG 97
            FG                                   A   +FAG N +   ++ G E 
Sbjct: 60  GFGNAFQPIVATALRYSVVEAEMNASQLLAARSTHSGGASYGVFAGVNYQFEDVVVGFEA 119

Query: 98  DVRYTVPV----------------------LADNIHSLHGIGGSLRIRGGYEVSDSLLLY 135
           D  Y                          L+    +     G++R R GY   + LL +
Sbjct: 120 DYTYFGQSGTTSDQIARYMITKDNYLRTVDLSGQASTKIQDYGTIRGRLGYAFGN-LLPF 178

Query: 136 ATVGPDVAQKYETGK--------------------------------------------- 150
            T G  V +                                                   
Sbjct: 179 VTGGVAVGRATVHNTVTIQNYGYNNTIYATNQTGTTKSYIDNEGYSVFYQNNPPGSIPAP 238

Query: 151 ----AGEITPIAIGGTAGVGVEVGGLSESLVARLEYRA---SKYSKVEGFYNTISLGVGM 203
                        G   G G+E   ++ + + R EY+    + +   +   NT+  G  +
Sbjct: 239 GTVHGTTKKVTVTGIAVGGGLEY-AITPNFLLRGEYQYVLFNDFQGHKAELNTVRGGAAI 297

Query: 204 KF 205
           KF
Sbjct: 298 KF 299


>gi|91975493|ref|YP_568152.1| Outer membrane autotransporter barrel [Rhodopseudomonas palustris
           BisB5]
 gi|91681949|gb|ABE38251.1| Outer membrane autotransporter barrel [Rhodopseudomonas palustris
           BisB5]
          Length = 645

 Score = 66.2 bits (160), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 35/205 (17%), Positives = 55/205 (26%), Gaps = 42/205 (20%)

Query: 22  QAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYN-----------GSFGE 70
            A D +  A    +           V   +++ G + G S               G+  +
Sbjct: 410 FAPDAIVAAPLYTK----AAKAPVLVRSAYNWTGFFIGGSFGALNGRTDWTFQPVGTRTD 465

Query: 71  EAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLAD--------NIHSLHGIGGSLRI 122
                A G    GY+ +    + GVEG++  T    A            +     G+   
Sbjct: 466 PRFAGAIGGGQIGYDHQFGKWVVGVEGNLFATNANGARPCPNGVFFTCENNVSWMGTATA 525

Query: 123 RGGYEVSDSLLLYATVGPDVAQKYETGK------------------AGEITPIAIGGTAG 164
           + GY   D  L Y   G        T                        +    G T G
Sbjct: 526 KLGYAFWDRSLWYVRGGGAFGDLKVTTNCNTGPVVPNPAFLVVAGCGESASRNRAGWTIG 585

Query: 165 VGVEVGGLSESLVARLEYRASKYSK 189
            G E   LS++   R E       +
Sbjct: 586 FGSEF-ALSKNWTVRAETNYFDMGR 609


>gi|86751789|ref|YP_488285.1| hypothetical protein RPB_4691 [Rhodopseudomonas palustris HaA2]
 gi|86574817|gb|ABD09374.1| conserved hypothetical protein [Rhodopseudomonas palustris HaA2]
          Length = 562

 Score = 66.2 bits (160), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 41/209 (19%), Positives = 68/209 (32%), Gaps = 40/209 (19%)

Query: 20  SAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSFGEEAHHNAGG- 78
           ++  A  +  A       +P +  +   P++  + G Y G      GSFG+ +  +  G 
Sbjct: 5   ASTTAMLILAATTAAAADLPRLPLSPAAPVQWSWTGLYWGAHLG--GSFGQTSFSDPAGP 62

Query: 79  --------------SIFAGYNVEDS-CIMYGVEGDVR------------YTVPVLADNIH 111
                          I  GYN + +   + GVE DV              +   ++ N  
Sbjct: 63  GLYGGQVRSPAALAGIQLGYNYQPNRNWLIGVEADVSAMNGNGTQSCLVSSGLFISANCR 122

Query: 112 SLHGIGGSLRIRGGYEVSD--SLLLYATVGPD----VAQKYETGKAGEITPI---AIGGT 162
                  +L  R G+        LLYA  G                G  T       G T
Sbjct: 123 VRQDALATLTGRAGFVTGPGGRTLLYAKAGAAFLSERLDITIGNPIGSSTESTDGRWGWT 182

Query: 163 AGVGVEVGGLSESLVARLEYRASKYSKVE 191
           AG G+E   L+ +   + EY  + +   +
Sbjct: 183 AGAGIE-RALAPAWSVKFEYDYANFGSRD 210


>gi|323139010|ref|ZP_08074070.1| porin [Methylocystis sp. ATCC 49242]
 gi|322395764|gb|EFX98305.1| porin [Methylocystis sp. ATCC 49242]
          Length = 294

 Score = 65.8 bits (159), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 37/190 (19%), Positives = 56/190 (29%), Gaps = 41/190 (21%)

Query: 48  PIRHDFNGPYAGLSALYNGSFGEEAHHNAGGSIFAGYNVED-SCIMYGVEGDVRYTVPVL 106
              H +    AGLSA    +     +    G    GYN +  +  + GVE D++      
Sbjct: 75  SPIHGWA---AGLSAT--SAPTSNNNSGFIGGGQIGYNWQFMNSFLVGVEADIQGVAGNS 129

Query: 107 ADNI--------------------HSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKY 146
                                    S     G++R R G+  + +LL+Y T G       
Sbjct: 130 GSQNIFGASSDPFTGTTFATFGTRSSRLDYLGTVRGRLGWLFTPTLLVYGTGGLAYGGVS 189

Query: 147 ETG--------------KAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEG 192
                                     +G TAG G E      +  A++EY       V  
Sbjct: 190 TNSSFVTSELGIGLSSVGGTTFADTRVGWTAGGGFE-WMFMPNWSAKVEYLYYDLGTVSA 248

Query: 193 FYNTISLGVG 202
              +I   VG
Sbjct: 249 SGASIEPVVG 258


>gi|83942577|ref|ZP_00955038.1| outer membrane protein, putative [Sulfitobacter sp. EE-36]
 gi|83846670|gb|EAP84546.1| outer membrane protein, putative [Sulfitobacter sp. EE-36]
          Length = 202

 Score = 65.8 bits (159), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 46/205 (22%), Positives = 75/205 (36%), Gaps = 20/205 (9%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M++       + LA  +F  A  A  +           P  A +    +  D+ G Y GL
Sbjct: 1   MKRTMKLASAAVLASTAFAGATYAGSLAEPVVEPVMTAPVPAPD----LGGDWTGFYTGL 56

Query: 61  SALYNGSFGEEAHHNAGG--SIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGG 118
              Y+ +  +       G     AGYN +    + G E D   T   L D      G   
Sbjct: 57  QLGYSDAEVDNGLEGDNGSYGFHAGYNYDFGRFVLGGELDYDKTDIDLDDAAGVTQGSID 116

Query: 119 SL---RIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSES 175
           S+   +I+GGY++  S L+YAT G   A        G+          G+G++     + 
Sbjct: 117 SVARAKIKGGYDL-GSTLIYATGGYARADTSL----GDEDGAFY----GIGMDYKITEQY 167

Query: 176 LVAR--LEYRASKYSKVEGFYNTIS 198
            V    LE++    + V G    ++
Sbjct: 168 SVGAELLEHKFDDVNGVSGDDADVT 192


>gi|27380105|ref|NP_771634.1| hypothetical protein blr4994 [Bradyrhizobium japonicum USDA 110]
 gi|27353259|dbj|BAC50259.1| blr4994 [Bradyrhizobium japonicum USDA 110]
          Length = 296

 Score = 65.8 bits (159), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 40/188 (21%), Positives = 64/188 (34%), Gaps = 43/188 (22%)

Query: 38  VPTIATNRYVPIRHDFNGPYAGLSAL--------------YNGSFGEEAHHNAGGSIFA- 82
             T A    V   +D++G Y G++                     GE  H+  GG+I   
Sbjct: 64  PYTKAPAPMVAAIYDWSGFYIGINGGGGSAHSCWDFVTPVTGTLVGEGCHNATGGTIGGQ 123

Query: 83  -GYNVEDSCIMYGVEGDVRY--------------TVPVLADNIHSLHGIGGSLRIRGGYE 127
            GY  + +  ++G+EG   +              +  V  D   S     G +  + GY 
Sbjct: 124 VGYRWQSASWVFGLEGQGNWADFSGDNISLLFPGSALVTGDRNRSRIDSFGLITGQVGYA 183

Query: 128 VSDSLLLYATVGPD-VAQKYETGKAG----------EITPIAIGGTAGVGVEVGGLSESL 176
             +S+LLY   G   V  K++   A                  G T G G+E  G + + 
Sbjct: 184 W-NSVLLYVKGGAAVVGDKFDIYAAPGTPGAGTLLASGRDTRWGATVGAGLEF-GFAPNW 241

Query: 177 VARLEYRA 184
              +EY  
Sbjct: 242 SVGVEYDH 249


>gi|148255738|ref|YP_001240323.1| putative outer-membrane protein [Bradyrhizobium sp. BTAi1]
 gi|146407911|gb|ABQ36417.1| putative outer-membrane protein [Bradyrhizobium sp. BTAi1]
          Length = 260

 Score = 65.8 bits (159), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 35/194 (18%), Positives = 57/194 (29%), Gaps = 43/194 (22%)

Query: 41  IATNRYVPIRHDFNGPYAGLSALYNGSF-----------------GEEAHHNAGG--SIF 81
                YV     + G Y G +   + S                   E  H+   G     
Sbjct: 32  APPPAYVTPLPSWAGFYLGANGGADWSRNCWTLNRVNGVPVVPTQSEGCHNATSGLIGGQ 91

Query: 82  AGYNVEDSCIMYGVEGDVRYTVPVLADN----------IHSLHGIGGSLRIRGGYEVSDS 131
            GY  + +  ++G+E    +T    ++            ++     G    + GY   + 
Sbjct: 92  IGYRWQAASWVFGLEAQGNWTDLKSSNASSAAFAAGITNNTKTDAIGLFTGQIGYAWGN- 150

Query: 132 LLLYATVGPDVAQKYETGKA------------GEITPIAIGGTAGVGVEVGGLSESLVAR 179
           +L Y   G  VA    TG A               +    GGT G GVE  G + +    
Sbjct: 151 VLWYVKGGAAVAHNKYTGTANAAAPVAVGTLLDSASETRWGGTVGTGVEF-GFAPNWSVA 209

Query: 180 LEYRASKYSKVEGF 193
           +EY        +  
Sbjct: 210 VEYDHLFMGSRDIT 223


>gi|316935831|ref|YP_004110813.1| outer membrane insertion C-terminal signal [Rhodopseudomonas
           palustris DX-1]
 gi|315603545|gb|ADU46080.1| outer membrane insertion C-terminal signal [Rhodopseudomonas
           palustris DX-1]
          Length = 263

 Score = 65.8 bits (159), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 56/277 (20%), Positives = 86/277 (31%), Gaps = 86/277 (31%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+++ +A  V  +A     +A AAD        G                 ++ G Y G 
Sbjct: 1   MRRVVVAATVGVMA----QTAYAADMPDYGPLRG--------ALVETARVVNWEGFYVGG 48

Query: 61  SALYNGS--------------------------------FGEEAHHNAGGSIFAGYNVED 88
            A Y  S                                 G+ + H  G   FAGYN + 
Sbjct: 49  QAGYGTSDMNFTNSTSDIASNLLANTVIESQMGVSSWPVLGKTSSHGQGWGAFAGYNAQW 108

Query: 89  SCIMYGVEGD-----------------VRYTVPVLADNIHSLHGIG----GSLRIRGGYE 127
             ++ GVE +                 + Y     +    S   I     GS R+R GY 
Sbjct: 109 DDVVLGVEANYMHGSFGGSAIGSMGRQITYNNVNYSATYTSSAAINVNDIGSARLRAGYA 168

Query: 128 VSDSLLLYATVGPDVAQKYETGKAG------------------EITPIAIGGTAGVGVEV 169
              S L YA +G  + Q      A                   +      G   G+G++ 
Sbjct: 169 F-GSFLPYAFIGASLGQADIVRTATITGTQGGSTVMPLSATRVQNGHFIYGYAGGLGMD- 226

Query: 170 GGLSESLVARLEYRASKYSK-VEGFYNTISLGVGMKF 205
             L   L  R E+   K++  V+   +T+  G+G KF
Sbjct: 227 MMLYRGLFLRAEWEYLKFAAPVDTSVSTVRAGLGYKF 263


>gi|319406586|emb|CBI80228.1| Hemin binding protein E [Bartonella sp. 1-1C]
          Length = 305

 Score = 65.8 bits (159), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 26/110 (23%), Positives = 43/110 (39%), Gaps = 19/110 (17%)

Query: 113 LHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYET--------GKAGEITPIAIGGTAG 164
                G+ R+R G+  +D ++ Y   G   A+  +T            +     +G T G
Sbjct: 198 KEKWTGATRVRIGFA-ADRIMPYIAAGVSYAELQDTLSVLVSRRNAEADEEKKMVGYTFG 256

Query: 165 VGVEVGGLSESLVARLEYRASKYSKV---------EGFYNTISLGVGMKF 205
            G ++  L++S + R EYR S + K              N   +GV  KF
Sbjct: 257 GGFDI-ALAKSFIMRTEYRYSDFGKKKFAKGEVELSYKTNDFRVGVAYKF 305


>gi|170750581|ref|YP_001756841.1| porin [Methylobacterium radiotolerans JCM 2831]
 gi|170657103|gb|ACB26158.1| porin [Methylobacterium radiotolerans JCM 2831]
          Length = 277

 Score = 65.8 bits (159), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 45/225 (20%), Positives = 64/225 (28%), Gaps = 61/225 (27%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M KL  ++   +       +A AAD  RRA                      + G Y G+
Sbjct: 1   MTKLLASLAAFTALTG---AASAADLPRRAAPPPVFTP---------VPVFTWTGAYFGI 48

Query: 61  SALYN------------------------GSFGEEAHHNAGGSIFAGYNVE---DSCIMY 93
           +A Y                          SF   +     G    GYN +    S ++ 
Sbjct: 49  NAGYAFDASDRNTGNTFAVPFPYAAPGTVASFRNRSQDGFSGGGQIGYNWQITPGSGVVI 108

Query: 94  GVEGDVRYTVPVLADNIH------------------SLHGIGGSLRIRGGYEVSDSLLLY 135
           GVE D +Y       N                    S     G++R R GY   D  L+Y
Sbjct: 109 GVEADAQYLDFGRNRNNAFVSGAVAPGYYLTDPRGLSSLDFFGTVRGRLGYAF-DRTLVY 167

Query: 136 ATVGPDVAQKYETGKAG---EITPIAIGGTAGVGVEVGGLSESLV 177
            T G            G          G   G G+E    ++S +
Sbjct: 168 GTGGFAYGSGSADRSFGGYAGNDSFRTGWAVGGGIEYALPTDSFL 212


>gi|254564200|ref|YP_003071295.1| outer-membrane immunogenic protein [Methylobacterium extorquens
           DM4]
 gi|254271478|emb|CAX27493.1| putative outer-membrane immunogenic protein precursor
           [Methylobacterium extorquens DM4]
          Length = 299

 Score = 65.8 bits (159), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 47/302 (15%), Positives = 74/302 (24%), Gaps = 114/302 (37%)

Query: 10  VSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNG--- 66
           ++ L       A AAD       G     P  A         D++G Y G    Y+    
Sbjct: 6   LALLTTVLVSPALAADLDYGVLRGYDDDYPAPA------PIIDWSGFYVGGHGGYSSAAL 59

Query: 67  SFGE-----------------------------EAHHNAGGSIFAGYNVEDSCIMYGVEG 97
            FG                                   A   +FAG N +   ++ G+E 
Sbjct: 60  GFGNAFQPIVANALRNTVAEIEMGASHYLAARATHSGGASYGVFAGINYQFEDVVAGIEA 119

Query: 98  DVRY----------------------TVPVLADNIHSLHGIGGSLRIRGGYEVSDSLLLY 135
           D  Y                      T   L     +     G++R R GY   +  L +
Sbjct: 120 DYTYFGRSGTAFDQIARYSITKDNYLTTVDLTGQASTKIQDYGTIRGRLGYAFGN-FLPF 178

Query: 136 ATVGPDVAQKYETGK--------------------------------------------- 150
            T G  V +                                                   
Sbjct: 179 FTGGLAVGRATVNDTVTVQNYAYNSATYASNQTGTTRSYINNYGYSAFYQNSPPDSIPAP 238

Query: 151 ----AGEITPIAIGGTAGVGVEVGGLSESLVARLEYRA---SKYSKVEGFYNTISLGVGM 203
                        G   G G+E   ++ + + R EY+    + +   +   NT+  G  +
Sbjct: 239 GTVYGTTKKVTVAGIAVGGGLEY-AITPNFLLRGEYQYVLFNDFQGHKAELNTVRGGAAI 297

Query: 204 KF 205
           KF
Sbjct: 298 KF 299


>gi|312115597|ref|YP_004013193.1| hypothetical protein Rvan_2888 [Rhodomicrobium vannielii ATCC
           17100]
 gi|311220726|gb|ADP72094.1| hypothetical protein Rvan_2888 [Rhodomicrobium vannielii ATCC
           17100]
          Length = 254

 Score = 65.8 bits (159), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 43/217 (19%), Positives = 70/217 (32%), Gaps = 40/217 (18%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M K  +A    +  LA   SA A D         +G           P    + G + GL
Sbjct: 1   MNKTLIATASVAALLAMGGSALAGDL------YAKGGYKDAPVVVAEP---TWTGFHLGL 51

Query: 61  SAL------------YNGSFGEEAHHN-----AGGSIFA----GYNVEDSCIMYGVEGDV 99
                          Y+   GE          +G  +F     GY+ +    + G+  + 
Sbjct: 52  GVGGAAVNHEIDAGLYDVRSGESKSIAGIDGISGTGVFGTVEVGYDRQYGNFVGGIFFNY 111

Query: 100 RYTVPVLADNIHSLHGIGG-------SLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAG 152
            +   +  D     H +         ++  R GY V+ S L Y   G   +    +    
Sbjct: 112 DFGDDISTDVSLLGHDLASVKQTDSWTVGGRLGYLVNASTLAYVLGGYTESTFELSVPVA 171

Query: 153 --EITPIAIGGTAGVGVEVGGLSESLVARLEYRASKY 187
                    G T G G+E   L+ SL  + EYR +++
Sbjct: 172 NFSTDDTFSGWTVGGGLET-KLTSSLSLKGEYRYTEF 207


>gi|13470603|ref|NP_102172.1| outer membrane protein-like [Mesorhizobium loti MAFF303099]
 gi|14021345|dbj|BAB47958.1| outer membrane protein-like [Mesorhizobium loti MAFF303099]
          Length = 430

 Score = 65.8 bits (159), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 38/200 (19%), Positives = 67/200 (33%), Gaps = 40/200 (20%)

Query: 44  NRYVPIRHDFNGPYAGLSALYNGSFGEEAHHNAGGSIF---------------AGYNVED 88
             +    +++ G Y G +    G+   +   + GG                   GY+ + 
Sbjct: 232 ASFAAPTYNWTGFYVGGALG-AGTAVHDLGVDLGGGALDLNGIGSEGVLGEASIGYDYDF 290

Query: 89  SCIMYGVEGDVRYTV-----PVLADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPD-- 141
              + GV+ D  Y+       +   +I   +  G     R G +V++S L Y   G    
Sbjct: 291 GSWVAGVQLDASYSGIRSKLDIPGGSIKLDNDYGFDALARVGAKVNESTLAYVIGGYSYQ 350

Query: 142 -VAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVE--------- 191
                        I     G T G G+E   +S ++   LEYR S++ K +         
Sbjct: 351 HFDLHASDPVGDIIDWNKSGFTVGGGLET-AVSSNMTVGLEYRYSQFGKKDFSSEFGAPD 409

Query: 192 ------GFYNTISLGVGMKF 205
                   + T+ +G   KF
Sbjct: 410 GTLTDKASFQTVRIGAKYKF 429



 Score = 53.5 bits (127), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 44/211 (20%), Positives = 72/211 (34%), Gaps = 40/211 (18%)

Query: 5   FLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALY 64
           FL   VS++AL    +AQAAD V+     G                 +++G Y G+   +
Sbjct: 10  FLLGAVSAVAL--MSAAQAADVVQPVEASG----------------FNWSGAYIGIGGGF 51

Query: 65  NGS-----------FGEEAHHNAGGSIFAGYNVE-DSCIMYGV-----EGDVRYTVPVLA 107
             S           F     +   G + AGY+       + G       G++  ++ +  
Sbjct: 52  GASVHKFSVAPIIDFNGIGGNGVFGELTAGYDYMVSDRFLLGGFIDANGGNIGPSISIPG 111

Query: 108 DNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEI----TPIAIGGTA 163
            +I   +  G  + +R GY ++   L Y   G         G         T    G   
Sbjct: 112 ADIDLTNSYGFDVGLRAGYLLNPDTLGYVLGGYSWQHFKLDGSGFAEGLNFTQNRSGYVL 171

Query: 164 GVGVEVGGLSESLVARLEYRASKYSKVEGFY 194
           GVG+E   L  +   + EYR + Y       
Sbjct: 172 GVGMET-VLRGNWTLKTEYRYAAYGDKSVID 201


>gi|163746512|ref|ZP_02153870.1| outer membrane protein, putative [Oceanibulbus indolifex HEL-45]
 gi|161380397|gb|EDQ04808.1| outer membrane protein, putative [Oceanibulbus indolifex HEL-45]
          Length = 201

 Score = 65.4 bits (158), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 33/172 (19%), Positives = 58/172 (33%), Gaps = 14/172 (8%)

Query: 29  RAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALY---NGSFGEEAHHNAGGSIFAGYN 85
                   V         V +  ++ G Y GL       +   G     +      AGY+
Sbjct: 28  ENTTVEAPVFTPAPMPTPVAVDGNWTGFYTGLQVGQTDIDSDSGTLDGDDTSYGFHAGYD 87

Query: 86  VEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQK 145
            +    + G E D   T   L     +   +    +++ GY+  ++ L+YAT G   A  
Sbjct: 88  YDFGKFVLGGELDYDKTDIDLGTAGATADSV-ARAKVKAGYDFGNT-LVYATAGAARADT 145

Query: 146 YETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFYNTI 197
                 G+ T       AG+GV    +++      E    K+  V G  + +
Sbjct: 146 SV----GDETGPF----AGLGVTY-KVTDRYTVGGEVLQHKFDDVGGTGDDL 188


>gi|220914733|ref|YP_002490041.1| porin [Methylobacterium nodulans ORS 2060]
 gi|219952484|gb|ACL62874.1| porin [Methylobacterium nodulans ORS 2060]
          Length = 287

 Score = 65.4 bits (158), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 34/173 (19%), Positives = 49/173 (28%), Gaps = 49/173 (28%)

Query: 53  FNGPYAGLSALYNGSFGEEAH---------------------------HNAGGSIFAGYN 85
           + G YAG +A Y    G                                   G    GYN
Sbjct: 43  WTGFYAGFNAGYGFDTGPNRGPTVIGVGPATGLVIVPTVIAFRNESNLDGFTGGGQIGYN 102

Query: 86  VED---SCIMYGVEGDVRYTVPVLADNIH-----------------SLHGIGGSLRIRGG 125
            +    + ++ G+E D +Y       N                   +     G++R R G
Sbjct: 103 YQFTPGAGVVIGLEADAQYVDFGRDRNRFIATGPIAAQRVFNPAGLAGLDFFGTVRGRLG 162

Query: 126 YEVSDSLLLYATVGPDVAQKYETGKA-GEITPIAIGGTAGVGVEVGGLSESLV 177
           Y   D  L+Y T G                     G TAG GVE    ++S +
Sbjct: 163 YAW-DRTLIYGTGGFAYGSGGGRDFGLPNDDDFQTGWTAGGGVEYALPTDSFL 214


>gi|323137911|ref|ZP_08072986.1| porin [Methylocystis sp. ATCC 49242]
 gi|322396914|gb|EFX99440.1| porin [Methylocystis sp. ATCC 49242]
          Length = 259

 Score = 65.4 bits (158), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 35/226 (15%), Positives = 65/226 (28%), Gaps = 46/226 (20%)

Query: 3   KLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYA---- 58
                V  +  ++    +A AAD   R         P +           + G +     
Sbjct: 2   TFKATVVGALASVLMIGAASAADLPSRKAPPEYIPPPPV---------FSWEGWHIGVVG 52

Query: 59  ------GLSALYNGSFGE-----EAHHNAGGSIF-----AGYNVE-DSCIMYGVEGDVRY 101
                   ++ +   FG        + + G S +     +GY  +  +  + G E +  Y
Sbjct: 53  GYGGGSSSTSSWIWDFGAVPAVWNVNTSRGTSGYLVGYESGYTWQFSNNFVLGYESEFSY 112

Query: 102 ------TVPVLADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAG--- 152
                         + +     G+ R+R GY     +L Y T G    +   +G      
Sbjct: 113 ADVRSNNTNSWFGGVSNRLEWFGAERLRFGYAF-GRILPYVTGGLAYGRVKASGTDSIGG 171

Query: 153 -----EITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGF 193
                  +    G T G G+E     +    + EY  +      G 
Sbjct: 172 FLFPTNASTWQAGWTVGAGLEY-AFWDKFSIKAEYLYTSMKGPSGT 216


>gi|310816896|ref|YP_003964860.1| outer membrane protein [Ketogulonicigenium vulgare Y25]
 gi|308755631|gb|ADO43560.1| outer membrane protein [Ketogulonicigenium vulgare Y25]
          Length = 241

 Score = 65.4 bits (158), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 40/165 (24%), Positives = 59/165 (35%), Gaps = 31/165 (18%)

Query: 53  FNGPYAGLSALYN-----------------GSFGEEAHHNAGGSIFAGYNVEDSCIMYGV 95
           F G Y G S  Y                  G  GE        +IF GY       ++G 
Sbjct: 48  FTGAYVGASLGYTFSEDDRVGVHTPAGTFLGDIGEFELAGPSAAIFGGYRWNSGKWVFGP 107

Query: 96  E---------GDVRYTVPVLADNIHSLH-GIGGSLRIRGGYEVSDSLLLYATVGPDVAQK 145
           E          D+ Y  P+ A +  +       +LR   GYEV+ + L+Y  +G    + 
Sbjct: 108 EVSVRFGDVSDDISYAGPIPAASTGTKELNWEAALRATLGYEVTPTTLVYGFLGYSAVEY 167

Query: 146 YETGKAG---EITPIAIGGTAGVGVEVGGLSESLVARLEYRASKY 187
                     + T    G TAG+GVE   L+++   R  Y  + Y
Sbjct: 168 DYVLNGAITLDETVSQNGLTAGLGVE-HALNDTWAVRGLYVYNDY 211


>gi|170741253|ref|YP_001769908.1| porin [Methylobacterium sp. 4-46]
 gi|168195527|gb|ACA17474.1| porin [Methylobacterium sp. 4-46]
          Length = 300

 Score = 65.1 bits (157), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 42/309 (13%), Positives = 82/309 (26%), Gaps = 116/309 (37%)

Query: 3   KLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSA 62
           ++  +  ++ L +     A+AAD       G     P            +++G Y G   
Sbjct: 2   RIVTSTLLAGLCVCGLTPARAADLDFATLRGTSYDAPA--------PAGNWDGFYFGGHG 53

Query: 63  LYNGSF--------------------------------GEEAHHNAGGSIFAGYNVEDSC 90
            +  +                                 G     +     + G N +   
Sbjct: 54  GWTSTSFGFGSVFQAPVANYLRQTKFESDLNASTLLHPGSMRRDSTTFGAYVGINFQLDE 113

Query: 91  IMYGVEGDV------RYTVPVLADNIHSLHGI----------------GGSLRIRGGYEV 128
            + G E D        +T   +   I    G                   +LR R GY+ 
Sbjct: 114 FVAGAELDYTHLSARGWTSDEIGRAIVGSDGWWRAVYLTGNASTRIDDYATLRARFGYD- 172

Query: 129 SDSLLLYATVGPDVAQKYETGKAG------------------------------------ 152
           + + + + T G  + +   +   G                                    
Sbjct: 173 AGNFMPFVTGGFAIGRAQISETIGVQPIEYDQATYKSNQSAARPAYVNYSGYSNFDQTNP 232

Query: 153 -------------EITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFY---NT 196
                            I  G  AG G+E   ++ +++ R EY+  +++  +G     NT
Sbjct: 233 GASTPSAPHLLVRSREKIVGGIAAGAGMEF-AMTANILLRAEYQFVQFNDFDGHKANINT 291

Query: 197 ISLGVGMKF 205
           +  G  +KF
Sbjct: 292 VRGGAALKF 300


>gi|294851522|ref|ZP_06792195.1| predicted protein [Brucella sp. NVSL 07-0026]
 gi|294820111|gb|EFG37110.1| predicted protein [Brucella sp. NVSL 07-0026]
          Length = 87

 Score = 65.1 bits (157), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 21/88 (23%), Positives = 33/88 (37%), Gaps = 16/88 (18%)

Query: 133 LLYATVGPDVAQKYET----GKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYS 188
           + Y   G        +    G+    +    G T G G++    +++++ RLEYR + Y 
Sbjct: 1   MPYIAGGVAFGGIKNSLRIGGEESSKSKTQTGWTVGAGIDYAA-TDNVLLRLEYRYTDYG 59

Query: 189 KV-----------EGFYNTISLGVGMKF 205
           K                N I LGV  KF
Sbjct: 60  KKNFGLNDLDTRGSFKTNDIRLGVAYKF 87


>gi|27379812|ref|NP_771341.1| outer-membrane immunogenic protein [Bradyrhizobium japonicum USDA
           110]
 gi|27352965|dbj|BAC49966.1| blr4701 [Bradyrhizobium japonicum USDA 110]
          Length = 250

 Score = 65.1 bits (157), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 31/179 (17%), Positives = 59/179 (32%), Gaps = 35/179 (19%)

Query: 39  PTIATNRYVPIRHDFNGPYAGLS--ALYNGSFGEEAH-------------HNAGGSIFA- 82
           P       V   ++++G Y G +     + +  +                HNA G++   
Sbjct: 29  PYTKAPVAVASIYNWSGFYIGGNAGGGSSHNCWDLTAVGVAAIPVTAEGCHNATGALVGG 88

Query: 83  --GYNVEDSCIMYGVEGDVRYTVPVLAD----------NIHSLHGIGGSLRIRGGYEVSD 130
             GY  + S  ++G+E    +     ++            ++     G    + GY   +
Sbjct: 89  QIGYRWQSSSWVFGLEAQGDWADLKGSNVSAPAALFPLVNNTKIDAIGLFTGQVGYAW-N 147

Query: 131 SLLLYATVGPDVAQKYETG-----KAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRA 184
           ++L Y   G  V     +G               GGT G G+E  G + +    +EY  
Sbjct: 148 NVLWYVKGGAAVTHNKFSGTLAGITLDTANETRWGGTVGTGIEF-GFAPNWSVAVEYNH 205


>gi|148252448|ref|YP_001237033.1| putative outer-membrane immunogenic protein [Bradyrhizobium sp.
           BTAi1]
 gi|146404621|gb|ABQ33127.1| putative outer-membrane immunogenic protein precursor
           [Bradyrhizobium sp. BTAi1]
          Length = 243

 Score = 65.1 bits (157), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 37/212 (17%), Positives = 57/212 (26%), Gaps = 39/212 (18%)

Query: 31  HHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGS---------FGEEAHHNAGGSIF 81
             G R          YV   +++ G Y G       S          G  ++    G + 
Sbjct: 24  DLGARSYPYATKAPAYVAPIYNWTGFYLGAHLGGAFSSDNNFSGLATGNNSNGRFLGGVQ 83

Query: 82  AGYNVED-SCIMYGVEGDVRYTVPVLADNIHSLHGIG------GSLRIRGGYEVSDSLLL 134
            G + +     + G EG   +    +                 GS+  R GY      LL
Sbjct: 84  VGADWQFAPTWVIGAEGQYSWLSGNVGAAFPGGFVYTNSQRGLGSITGRFGYTW-GPGLL 142

Query: 135 YATVGPDVAQKYETG-------KAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKY 187
           Y   G   +   E                   G T G G+E    + S  A+ EY+   +
Sbjct: 143 YVKGGYAYSDNNEKVTLAGNQIGFATNGDHRNGWTVGAGIEY-MFAPSWSAKAEYQYYNF 201

Query: 188 SKV--------------EGFYNTISLGVGMKF 205
                                +T   GV  +F
Sbjct: 202 GSATFTAPAGLVPTGSFTTDDHTFKAGVNYRF 233


>gi|316936292|ref|YP_004111274.1| hypothetical protein Rpdx1_5001 [Rhodopseudomonas palustris DX-1]
 gi|315604006|gb|ADU46541.1| hypothetical protein Rpdx1_5001 [Rhodopseudomonas palustris DX-1]
          Length = 561

 Score = 64.7 bits (156), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 44/241 (18%), Positives = 77/241 (31%), Gaps = 53/241 (21%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+++ +    ++        A AAD          G  P +      P++ ++ G Y G+
Sbjct: 1   MRRILVT---AAALATVISPAAAADMP--------GFPPLMPA---APVQWNWTGLYWGV 46

Query: 61  SALYNG-------------SFGEEAHHNAGGSIFAGYNVE-DSCIMYGVEGDVR------ 100
               +                G      A   I  GYN + ++  + GVE D+       
Sbjct: 47  HVGGSFGSSSFSDPAGPGLYGGNVRSPAALAGIQVGYNYQPNANWLIGVEADLSSMNAKG 106

Query: 101 ------YTVPVLADNIHSLHGIGGSLRIRGGYEVSD--SLLLYATVGPDVAQKYETGKAG 152
                  +   ++ N         +L  R G         LLYA  G     +      G
Sbjct: 107 TDTCMASSGLFISSNCRVRQDALATLTGRAGLVTGPGGRTLLYAKGGAAFLSERLDITTG 166

Query: 153 -------EITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVE-GFYNTISL--GVG 202
                  +      G T G G+E   L+ +   +LEY  + +   +    ++  L  GVG
Sbjct: 167 NPLGNSTDTNDGRWGWTVGAGIE-RALAPAWSVKLEYGYADFGSRDMATPSSFRLVPGVG 225

Query: 203 M 203
            
Sbjct: 226 Y 226


>gi|220926460|ref|YP_002501762.1| porin [Methylobacterium nodulans ORS 2060]
 gi|219951067|gb|ACL61459.1| porin [Methylobacterium nodulans ORS 2060]
          Length = 246

 Score = 64.7 bits (156), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 50/230 (21%), Positives = 77/230 (33%), Gaps = 48/230 (20%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+ +     +    L    +A AAD  R                  VP    + G YAG+
Sbjct: 2   MRSILRLGALGCACLGP--AALAADLPRH----------AAPPPLPVPPVFTWTGFYAGV 49

Query: 61  SALYNGSFGEEAHHNAGGSIFA--------------GYNVED---SCIMYGVEGDVRYTV 103
           +A Y    G ++  +      +              GYN +    S  + G E D++ T 
Sbjct: 50  NAGYGFGSGSDSFTDPTYGTISTGGGRDGFVGGGQVGYNYQFTPGSGFVVGAEADIQGTT 109

Query: 104 PVLAD----------NIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGE 153
              +           ++       G++R R GY V D +L+Y T G           A  
Sbjct: 110 FGRSRTGLVGSAPFYDVGPSLDWFGTVRGRIGYAV-DRILVYGTGGFAYGGGSLPSFAAS 168

Query: 154 ITP-----IAIGGTAGVGVEVGGLSESLVARLE--YRASKYSKVEGFYNT 196
            T         G  AG GVE   +++ L ARLE  Y        +  Y+ 
Sbjct: 169 YTGPLPGTTRTGWAAGGGVEY-AITDRLSARLEGLYVNLDRGHRDTIYDA 217


>gi|319406881|emb|CBI80516.1| putative Hemin binding protein b [Bartonella sp. 1-1C]
          Length = 379

 Score = 64.7 bits (156), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 27/116 (23%), Positives = 42/116 (36%), Gaps = 25/116 (21%)

Query: 113 LHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQ------KYETGKAGEIT---------PI 157
                G+ RIR G  V   ++ Y   G   A+      K       + T          I
Sbjct: 266 KRKWFGATRIRLGLSV-GRVMPYIAGGVAYAKVQGIFKKSIKIGISKETVPLSSFDSEEI 324

Query: 158 AIGGTAGVGVEVGGLSESLVARLEYRASKYS-----KVEGFY---NTISLGVGMKF 205
             G T G G +   +++ ++ R EYR S +      KV+      N   +G+  KF
Sbjct: 325 MTGYTLGGGFDF-AVTDRILLRAEYRYSDFGAKEFKKVDLKDYNANDFRIGLAYKF 379



 Score = 36.6 bits (83), Expect = 2.4,   Method: Composition-based stats.
 Identities = 14/91 (15%), Positives = 24/91 (26%), Gaps = 23/91 (25%)

Query: 48  PIRHDFNGPYAGLSAL---------------------YNGSFGEEAHHNAGGSIFAGYNV 86
              + + G Y G                          +  F  E     GG  +AG N 
Sbjct: 36  APFYSWGGFYFGGQIGSFSSSTTLQYNTLDETKKLNLSSRDFTSEFSGGTGGF-YAGVNF 94

Query: 87  EDSC-IMYGVEGDVRYTVPVLADNIHSLHGI 116
           E     + GV+ D+ ++             +
Sbjct: 95  EYGNRFVLGVDTDIVFSNKQNTKVFSGKDSV 125


>gi|220925103|ref|YP_002500405.1| porin [Methylobacterium nodulans ORS 2060]
 gi|219949710|gb|ACL60102.1| porin [Methylobacterium nodulans ORS 2060]
          Length = 287

 Score = 64.7 bits (156), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 45/225 (20%), Positives = 65/225 (28%), Gaps = 59/225 (26%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+ L  +   +   +    SA AAD  RR                       + G YAG 
Sbjct: 1   MKSLLKS-ATALAGVLVAGSALAADLPRRV---------APPPVFTPVPVFTWTGFYAGF 50

Query: 61  SALYNGSFGEEA---------------------------HHNAGGSIFAGYNVED---SC 90
           +A Y  S  +                             +    G    GYN +    S 
Sbjct: 51  NAGYGFSTNDNNTPTVLGVGPATGLVFAPTVIAFQNRNNNDGFVGGGQVGYNYQFTPGSG 110

Query: 91  IMYGVEGDVRYTVPVLADNIH-----------------SLHGIGGSLRIRGGYEVSDSLL 133
           ++ G+E D ++       N                   S     G++R R GY   D  L
Sbjct: 111 VVIGLEADAQFADFGRNRNRFLATGPIAAQTVFNPAGISGLDWFGTVRGRLGYAF-DRTL 169

Query: 134 LYATVGPDVAQKYETGKA-GEITPIAIGGTAGVGVEVGGLSESLV 177
           +YAT G                     G TAG GVE    ++S +
Sbjct: 170 VYATGGFAYGSGGGRDFGLPNRDDFQTGWTAGGGVEYALPTDSFL 214


>gi|170741476|ref|YP_001770131.1| porin [Methylobacterium sp. 4-46]
 gi|168195750|gb|ACA17697.1| porin [Methylobacterium sp. 4-46]
          Length = 296

 Score = 64.7 bits (156), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 41/232 (17%), Positives = 63/232 (27%), Gaps = 65/232 (28%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+ L  +   +   +    SA AAD  RRA                      + G YAG 
Sbjct: 1   MKSLLKS-ATALAGVVIAGSAMAADLPRRAAPPPVFTP---------VPVFTWTGFYAGF 50

Query: 61  SALY-----------------------------NGSFGEEAHHNAGGSIFAGYNVED--- 88
           +A Y                              G    + +    G    GYN +    
Sbjct: 51  NAGYGFGTSDNNNSTLIGVNAATGLVPPGTTAVLGFRNRDNNDGFVGGGQVGYNYQFTPG 110

Query: 89  SCIMYGVEGDVRYTV-----------------------PVLADNIHSLHGIGGSLRIRGG 125
           + ++ G+E D +Y                          V   N  S     G++R R G
Sbjct: 111 AGVVIGIEADAQYADFGRERNRFSLVTNNPAVTGLAAQQVFNPNGLSGLDYFGTVRGRLG 170

Query: 126 YEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLV 177
           Y    +L+              +           G T G GVE    ++S +
Sbjct: 171 YAFDRTLVYATGGFAYGGGGGTSFGLPNRDDFQTGWTVGGGVEYALPTDSFL 222


>gi|170750637|ref|YP_001756897.1| porin [Methylobacterium radiotolerans JCM 2831]
 gi|170657159|gb|ACB26214.1| porin [Methylobacterium radiotolerans JCM 2831]
          Length = 278

 Score = 64.7 bits (156), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 35/173 (20%), Positives = 50/173 (28%), Gaps = 49/173 (28%)

Query: 53  FNGPYAGLSALYN------------------------GSFGEEAHHNAGGSIFAGYNVE- 87
           + G Y G++A Y                          SF   +     G    GYN + 
Sbjct: 42  WTGAYFGINAGYAFDASDRNTGNTFAVPFPYAAPGTVASFRNRSQDGFSGGGQIGYNWQI 101

Query: 88  --DSCIMYGVEGDVRYTVPVLADNIH------------------SLHGIGGSLRIRGGYE 127
              S ++ GVE D +Y       N                    S     G++R R GY 
Sbjct: 102 TPGSGVVIGVEADAQYLDFGRNRNNAFVSGAVAPGYYLTDPRGLSSLDFFGTVRGRLGYA 161

Query: 128 VSDSLLLYATVGPDVAQKYETGKAG---EITPIAIGGTAGVGVEVGGLSESLV 177
             D  L+Y T G            G          G   G G+E    ++S +
Sbjct: 162 F-DRTLVYGTGGFAYGSGSADRSFGGYAGNDSFRTGWAVGGGIEYALPTDSFL 213


>gi|146342779|ref|YP_001207827.1| putative outer membrane protein (OMPA-like), hemin-binding protein
           [Bradyrhizobium sp. ORS278]
 gi|146195585|emb|CAL79612.1| conserved hypothetical protein; putative outer membrane protein
           (OMPA-like), hemin-binding protein [Bradyrhizobium sp.
           ORS278]
          Length = 266

 Score = 64.7 bits (156), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 53/270 (19%), Positives = 82/270 (30%), Gaps = 90/270 (33%)

Query: 18  FCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALY------------- 64
              AQAAD        G        T      R +++G YAG+   Y             
Sbjct: 5   VSVAQAADLSDLPILRGSM------TEGLNSSRVNWDGYYAGVQGGYGSSDENFNGSTST 58

Query: 65  --------------------NGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEG------- 97
                               N + G+++  ++G   F GYN +   ++ GVE        
Sbjct: 59  MTAAVLANTLIESQMQVSSWNMNLGKQSSRSSGFGGFVGYNSQWDDVVLGVEASYLHGKF 118

Query: 98  -----------------DVRYTVPVLADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGP 140
                            D  Y       +         ++R R GY +    L YA  G 
Sbjct: 119 GGMTSSTRALVSGTALTDGNYHSVTSTQSSQISIKDMATIRGRAGYAL-GCFLPYAFFGL 177

Query: 141 DVAQKYE---TGKAGEITPIAI---------------------GGTAGVGVEVGGLSESL 176
            +              ++   +                     G +AG+GV+V  L   L
Sbjct: 178 ALGNADIGQTVTVQDSVSATQLGAYTALQPLSANNIQHNHLIYGYSAGLGVDVN-LVGGL 236

Query: 177 VARLEYRASKY-SKVEGFYNTISLGVGMKF 205
            AR EY   ++ S V+   NT+  G+G KF
Sbjct: 237 FARAEYEYIRFTSTVDTSVNTVRAGLGYKF 266


>gi|94497615|ref|ZP_01304184.1| membrane protein [Sphingomonas sp. SKA58]
 gi|94423032|gb|EAT08064.1| membrane protein [Sphingomonas sp. SKA58]
          Length = 279

 Score = 64.7 bits (156), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 37/226 (16%), Positives = 63/226 (27%), Gaps = 68/226 (30%)

Query: 41  IATNRYVPIRHDFNGPYAGLSALYN-----------------GSFGEEAHHNAGGSIFA- 82
           +          D+ GPY G S  YN                 G + +      G + F+ 
Sbjct: 19  VPAMAQDSGAVDWTGPYVGGSFGYNWQKSDGGEHLRFDTDADGDYNDVVTTTTGANAFSP 78

Query: 83  -----------------------------GYNVEDSCIMYGVEGDVR--YTVPVLAD--- 108
                                        GY+++    + GV  +    Y    + +   
Sbjct: 79  GTCGGAARGPTPASGCNDDKDAIAWMGHVGYDMQFGSFVAGVVAEAGKAYVDDKVTEFST 138

Query: 109 -----NIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAI---- 159
                 +       G+LR R GY     ++ Y T G   A+                   
Sbjct: 139 TPAFYTMRRKIDWNGNLRARLGYTTPSGIMPYITGGLAYAKVKNNFTTSNGANSFTENNR 198

Query: 160 -----GGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFYNTISLG 200
                G T G GVE   +S++      Y  ++Y  V+ +   +  G
Sbjct: 199 SEDGWGWTMGGGVEA-KVSDNFSIGARYLWTRY-NVDDYRVDVGAG 242


>gi|83953797|ref|ZP_00962518.1| outer membrane protein, putative [Sulfitobacter sp. NAS-14.1]
 gi|83841742|gb|EAP80911.1| outer membrane protein, putative [Sulfitobacter sp. NAS-14.1]
          Length = 198

 Score = 64.3 bits (155), Expect = 9e-09,   Method: Composition-based stats.
 Identities = 46/195 (23%), Positives = 71/195 (36%), Gaps = 18/195 (9%)

Query: 12  SLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVP-IRHDFNGPYAGLSALYNGSFGE 70
           + A     +A A             V P +      P +  D+ G Y GL   Y+ +  +
Sbjct: 4   ASAAVLASTAFAG-ATYAGSLAEPVVEPVMTAPVPAPDLGGDWTGFYTGLQLGYSDAEVD 62

Query: 71  EAHHNAGG--SIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGSL---RIRGG 125
                  G     AGYN +    + G E D   T   L D      G   S+   +I+GG
Sbjct: 63  NGLEGDNGSYGFHAGYNYDFGRFVLGGELDYDKTDIDLNDAAGVTQGSIDSVARAKIKGG 122

Query: 126 YEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVAR--LEYR 183
           Y++  S L+YAT G   A        G+          GVG++     +  V    LE++
Sbjct: 123 YDL-GSTLIYATGGYARAD----TTMGDEDGAFY----GVGMDYKITEQYSVGAELLEHK 173

Query: 184 ASKYSKVEGFYNTIS 198
            +  S V G    ++
Sbjct: 174 FNDVSGVSGNDADVT 188


>gi|170747833|ref|YP_001754093.1| porin [Methylobacterium radiotolerans JCM 2831]
 gi|170654355|gb|ACB23410.1| porin [Methylobacterium radiotolerans JCM 2831]
          Length = 276

 Score = 64.3 bits (155), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 35/171 (20%), Positives = 51/171 (29%), Gaps = 47/171 (27%)

Query: 53  FNGPYAGLSALYNGSFGEEAHHNAG----------------------GSIFAGYNVED-- 88
           + G Y G++A Y         ++ G                      G    GYN +   
Sbjct: 42  WTGAYFGINAGYAFDASSNNTNSFGVPAPYGNGTTAFFSQRNQEGFTGGGQVGYNFQFTP 101

Query: 89  -SCIMYGVEGDVRYTVPVLADNIH------------------SLHGIGGSLRIRGGYEVS 129
            S I+ GVE D +Y     + N                    S     G++R R GY   
Sbjct: 102 GSGIVVGVEADAQYLDFGRSRNNAFLVGPLAPGYYVTDPRGLSSLDFFGTVRGRIGYAF- 160

Query: 130 DSLLLYATVGPDVAQKYET---GKAGEITPIAIGGTAGVGVEVGGLSESLV 177
           D +L Y T G            G          G   G G+E    ++S +
Sbjct: 161 DRVLFYGTGGFAYGSGSADRSFGGFAGNDSFRTGYAVGGGIEYALPTDSFL 211


>gi|312113967|ref|YP_004011563.1| porin [Rhodomicrobium vannielii ATCC 17100]
 gi|311219096|gb|ADP70464.1| porin [Rhodomicrobium vannielii ATCC 17100]
          Length = 294

 Score = 64.3 bits (155), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 34/210 (16%), Positives = 57/210 (27%), Gaps = 63/210 (30%)

Query: 40  TIATNRYVPIRHDFNGPYAGLSAL---------------YNGSFGEEAHHNAGG----SI 80
             +     P    + G Y G                   +  S   + +   GG     I
Sbjct: 30  PASYKDIAPPPPLWTGFYVGAHLGGGWTDFDLGRNSYYYWPTSTTYDRYDYNGGLSGTGI 89

Query: 81  FAG----YNVEDSC---IMYGVEGDVRYTVPVLADNIH-------------------SLH 114
           F G    YN +       +YG+E D+       +  I+                   +  
Sbjct: 90  FGGLTIGYNWQFGQCCNYVYGIELDIGGWRDDASKTIYIDDDRRGLDPDASTRIRFTNKG 149

Query: 115 GIGGSLRIRGGYEVSDSLLLYATVGPD----------------VAQKYETGKAGEITPIA 158
           G  G +  R GY   ++ L+YA  G                      Y+     +     
Sbjct: 150 GFYGDITGRIGYAAGNT-LIYAKGGFAWLNNSFRVGVLRENGATGYNYDWSSTTDNGNTL 208

Query: 159 IGGTAGVGVEVGGLSESLVARLEYRASKYS 188
            G T G G+E    + +   + EY    + 
Sbjct: 209 AGWTVGGGLEY-KWNYNWSVKAEYLYFNFG 237


>gi|15420210|gb|AAK97315.1|AF321116_1 Pap31 [Bartonella henselae phage 60457]
          Length = 221

 Score = 63.9 bits (154), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 32/214 (14%), Positives = 58/214 (27%), Gaps = 77/214 (35%)

Query: 40  TIATNRYVPIRHDFNGPYAGLSALYNGSFGEEAH----------------HNAGGSIFAG 83
            +A          + G Y G       S  E                       G I+AG
Sbjct: 9   EVAPTVISAPAFSWTGFYIGGQVGNFSSKVEITDPNKKDKLFSKDDTPKPSGFMGGIYAG 68

Query: 84  YNVEDSC-IMYGVEGDVRYTV--------------------------------------- 103
            N++    ++ GVE D  +                                         
Sbjct: 69  SNMDLGNNMILGVETDAVWADREDAKTFSAGAIGEDKLEKFKASLKNANADVAKDKKIDD 128

Query: 104 ----PVLADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGP------DVAQKYETGKAG- 152
                   D++       G+ R+R G+  +D ++ Y   G        V+    T  A  
Sbjct: 129 IVKEDKHTDSLALKEKWSGATRVRIGFTAADRIMPYVAGGVSYAQVQAVSSTKVTQAADD 188

Query: 153 ---------EITPIAIGGTAGVGVEVGGLSESLV 177
                    + T   +G T G GV+   ++++++
Sbjct: 189 AEIASAQLFDKTKTLVGFTLGGGVDF-AMTDNVL 221


>gi|85715155|ref|ZP_01046139.1| putative outer membrane protein [Nitrobacter sp. Nb-311A]
 gi|85698070|gb|EAQ35943.1| putative outer membrane protein [Nitrobacter sp. Nb-311A]
          Length = 236

 Score = 63.9 bits (154), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 41/202 (20%), Positives = 61/202 (30%), Gaps = 37/202 (18%)

Query: 39  PTIATNRYVPIR---HDFNGPYAGLSALYNGSFGEEAHHN-AGGSIFAGYNVED-SCIMY 93
           P      Y P +   +++ G Y G         G         G +  G + +  +  + 
Sbjct: 27  PYTKAPTYTPPQQAVYNWTGFYVGGHLGGAFGGGLGGSDGRFLGGVQGGADYQFANQWVL 86

Query: 94  GVEGD----VRYTVPVLADNIHSLHGIG---GSLRIRGGYEVSDSLLLYATVGPD---VA 143
           GVE        Y   V       + G     GS+  R GY V    LLYA  G      A
Sbjct: 87  GVEAQYSWLANYRGDVAFPGGSVVTGGNSGLGSVTGRLGY-VWGPTLLYAKGGYAFRDGA 145

Query: 144 QKYETGKAGEITPIA-----IGGTAGVGVEVGGLSESLVARLEYRASKYSKV-------- 190
                         A      G T G G+E    + +  A+ EY+   + K         
Sbjct: 146 LGVTNAAGVPQAFTATGNRDSGYTVGAGLEY-MFAPNWSAKAEYQYYNFGKTTFGAGSPA 204

Query: 191 -------EGFYNTISLGVGMKF 205
                      +T+  GV  +F
Sbjct: 205 DVVGASFRNDEHTVKAGVNYRF 226


>gi|170738855|ref|YP_001767510.1| porin [Methylobacterium sp. 4-46]
 gi|168193129|gb|ACA15076.1| porin [Methylobacterium sp. 4-46]
          Length = 279

 Score = 63.9 bits (154), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 42/214 (19%), Positives = 58/214 (27%), Gaps = 63/214 (29%)

Query: 8   VGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALY--- 64
           +  + LA+A    A AAD  RR        VP             + G   G +  Y   
Sbjct: 6   LSSALLAIAVAGPACAADLPRRVQPPSFTPVP----------VFTWTGFSVGGNVGYAFT 55

Query: 65  -----------------------NGSFGEEAHHNAGGSIFAGYNVED---SCIMYGVEGD 98
                                     F     +   G +  G N +    S ++ GVE D
Sbjct: 56  TRESRNRNAAFLIDDRAIGTVGGTFGFSNRGQNGFTGGLQVGANYQMTPGSGVVVGVEAD 115

Query: 99  VRY--------------------TVPVLADNIHSLHGIGGSLRIRGGYEVSDSLLLYATV 138
            +Y                              +     G+ R R GY   D  L+YAT 
Sbjct: 116 AQYLDAGRRRSGVLAGPNTVLNPNAIFFDPRATAGLEYFGTARGRLGYAF-DRTLVYATG 174

Query: 139 GPDVAQKYETGKAG--EITPIAIGGTAGVGVEVG 170
           G            G  +   +  G T G GVE  
Sbjct: 175 GFAYGGGSARRFFGATDNAQMRTGWTVG-GVEYA 207


>gi|87118661|ref|ZP_01074560.1| putative outer-membrane immunogenic protein precursor [Marinomonas
           sp. MED121]
 gi|87118664|ref|ZP_01074563.1| putative outer-membrane immunogenic protein precursor [Marinomonas
           sp. MED121]
 gi|86166295|gb|EAQ67561.1| putative outer-membrane immunogenic protein precursor [Marinomonas
           sp. MED121]
 gi|86166298|gb|EAQ67564.1| putative outer-membrane immunogenic protein precursor [Marinomonas
           sp. MED121]
          Length = 258

 Score = 63.5 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 36/206 (17%), Positives = 70/206 (33%), Gaps = 61/206 (29%)

Query: 52  DFNGPYAGLSAL-------------YNGSFGEEAH-----------------HNAGGSIF 81
           ++ G Y G++               Y+G F + ++                     GS+ 
Sbjct: 29  NWEGLYTGIAIGISSSTASPSTEVEYSGYFNDNSNGSDRDQLDPILQREIEGDTTSGSLL 88

Query: 82  AGYNVEDSCIMYGVEGDV--------------RYTVPVLADN----IHSLHGIGGSLRIR 123
            GY+ +    +YG+E D+               Y     A N             SLR +
Sbjct: 89  LGYHFQKGKFVYGLEADLTFAEFSESESEGPTDYDTTAGASNFTTVTEIKTDYMFSLRPK 148

Query: 124 GGYEVSDSLLLYATVGPDVA-----------QKYETGKAGEITPIAIGGTAGVGVEVGGL 172
            GY V D+ L++ + GP ++                  + E    ++G +A +G++   +
Sbjct: 149 VGY-VKDNFLMHISAGPVISEFTTTHSYTDTHGSGASLSFEDKDSSVGLSANIGIDYL-I 206

Query: 173 SESLVARLEYRASKYSKVEGFYNTIS 198
           S  L  R +Y    +S +      ++
Sbjct: 207 SNGLSIRADYTYLHFSDILDGSGDVN 232


>gi|170738817|ref|YP_001767472.1| porin [Methylobacterium sp. 4-46]
 gi|168193091|gb|ACA15038.1| porin [Methylobacterium sp. 4-46]
          Length = 302

 Score = 63.5 bits (153), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 34/203 (16%), Positives = 50/203 (24%), Gaps = 62/203 (30%)

Query: 34  GRGVVPTIATNRYVPIRHDFNGPYAGLSALYN---------------------------- 65
            R V P +           + G YAG +A Y                             
Sbjct: 24  PRRVAPPVIAPV---PVFTWTGFYAGFNAGYGFDASSTNPDVIVLTRDPRVVAGPAGSAL 80

Query: 66  --GSFGEEAHHNAGGSIFAGYNVED---SCIMYGVEGDVRYTVPVLADNIHS-------- 112
             G  G+       G    GYN +    + ++ G+E D +Y       N  S        
Sbjct: 81  AIGWTGDRNTEGFSGGGQIGYNYQFTPGAGVVVGIEADAQYVDFGRNRNAFSFAIPNQPG 140

Query: 113 ------------------LHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEI 154
                                  G++R R GY     L                      
Sbjct: 141 AQFNGANGLRLFDPRGLSGLDYFGTVRGRLGYAFDRVLFYGTGGFAYGGGGGTNFGLPNT 200

Query: 155 TPIAIGGTAGVGVEVGGLSESLV 177
                G TAG G+E    ++S +
Sbjct: 201 DDFQTGWTAGGGIEYALPTDSFL 223


>gi|27382516|ref|NP_774045.1| hypothetical protein bll7405 [Bradyrhizobium japonicum USDA 110]
 gi|27355688|dbj|BAC52670.1| bll7405 [Bradyrhizobium japonicum USDA 110]
          Length = 298

 Score = 63.5 bits (153), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 56/310 (18%), Positives = 90/310 (29%), Gaps = 117/310 (37%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M++L+L   V      S  +A AAD        G        T+      H ++G Y G+
Sbjct: 1   MRRLWLVAAV----FGSVSAAHAADMPDLPVLRGGF------TDGLSKTSHRWDGAYVGV 50

Query: 61  SALYNGSFGEEAHH------------------------------NAGGSIFAGYNVEDSC 90
           +  Y     + +                                +     F G N +   
Sbjct: 51  NGGYTADATDFSQSVVGLTNFIFRDSVLQQPTANWSLMNKTNTQSTNFGAFVGRNWQWYD 110

Query: 91  IMYGVEGDVRY--TVPVLADNIHSLHGIGG-----------------------------S 119
            + G+EG   Y   +  L    +SL  +                               +
Sbjct: 111 AILGLEGTYSYFNNLSTLTSGTNSLTIVNPPGDAHAANVTDNYDVTLTGTAAAKVKDMIT 170

Query: 120 LRIRGGYEVSDSLLLYATVGPDVAQKYETG------------------------------ 149
           LR R G++  D  + YA +G  V +   +                               
Sbjct: 171 LRGRVGWDGGD-FMPYAFMGAAVGRMDVSRSVTSIVDLRQDVTNTIVVGGATLTTTTFGA 229

Query: 150 ----KAGEITPI-------AIGGTAGVGVEVGGLSESLVARLEYRASKYS---KVEGFYN 195
                A   +         A+G TAG+GVE   + + L AR+EY   K+S         N
Sbjct: 230 PQAVPAQSQSQTQRRTNAFAVGWTAGLGVEYC-IWDGLFARVEYEYVKFSPVMNTSVTLN 288

Query: 196 TISLGVGMKF 205
              +G+G KF
Sbjct: 289 NARVGLGYKF 298


>gi|83951536|ref|ZP_00960268.1| possible outer membrane protein [Roseovarius nubinhibens ISM]
 gi|83836542|gb|EAP75839.1| possible outer membrane protein [Roseovarius nubinhibens ISM]
          Length = 221

 Score = 63.5 bits (153), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 35/148 (23%), Positives = 54/148 (36%), Gaps = 13/148 (8%)

Query: 52  DFNGPYAGLSALYN--GSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADN 109
           D+ G Y G    Y    S G     +  G I AGY+ +    + G   D  +    L   
Sbjct: 72  DWTGFYGGAQLGYGDVSSNGALNGDDVIGGISAGYDYDLGSWVLGGGLDYDFADINLGGG 131

Query: 110 IHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEV 169
            +  +     LR   GY+V +  L+Y T G   A   +T   G       G   G G E 
Sbjct: 132 TNLENVFRAKLRA--GYKVGNG-LIYGTGGYAQA---DTNTTGSED----GYFVGAGYE- 180

Query: 170 GGLSESLVARLEYRASKYSKVEGFYNTI 197
             +S+++    E    ++  V G    +
Sbjct: 181 HMVSQNISVGGEALYHEFENVGGTTTDV 208


>gi|323138620|ref|ZP_08073687.1| porin [Methylocystis sp. ATCC 49242]
 gi|322396108|gb|EFX98642.1| porin [Methylocystis sp. ATCC 49242]
          Length = 305

 Score = 63.5 bits (153), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 30/161 (18%), Positives = 48/161 (29%), Gaps = 41/161 (25%)

Query: 71  EAHHNAGGSIFAGYNVEDS-CIMYGVEGDV----RYTVPVLADNIHSLHGIG-------- 117
                  G    GYN +     + G+E D+              I +  G          
Sbjct: 96  TNTSGFIGGGQIGYNWQFGGSFLAGIEADIQGVAGSNSNSTVTTIATGAGFPANPTMTTM 155

Query: 118 ---------GSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKA----------------- 151
                    G++R R G+  + +LL+Y T G                             
Sbjct: 156 TASRRLDYIGTVRGRLGWLFTPTLLVYGTGGLAYGGVTSNVSLVGAETPAAGPNNGVWFS 215

Query: 152 -GEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVE 191
            G  +   +G TAG GVE   +  +  A++EY      +V 
Sbjct: 216 NGAFSDTRVGWTAGGGVEWMFM-PNWSAKVEYLYYDLGRVT 255


>gi|15420182|gb|AAK97313.1|AF308171_1 Pap31 [Bartonella quintana phage]
          Length = 228

 Score = 63.5 bits (153), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 41/240 (17%), Positives = 70/240 (29%), Gaps = 87/240 (36%)

Query: 13  LALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSFGEEA 72
           +AL S  +AQAAD +              A          + G Y G      G+F  + 
Sbjct: 2   IALISASAAQAADVIATHE----------AAPVITTPNFSWTGFYIGGQI---GNFTSDN 48

Query: 73  H-------------------HNAGGSIFAGYNVEDSC-IMYGVEGDVRYTV--------- 103
                                   G I+AG N++    ++ GVE D  +           
Sbjct: 49  KIKGLGKETSIFTKELTPQLSGIVGGIYAGSNIDLGSGLILGVETDAIWADCEATKTSAI 108

Query: 104 -----------------------------PVLADNIHSLHGIGGSLRIRGGYEVSDSLLL 134
                                          ++D+        G+ R R G+   D ++ 
Sbjct: 109 RTLSVPQANSLNDEFKAAGITLKDKFSENDTMSDHYTYKAKWSGATRARIGFSAFDRVMP 168

Query: 135 YATVGPDVAQ---------------KYETGKAGEITPIAIGGTAGVGVEVGGLSESLVAR 179
           Y   G   A+               K   G   + T + +G T   GV+V  ++ +++ R
Sbjct: 169 YFAGGVAYARMQGMKSVSGMNAAKNKKLGGGLYDETKMMVGFTVSGGVDV-AMTGNVLLR 227


>gi|220923245|ref|YP_002498547.1| porin [Methylobacterium nodulans ORS 2060]
 gi|219947852|gb|ACL58244.1| porin [Methylobacterium nodulans ORS 2060]
          Length = 285

 Score = 63.5 bits (153), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 36/173 (20%), Positives = 52/173 (30%), Gaps = 49/173 (28%)

Query: 53  FNGPYAGLSALYNGSFGEEA---------------------------HHNAGGSIFAGYN 85
           + G YAG +A Y  S  +                             +    G    GYN
Sbjct: 41  WTGFYAGFNAGYGFSTNDNNTPTVLGVGPATGLVFAPTVIAFQNRNNNDGFVGGGQVGYN 100

Query: 86  VED---SCIMYGVEGDVRYTVPVLADNIH-----------------SLHGIGGSLRIRGG 125
            +    S ++ G+E D ++       N                   S     G++R R G
Sbjct: 101 YQFTPGSGVVIGLEADAQFADFGRNRNRFLATGPIAAQTVFNPAGISGLDWFGTVRGRLG 160

Query: 126 YEVSDSLLLYATVGPDVAQKYETGKA-GEITPIAIGGTAGVGVEVGGLSESLV 177
           Y   D  L+YAT G                     G TAG GVE    ++S +
Sbjct: 161 YAF-DRTLVYATGGFAYGSGGGRDFGLPNRDDFQTGWTAGGGVEYALPTDSFL 212


>gi|170742457|ref|YP_001771112.1| porin [Methylobacterium sp. 4-46]
 gi|168196731|gb|ACA18678.1| porin [Methylobacterium sp. 4-46]
          Length = 294

 Score = 63.5 bits (153), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 31/180 (17%), Positives = 48/180 (26%), Gaps = 55/180 (30%)

Query: 53  FNGPYAGLSALY-----------------------------NGSFGEEAHHNAGGSIFAG 83
           + G YAG +A Y                              G    + +    G    G
Sbjct: 41  WTGFYAGFNAGYGFGTSDNNNSTLIGVNAATGLVPPGTTAVLGFRNRDNNDGFVGGGQVG 100

Query: 84  YNVED---SCIMYGVEGDVRYTV-----------------------PVLADNIHSLHGIG 117
           YN +    +  + G+E D +Y                          V   N  S     
Sbjct: 101 YNYQFTPGAGFVIGIEADAQYADFGRERNRFSLVTNNPAVTGLAAQQVFNPNGLSGLDYF 160

Query: 118 GSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLV 177
           G++R R GY    +L+              +           G T G GVE    ++S +
Sbjct: 161 GTVRGRLGYAFDRTLVYATGGFAYGGGGGTSFGLPNRDDFQTGWTVGGGVEYALPTDSFL 220


>gi|75675529|ref|YP_317950.1| putative outer membrane protein [Nitrobacter winogradskyi Nb-255]
 gi|74420399|gb|ABA04598.1| putative outer membrane protein [Nitrobacter winogradskyi Nb-255]
          Length = 241

 Score = 63.5 bits (153), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 39/202 (19%), Positives = 61/202 (30%), Gaps = 36/202 (17%)

Query: 38  VPTIATNRYVPIR--HDFNGPYAGLSALYNGSFGEEAHHN-AGGSIFAGYNVED-SCIMY 93
             T A   Y P +  +++ G Y G                   G +  G + +  +  + 
Sbjct: 27  PYTKAPVPYTPPQAVYNWTGFYIGGHLGGAFGGDLGGSDGRFLGGVQGGADYQFANNWVL 86

Query: 94  GVEGD----VRYTVPVLADNIHSLHGIG---GSLRIRGGYEVSDSLLLYATVGPDVAQKY 146
           G+E        Y   V       + G     GS+  R GY      LLYA  G       
Sbjct: 87  GIEAQHSWLANYRENVAFPGGSVVTGGNSGLGSVTGRLGYSW-GPTLLYAKGGYAFRDGA 145

Query: 147 --ETGKAGEITPI------AIGGTAGVGVEVGGLSESLVARLEYRASKYSKV-------- 190
              T  AG             G T G G+E    + +  A+ EY+   + +         
Sbjct: 146 LGVTDAAGAPQAFTTTGNRNSGYTVGAGLEY-MFAPNWSAKAEYQYFNFGRTTFGAGSPA 204

Query: 191 -------EGFYNTISLGVGMKF 205
                      +T+  GV  +F
Sbjct: 205 DVVGASFRNDEHTVKAGVNYRF 226


>gi|89052836|ref|YP_508287.1| hypothetical protein Jann_0345 [Jannaschia sp. CCS1]
 gi|88862385|gb|ABD53262.1| hypothetical protein Jann_0345 [Jannaschia sp. CCS1]
          Length = 206

 Score = 63.1 bits (152), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 44/191 (23%), Positives = 71/191 (37%), Gaps = 24/191 (12%)

Query: 33  GGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSFGEEAH--------HNAGGSIFAGY 84
           GG      +         HD+ G YAG       +              +     +FAGY
Sbjct: 20  GGVVDPAPLDPVIISQPDHDWTGFYAGAQLDLVANAETTLEPFGQLMSFNGELAGLFAGY 79

Query: 85  NVEDSCIMYGVEGDV---RYTVPVLADNI---HSLHGIGGSLRI--RGGYEVSDSLLLYA 136
             +   I+ G E D     Y V  +A NI        +   LR     GY++ D  L YA
Sbjct: 80  RYDFGDIVLGGEIDYMRGTYDVDEIAPNILLLSPEVDVE-LLRAGIEVGYDLGD-FLPYA 137

Query: 137 TVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVE-GFYN 195
           T G       + G  GE +    G  AG+G +   +SE++    E    ++   + G  +
Sbjct: 138 TAGYA-HLTLDYGGFGEDSG--DGWFAGIGADYR-VSENVTVGAELLHHQFEFNDFGLQH 193

Query: 196 TI-SLGVGMKF 205
            + ++G+ + F
Sbjct: 194 ELTTVGINVAF 204


>gi|192293155|ref|YP_001993760.1| outer membrane insertion C-terminal signal [Rhodopseudomonas
           palustris TIE-1]
 gi|192286904|gb|ACF03285.1| outer membrane insertion C-terminal signal [Rhodopseudomonas
           palustris TIE-1]
          Length = 263

 Score = 63.1 bits (152), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 52/259 (20%), Positives = 77/259 (29%), Gaps = 82/259 (31%)

Query: 19  CSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGS----------- 67
            +A AAD        G             P   ++ G Y G    Y  S           
Sbjct: 15  QTAYAADMPDYGPLRG--------ALVETPRVINWEGFYVGGQGGYGTSDMDFSNSTSGI 66

Query: 68  ---------------------FGEEAHHNAGGSIFAGYNVEDSCIMYGVEGD-------- 98
                                 G+ + H  G   FAGYN +   ++ GVE +        
Sbjct: 67  ASNLLVNTVIENQMSVSSWPVLGKASSHGQGWGAFAGYNAQWDDVVLGVEANYMHGSFGG 126

Query: 99  ---------VRYTVPVLADNIHSLHGIG----GSLRIRGGYEVSDSLLLYATVGPDVAQK 145
                    + Y          S   I     GS R+R GY    S L YA +G  + Q 
Sbjct: 127 GATGSMGRQIDYNNVNYRAIYTSSAAINVNDIGSARLRAGYAF-GSFLPYAFIGASLGQA 185

Query: 146 YETGKAG------------------EITPIAIGGTAGVGVEVGGLSESLVARLEYRASKY 187
                A                   +      G   G+G++V  L   L  R E+   K+
Sbjct: 186 DIVRTATITGTQGGVPFTPLSATQVQNGHFIYGYAGGLGMDV-MLYRGLFLRAEWEYLKF 244

Query: 188 SK-VEGFYNTISLGVGMKF 205
           +  ++   +T+  G+G KF
Sbjct: 245 AAPIDTSVSTVRAGLGYKF 263


>gi|146340935|ref|YP_001205983.1| putative outer-membrane protein [Bradyrhizobium sp. ORS278]
 gi|146193741|emb|CAL77758.1| putative outer-membrane protein; putative secreted protein
           [Bradyrhizobium sp. ORS278]
          Length = 242

 Score = 63.1 bits (152), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 36/172 (20%), Positives = 58/172 (33%), Gaps = 28/172 (16%)

Query: 39  PTIATNRYVPIRHDFNGPYAGLSALYNGSF---------GEEAHHNAGGSI--FAGYNVE 87
           P       +   +D++G Y G++  Y  S           E  H+  GG++    GY  +
Sbjct: 29  PYTKAPPAIVAINDWSGFYLGINGGYGSSRNCWTLVNGPAEGCHNATGGTVGGQFGYRWQ 88

Query: 88  DSCIMYGVEGDVRYTVPVLA--------DNIHSLHGIGGSLRIRGGYEVSDSLLLYATVG 139
              +++G+E    +              D   +     G    + GY   D+ LLYA  G
Sbjct: 89  MGQVVFGLEAQGNWADLTGNNVTPVFAPDRNRTKLTAFGLFTGQIGYSFGDT-LLYAKGG 147

Query: 140 PDVAQKYETGKAGEITPIAI-------GGTAGVGVEVGGLSESLVARLEYRA 184
             V        +G I  +         G + G GVE    + S     EY  
Sbjct: 148 AAVTDTRYEIFSGVINTVLAATTVHKWGASVGAGVEY-AFAPSWSVGFEYDH 198


>gi|118581633|ref|YP_902883.1| OmpA domain-containing protein [Pelobacter propionicus DSM 2379]
 gi|118504343|gb|ABL00826.1| OmpA domain protein transmembrane region-containing protein
           [Pelobacter propionicus DSM 2379]
          Length = 230

 Score = 63.1 bits (152), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 36/204 (17%), Positives = 64/204 (31%), Gaps = 41/204 (20%)

Query: 40  TIATNRYVPIRHDFNGPYAGLSALYNGSFGE--------EAHHNAGGSIFAG-------- 83
            + +       H++ G YAG++  Y     +        +A H+  G +  G        
Sbjct: 17  AVPSLAADNAPHNWTGFYAGINGGYGWGETQWDYVGSTGKADHHINGGLIGGTMGANLQF 76

Query: 84  --YNVEDSCIMYGVEGDVRYTVPVLAD-------NIHSLHGIGGSLRIRGGYEVSDSLLL 134
             Y      ++ GVE D  +                 S      ++R R G    D L +
Sbjct: 77  FAYQGGIPAVVGGVESDFDWADLGDDGPCPNPRFRAKSSIDALATVRGRLGLAF-DRLFI 135

Query: 135 YATVGPDVAQKYET-------------GKAGEITPIAIGGTAGVGVEVGGLSESLVARLE 181
           + T G  VA+                            G   GVG E   + ++L  ++E
Sbjct: 136 FGTGGLAVAKTDVETVDTWGTSVPPSGTAKNGEGKWKTGYVVGVGAEY-AVWKNLSFKVE 194

Query: 182 YRASKYSKVE-GFYNTISLGVGMK 204
           Y+     +      N I +  G++
Sbjct: 195 YQYYDLGRSTYRVDNDIPVKAGVR 218


>gi|323139376|ref|ZP_08074427.1| porin [Methylocystis sp. ATCC 49242]
 gi|322395369|gb|EFX97919.1| porin [Methylocystis sp. ATCC 49242]
          Length = 293

 Score = 63.1 bits (152), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 35/224 (15%), Positives = 59/224 (26%), Gaps = 70/224 (31%)

Query: 37  VVPTIATNRYVPIRHDFNGPYAGLSALYNGSFGEEAHH---------------------- 74
            +P+      +P    + G Y GL+A    S                             
Sbjct: 19  DLPSSKGPATLPPPPLWTGFYLGLNAGGAWSDNNSVQTATFPIFDAIPAGYGTTSAILGT 78

Query: 75  --------NAGGSIFAGYNVEDSC-IMYGVEGDVRYTVPVLADNIHSLHGIG-------- 117
                      G    GY+ +     + GVE D++        +  +             
Sbjct: 79  FSAPANASGFIGGGQIGYDYQFGGAFVAGVEADIQGVASSDGSSSVAGAAFNPVVLGGST 138

Query: 118 --------------GSLRIRGGYEVSDSLLLYATVGPDVAQKYETG-------------- 149
                         G+ R R GY V+ +LL++ + G                        
Sbjct: 139 ASQLATVGKSLDYLGTARGRLGYLVTPTLLVFGSSGLAYGGVSANTSIFQSYTPVAGATN 198

Query: 150 --KAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVE 191
              +G  +    G TAG G+E   +  +  A+ EY       V 
Sbjct: 199 IFASGSYSGARAGWTAGGGLEWMFV-PNWSAKAEYLYYDLGNVT 241


>gi|84499800|ref|ZP_00998088.1| outer membrane protein, putative [Oceanicola batsensis HTCC2597]
 gi|84392944|gb|EAQ05155.1| outer membrane protein, putative [Oceanicola batsensis HTCC2597]
          Length = 194

 Score = 63.1 bits (152), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 41/201 (20%), Positives = 73/201 (36%), Gaps = 22/201 (10%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M ++   +  S++ + +  SA  A    +A        P            D++GPY G 
Sbjct: 1   MSRIKTFIIGSAVVVTAGASAAYAGSPTQAQPEPVVAQPVTPVVAGT----DWSGPYYGA 56

Query: 61  SALY-NGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGS 119
           S  + +   G  +        F GY+ +    + G E  ++Y   +  D       + G 
Sbjct: 57  SLGFGSWDLGGASGEGRNEGAFLGYDYDFGNYVAGGE--LQY---IGNDVTVGGTALNGM 111

Query: 120 LR--IRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLV 177
            R   + GY+ +  +LLY T G   A                G  AGVG++       + 
Sbjct: 112 ARLKGKLGYD-AGPVLLYGTAGYAWADSSAGDGD--------GYVAGVGMDYQ-FDNGVA 161

Query: 178 ARLEYRASKYSKVEGFYNTIS 198
              EY  +++S      NT++
Sbjct: 162 VGAEYLYNEFSDFANTGNTLT 182


>gi|307294323|ref|ZP_07574167.1| putative outer membrane protein [Sphingobium chlorophenolicum L-1]
 gi|306880474|gb|EFN11691.1| putative outer membrane protein [Sphingobium chlorophenolicum L-1]
          Length = 217

 Score = 63.1 bits (152), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 47/232 (20%), Positives = 80/232 (34%), Gaps = 42/232 (18%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K+  A  ++  A+AS   AQ  +P                      + +D  G  AG 
Sbjct: 1   MRKILAATLLTGAAVASPALAQEPNPTFTGPR------------VEAILGYDRTG--AGS 46

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHS-------- 112
           S   +    +++       + AGY+V     + GVEG+   +    +    +        
Sbjct: 47  SVDNDNDRDDQSIDGLLYGVGAGYDVNLGSAVIGVEGEYTDSTAKSSRTDFTDQFGFGRV 106

Query: 113 LHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQK-YETGKAGEITPIAI---GGTAGVGVE 168
             G    +  R G   S + L+Y   G    +     G   + T       G   G GVE
Sbjct: 107 KQGRDLYVGARAGILASPNTLVYVKGGYTNTKLDVLAGDTNQETDTNFKLDGWRIGGGVE 166

Query: 169 VGGLSESLVARLEYRASKYSK---------------VEGFYNTISLGVGMKF 205
              ++ +  A+LEYR SKY                 ++   + +   VG +F
Sbjct: 167 -RAINANSFAKLEYRYSKYEDAHIDFANGASSDEFGIDTDRHQVVASVGWRF 217


>gi|148255737|ref|YP_001240322.1| putative outer-membrane protein [Bradyrhizobium sp. BTAi1]
 gi|146407910|gb|ABQ36416.1| putative outer-membrane protein [Bradyrhizobium sp. BTAi1]
          Length = 251

 Score = 63.1 bits (152), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 41/229 (17%), Positives = 69/229 (30%), Gaps = 46/229 (20%)

Query: 6   LAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSAL-- 63
           L +G ++        A AAD   R                 +   +D++G Y G +A   
Sbjct: 4   LLLGATTSLALGIAPAIAADLPARTFTK---------APAMIATIYDWSGFYLGFNAGGG 54

Query: 64  -----------------YNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVL 106
                             N     +A     G    GY  +    ++GVEG   +     
Sbjct: 55  SARTCWTNQVTIAGVAATNAEGCHDATGALAGG-QVGYRWQTGGWVFGVEGQGNWANLKG 113

Query: 107 ADNIHSLHGIG--------GSLRIRGGYEVSDSLLLYATVGPDVAQKYETG-------KA 151
            +      G+         G L  + GY   +++L Y   G  V  +  +G         
Sbjct: 114 RNASQLAPGVTNQTKINGVGLLTGQIGYAW-NNVLWYVKGGAAVTGEKYSGLATATGTPF 172

Query: 152 GEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFYNTISLG 200
            + +    G   G GVEV G + +     EY           ++ +  G
Sbjct: 173 DQASATRWGAAVGTGVEV-GFANNWSIAAEYEHLFMGNRTLTFSGVPGG 220


>gi|319403669|emb|CBI77254.1| Hemin binding protein E [Bartonella rochalimae ATCC BAA-1498]
          Length = 306

 Score = 63.1 bits (152), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 24/110 (21%), Positives = 42/110 (38%), Gaps = 19/110 (17%)

Query: 113 LHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYET--------GKAGEITPIAIGGTAG 164
                G+ R+R G+  +D ++ Y   G    +  +T            +     +G T G
Sbjct: 199 KEKWAGATRVRIGFA-ADRIMPYIAAGVSYTELQDTLSVLVSRRNAEVDEEKKMVGYTFG 257

Query: 165 VGVEVGGLSESLVARLEYRASKYSKV---------EGFYNTISLGVGMKF 205
            G ++  +++S + R EYR S + K              N   +GV  KF
Sbjct: 258 GGFDI-AIAKSFIMRTEYRYSDFGKKKFAKGEVELSYKTNDFRVGVAYKF 306


>gi|323139111|ref|ZP_08074169.1| hypothetical protein Met49242DRAFT_3557 [Methylocystis sp. ATCC
           49242]
 gi|322395675|gb|EFX98218.1| hypothetical protein Met49242DRAFT_3557 [Methylocystis sp. ATCC
           49242]
          Length = 837

 Score = 63.1 bits (152), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 33/203 (16%), Positives = 54/203 (26%), Gaps = 65/203 (32%)

Query: 52  DFNGPYAGLSALYNGSFGEEAHH-----------------------------NAGGSIFA 82
            +   Y GL+    G++   A +                                G +  
Sbjct: 592 SWTDVYVGLNGG--GAWSSPASNVQVVGVGPAPASLPVAFSAAPIDTGNHLAGFIGGLQL 649

Query: 83  GYNVE-DSCIMYGVEGDV----RYTVPVLADNIHSLHG--------------IGGSLRIR 123
           G N       + GVE D+      T         +  G                G++R R
Sbjct: 650 GANWNFSGNFLAGVETDLHGVSGNTDTKWQLTSANGGGDTFLTYEQRTATLNYLGTVRGR 709

Query: 124 GGYEVSDSLLLYATVGPDVAQKYETG-------KAGEITP-------IAIGGTAGVGVEV 169
            GY  + +L++Y T G                      T          +G +AG GVE 
Sbjct: 710 LGYLATPTLVVYGTGGMAYGGVVSNTAIFTRRIGGTSQTQVNPVFQDTLVGWSAGGGVEW 769

Query: 170 GGLSESLVARLEYRASKYSKVEG 192
             L  +  A+++Y          
Sbjct: 770 MFL-PNWSAKVDYLHYDLGNARA 791


>gi|84515617|ref|ZP_01002979.1| possible outer membrane protein [Loktanella vestfoldensis SKA53]
 gi|84510900|gb|EAQ07355.1| possible outer membrane protein [Loktanella vestfoldensis SKA53]
          Length = 205

 Score = 63.1 bits (152), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 29/138 (21%), Positives = 45/138 (32%), Gaps = 5/138 (3%)

Query: 11  SSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSFGE 70
           +++  A F  A               V PT      +    D+ G YAG    Y    G 
Sbjct: 10  TAMLAAPFAVAAGMSAAGGMAQPVETVAPTPVAPAPMMASTDWTGFYAGGQLGYADVTGS 69

Query: 71  EAHHNAGG---SIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGSLRIRGGYE 127
               +  G    +  GY  +   ++ G E D   +          L  I   ++ R GY+
Sbjct: 70  GTTADVDGAIYGVHGGYMYDLGSVVLGGEVDYDLSSIDNVAGTADLDDIM-RVKARVGYD 128

Query: 128 VSDSLLLYATVGPDVAQK 145
            + + L Y T G   A  
Sbjct: 129 -AGAFLPYVTGGVVRANT 145


>gi|294011267|ref|YP_003544727.1| putative outer membrane protein [Sphingobium japonicum UT26S]
 gi|292674597|dbj|BAI96115.1| putative outer membrane protein [Sphingobium japonicum UT26S]
          Length = 217

 Score = 63.1 bits (152), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 42/201 (20%), Positives = 69/201 (34%), Gaps = 27/201 (13%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M K+  A  ++  A++S   AQ  +P                      + +D  G  AG 
Sbjct: 1   MHKILAATLLTGAAVSSPALAQDVNPTFTGPR------------VEAILGYDHTG--AGS 46

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNI--------HS 112
           S   +    +++       + AGY+V     + GVEG+   +      +           
Sbjct: 47  SVDNDNDRDDQSIDGLLYGVGAGYDVNLGSAVVGVEGEFTDSTAKSGRSDPTDQFGFGRV 106

Query: 113 LHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYE---TGKAGEITPIAI-GGTAGVGVE 168
             G    +  R G   S + L+Y   G    +             T   + G   G GVE
Sbjct: 107 KQGRDLYVGARAGILASPNTLVYVKGGYTNTKLDVLAGNTNVETDTNFKLDGWRIGAGVE 166

Query: 169 VGGLSESLVARLEYRASKYSK 189
              ++ +  A+LEYR SKY  
Sbjct: 167 -RAINANTFAKLEYRYSKYED 186


>gi|323139008|ref|ZP_08074068.1| porin [Methylocystis sp. ATCC 49242]
 gi|322395762|gb|EFX98303.1| porin [Methylocystis sp. ATCC 49242]
          Length = 300

 Score = 62.7 bits (151), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 46/262 (17%), Positives = 71/262 (27%), Gaps = 84/262 (32%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+     V V +  L +  SA AAD   R                       + G Y GL
Sbjct: 1   MKTRHFCVVVMTAVLMT-ASAVAADLPSRKDDPLPAPP-----------PPMWTGFYVGL 48

Query: 61  SALYNGSFGEEAHH---------NAGGSIFAG-----------------------YNVE- 87
           +A    S    A+             G +                          YN   
Sbjct: 49  NAGGTWSNSNSANVASAPFWTLPGLNGDVLGASAISASAYNPANAGGFIGGGQIGYNWRI 108

Query: 88  DSCIMYGVEGDVRYTVPVLADNIHSLH----------------------GIGGSLRIRGG 125
               + G+E D++           +                           G++R R G
Sbjct: 109 AGSFVTGIEADIQGIAGNGGAGSSANVAAIAGALVPSHVATVVGTSKSLDYLGTVRSRIG 168

Query: 126 YEVSDSLLLYATVGPDVAQKYET----------------GKAGEITPIAIGGTAGVGVEV 169
           Y  + +LL+Y T G        +                G  G  +   +G TAG G+E 
Sbjct: 169 YLATPTLLIYGTGGLAYGGVSSSATISQSASFIDTAVPWGSTGAFSDTRVGWTAGGGIEW 228

Query: 170 GGLSESLVARLEYRASKYSKVE 191
             +S +  A++EY       V 
Sbjct: 229 MFMS-NWSAKVEYLYYDLGSVT 249


>gi|170749780|ref|YP_001756040.1| porin [Methylobacterium radiotolerans JCM 2831]
 gi|170656302|gb|ACB25357.1| porin [Methylobacterium radiotolerans JCM 2831]
          Length = 299

 Score = 62.7 bits (151), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 30/137 (21%), Positives = 46/137 (33%), Gaps = 28/137 (20%)

Query: 68  FGEEAHHNAGGSIFAGYNVE---DSCIMYGVEGDVRY-----------------TVPVLA 107
           +  ++     G    GYN +    S  + G E D +Y                    +  
Sbjct: 94  YSNDSREGFSGGGQIGYNWQLTPGSGAVIGFEADAQYLDFGRRARFATNAAAINPGFIPV 153

Query: 108 DNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPD-------VAQKYETGKAGEITPIAIG 160
           +   +     G++R R GY   D  L+YAT G          A+      AG       G
Sbjct: 154 NGTLNTIDFFGTVRGRLGYAF-DRTLVYATGGFAYATGTDDGARVGLQNFAGRRNDFKTG 212

Query: 161 GTAGVGVEVGGLSESLV 177
            T G GVE    ++S +
Sbjct: 213 WTVGGGVEYALPTDSFL 229


>gi|39937872|ref|NP_950148.1| hypothetical protein RPA4814 [Rhodopseudomonas palustris CGA009]
 gi|39651732|emb|CAE30254.1| conserved hypothetical protein [Rhodopseudomonas palustris CGA009]
          Length = 561

 Score = 62.7 bits (151), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 45/221 (20%), Positives = 71/221 (32%), Gaps = 48/221 (21%)

Query: 6   LAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYN 65
           + V V++LA      A AAD  R          P +      P+  ++ G Y G     +
Sbjct: 4   ILVTVATLATV-ISPAAAADMPR---------FPPLMPV--APVSWNWTGLYWGAHVGGS 51

Query: 66  G-------------SFGEEAHHNAGGSIFAGYNVE-DSCIMYGVEGDVRY---------- 101
                           G      A   I  GYN + ++  + GVE D+            
Sbjct: 52  FGSSSFSDPAGPGLYGGSVRSPAALAGIQVGYNYQPNANWLIGVEADLSSMNAKGTNTCM 111

Query: 102 --TVPVLADNIHSLHGIGGSLRIRGGYEVSD--SLLLYATVGPD-------VAQKYETGK 150
             +   ++ N         +L  R G+        LLYA  G         +A  Y  G 
Sbjct: 112 ASSGLFISSNCRVRQDALATLTGRAGFVTGPGGRTLLYAKGGAAYLSERLDIAVGYPLGN 171

Query: 151 AGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVE 191
                    G T G G+E   L+ +   +LEY  + +   +
Sbjct: 172 LTAANDGRWGWTVGAGIE-RALAPAWSVKLEYNYADFGSRD 211


>gi|218532905|ref|YP_002423721.1| porin [Methylobacterium chloromethanicum CM4]
 gi|218525208|gb|ACK85793.1| porin [Methylobacterium chloromethanicum CM4]
          Length = 274

 Score = 62.7 bits (151), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 44/250 (17%), Positives = 73/250 (29%), Gaps = 74/250 (29%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+   +  G++ + L+   +A AAD  RRA       +P             + G Y G 
Sbjct: 1   MRNSLILSGLAGILLSG--TALAADLPRRAEAPVFTPIP----------VFAWTGAYFGT 48

Query: 61  SALYNGSFGEEA------------------------HHNAGGSIFAGYNVE---DSCIMY 93
           +  Y  +  +                                   AGYN +    +  ++
Sbjct: 49  NGGYAYTESDTLRTTGIGALQANVTNDLRRANVALPKDGFSFGGQAGYNFQLTPGAGFVF 108

Query: 94  GVEGDVRY----------------TVPVLADNIHSLHGIGGSLRIRGGYEVSDSLLLYAT 137
           G E D +Y                   VL +   +     G++R R GY   D +L+Y T
Sbjct: 109 GFETDAQYLDLARSRTETIFRPAINPNVLRNVYAADLDFLGTVRGRVGYAF-DRVLVYGT 167

Query: 138 VGPDVAQKYE---------TGKAGEITPIAIGGTAGVGVEVGGLSES---------LVAR 179
            G                    AG  + +  G   G G+E    + S         +  +
Sbjct: 168 GGFAYGTTTLAAVFRTGTPVTYAGARSGLETGYAYGGGIEYAIPANSFLDLTGSLQMTVK 227

Query: 180 LEYRASKYSK 189
            EY       
Sbjct: 228 AEYLRYDLGS 237


>gi|91978859|ref|YP_571518.1| OmpA-like transmembrane region [Rhodopseudomonas palustris BisB5]
 gi|91685315|gb|ABE41617.1| OmpA-like transmembrane region [Rhodopseudomonas palustris BisB5]
          Length = 559

 Score = 62.7 bits (151), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 37/192 (19%), Positives = 64/192 (33%), Gaps = 42/192 (21%)

Query: 37  VVPTIATNRYVPIRHDFNGPYAGLSALYNGSFGEEAHHNAGG---------------SIF 81
            +P +      P+  ++ G Y G      GSFG  +  +  G                I 
Sbjct: 22  DLPRLPPA--APVLWNWTGLYWGAHLG--GSFGASSFSDPAGPGIYGGNVRSPAAMAGIQ 77

Query: 82  AGYNVE-DSCIMYGVEGDVR------------YTVPVLADNIHSLHGIGGSLRIRGGYEV 128
            GYN + ++  + GVE D+              +  V++ N         ++  R G   
Sbjct: 78  LGYNYQPNANWLVGVEADLSALNGNGTNSCMVSSGLVISANCRVRQDAMATVTGRAGLVT 137

Query: 129 SD--SLLLYATVGPDVAQKYETGKAG-------EITPIAIGGTAGVGVEVGGLSESLVAR 179
                 LLYA  G     +      G       + +    G TAG G+E   L+ +   +
Sbjct: 138 GPGGRTLLYAKGGAAFLSERIDITVGNPLRSSTDNSDGRWGWTAGAGIE-QALAPAWSVK 196

Query: 180 LEYRASKYSKVE 191
            EY  + +   +
Sbjct: 197 FEYDYANFGSSD 208


>gi|254560231|ref|YP_003067326.1| outer-membrane immunogenic protein [Methylobacterium extorquens
           DM4]
 gi|254267509|emb|CAX23351.1| putative outer-membrane immunogenic protein precursor
           [Methylobacterium extorquens DM4]
          Length = 289

 Score = 62.4 bits (150), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 45/228 (19%), Positives = 69/228 (30%), Gaps = 63/228 (27%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+   +  G++ + L+   +A AAD  RRA                      + G YAG 
Sbjct: 1   MRNSLILAGLTGILLSG--TALAADLPRRAAPPPVFQP---------VPVFTWTGFYAGF 49

Query: 61  SALYNGSFGEE-----------------------------AHHNAGGSIFAGYNVED--- 88
           +A Y     ++                             ++    G    GYN +    
Sbjct: 50  NAGYGFGTQDDRVPTVIGVGPASLLVPPGTTAVVAFSNRESNEGFVGGGQIGYNYQFTPG 109

Query: 89  SCIMYGVEGDVRYTV-----------------PVLADNIHSLHGIGGSLRIRGGYEVSDS 131
           S ++ GVE D +Y                    V      S     G++R R GY   D 
Sbjct: 110 SGVVIGVEADAQYADFGRDRNRFLSTSPLAAQQVFNPGGLSGLDFFGTVRGRLGYAF-DR 168

Query: 132 LLLYATVGPDVAQKYET--GKAGEITPIAIGGTAGVGVEVGGLSESLV 177
            L+Y T G           G          G  AG G+E    ++S +
Sbjct: 169 TLVYGTGGFAYGSGGGREFGTGVSSNDFQTGWAAGGGIEYALPTDSFL 216


>gi|115524922|ref|YP_781833.1| hypothetical protein RPE_2916 [Rhodopseudomonas palustris BisA53]
 gi|115518869|gb|ABJ06853.1| conserved hypothetical protein [Rhodopseudomonas palustris BisA53]
          Length = 578

 Score = 62.4 bits (150), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 39/247 (15%), Positives = 65/247 (26%), Gaps = 77/247 (31%)

Query: 33  GGRGVVPTIATNRYVPIRHDFNGPYAGLSALY---------------------------- 64
           G    V   A+ +  P+   + G Y G                                 
Sbjct: 324 GDVTPVAAAASVKAPPVAVHWTGAYVGGHLGAGFGPKHWSDPLGSSMALVDPGPPDYAVG 383

Query: 65  -------NGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIG 117
                   G           G +  GYNV+    + G E +        +  I+S  G G
Sbjct: 384 TPRGLNMAGFGKSTPMAGGLGGLQIGYNVQIDNTVLGFEVEAALADLKGSHTIYSGIGGG 443

Query: 118 ---------GSLRIRGGYEVSDSLLLYATVG--PDVAQKYETGK------------AGEI 154
                    G+   R GY + D  L+Y   G    V                       +
Sbjct: 444 QAEAHTKALGTFAGRLGYAL-DRSLIYVKAGGAWAVTDHTLNTSSVYGNVQGLDCCGDTV 502

Query: 155 TPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSK-----------------VEGFYNTI 197
           +    G   G G+E   ++ +  A  EY    +                   ++  ++T+
Sbjct: 503 SSSRFGWVVGAGIEY-AVNRTWSATFEYDYMDFGTQSIRFPTNAGLGLPPAAIDQAFHTV 561

Query: 198 SLGVGMK 204
            +GV  K
Sbjct: 562 KMGVNYK 568


>gi|163850612|ref|YP_001638655.1| porin [Methylobacterium extorquens PA1]
 gi|218529335|ref|YP_002420151.1| porin [Methylobacterium chloromethanicum CM4]
 gi|240137660|ref|YP_002962131.1| putative outer-membrane immunogenic protein precursor
           [Methylobacterium extorquens AM1]
 gi|163662217|gb|ABY29584.1| porin [Methylobacterium extorquens PA1]
 gi|218521638|gb|ACK82223.1| porin [Methylobacterium chloromethanicum CM4]
 gi|240007628|gb|ACS38854.1| putative outer-membrane immunogenic protein precursor
           [Methylobacterium extorquens AM1]
          Length = 289

 Score = 62.4 bits (150), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 45/228 (19%), Positives = 69/228 (30%), Gaps = 63/228 (27%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+   +  G++ + L+   +A AAD  RRA                      + G YAG 
Sbjct: 1   MRNSLILAGLTGILLSG--TALAADLPRRAAPPPVFQP---------VPVFTWTGFYAGF 49

Query: 61  SALYNGSFGEE-----------------------------AHHNAGGSIFAGYNVED--- 88
           +A Y     ++                             ++    G    GYN +    
Sbjct: 50  NAGYGFGTQDDRVPTVIGVGPASLLVPPGTTAVVAFSNRESNEGFVGGGQIGYNYQFTPG 109

Query: 89  SCIMYGVEGDVRYTV-----------------PVLADNIHSLHGIGGSLRIRGGYEVSDS 131
           S ++ GVE D +Y                    V      S     G++R R GY   D 
Sbjct: 110 SGVVIGVEADAQYADFGRDRNRFLSTSPLAAQQVFNPGGLSGLDFFGTVRGRLGYAF-DR 168

Query: 132 LLLYATVGPDVAQKYET--GKAGEITPIAIGGTAGVGVEVGGLSESLV 177
            L+Y T G           G          G  AG G+E    ++S +
Sbjct: 169 TLVYGTGGFAYGSGGGREFGTGVSSNDFQTGWAAGGGIEYALPTDSFL 216


>gi|163854231|ref|YP_001642274.1| porin [Methylobacterium extorquens PA1]
 gi|163665836|gb|ABY33203.1| porin [Methylobacterium extorquens PA1]
          Length = 313

 Score = 62.4 bits (150), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 48/321 (14%), Positives = 85/321 (26%), Gaps = 124/321 (38%)

Query: 1   MQKLFLAVG-VSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAG 59
           M+   + +  ++ L       A AAD       G     P  A         D++G Y G
Sbjct: 1   MRTTTMRIATLALLTTVLVSPALAADLDYGVLRGYDDDYPAPA------PIIDWSGFYVG 54

Query: 60  LSALYNG--------------------------------SFGEEAHHNAGGSIFAGYNVE 87
               Y+                                 SF  +  H      FA YN++
Sbjct: 55  GHGGYSSASMGFTNVFSKPYSQYFRARDIETEFGISSLLSFASQRVHGITYGAFASYNIQ 114

Query: 88  DSCIMYGVEGDV------RYTVPVLADNIHSLHGI----------------GGSLRIRGG 125
               ++G+E D         +   ++  + + + +                 G++R R G
Sbjct: 115 LDDAVFGIEVDYTSFSKSGMSYSEISRFVTTKNNMFETVNLRGFSRTELEDFGTIRGRAG 174

Query: 126 YEVSDSLLLYATVGPDVAQ--------------------KYETGKAGEITPIAIGGTAG- 164
           Y    S L + T G  + +                     Y+T           G   G 
Sbjct: 175 YAF-GSFLPFVTAGLAIGRATILDQPEVQNYGYDATAAAAYQTNPKAGAPVTHHGYANGN 233

Query: 165 -------------------------------------VGVEVGGLSESLVARLEYRASKY 187
                                                 G+E   ++ + + R EY+   +
Sbjct: 234 TAFDPSAPQDPQKSIPDGFYQIPAKPKSKAMAGVALGAGLEY-AITPNFLLRGEYQYVLF 292

Query: 188 SKVEGFY---NTISLGVGMKF 205
              +G     NT+  G  +KF
Sbjct: 293 DDFDGHKINVNTVRGGAAIKF 313


>gi|260460927|ref|ZP_05809177.1| porin [Mesorhizobium opportunistum WSM2075]
 gi|259033504|gb|EEW34765.1| porin [Mesorhizobium opportunistum WSM2075]
          Length = 255

 Score = 62.4 bits (150), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 29/188 (15%), Positives = 50/188 (26%), Gaps = 41/188 (21%)

Query: 49  IRHDFNGPYAGLSALY-------------NGSFG-----------EEAHHNAGGSIFAGY 84
             +D++G Y G                  NG F            +       G I AG 
Sbjct: 36  SAYDWSGFYVGGHIGVADGDITATDMTEPNGGFFTELVPAGTEGFDFNKAGVAGGIHAGA 95

Query: 85  NVEDSCIMYGVEGDVRYTVPVL---------ADNIHSLHGIGGSLRIRGGYEVSDSLLLY 135
             +    + G E     T             +D          ++  R GY   D +L+Y
Sbjct: 96  QWQWGQFVLGGEATWTATGIRKTITSPYYPDSDTETGKISNYATIVGRVGYAF-DRVLIY 154

Query: 136 ATVGPDVA----QKYETGKAGE--ITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSK 189
           A  G        +  +              G   G G++   L+ +L   ++Y       
Sbjct: 155 AKAGYAGGKVDFRARDNDALVSYEKNEWQNGYALGAGIDY-ALTNNLSLGVDYTHIDLGH 213

Query: 190 VEGFYNTI 197
                + +
Sbjct: 214 KTSTGDNV 221


>gi|188582250|ref|YP_001925695.1| porin [Methylobacterium populi BJ001]
 gi|179345748|gb|ACB81160.1| porin [Methylobacterium populi BJ001]
          Length = 290

 Score = 62.4 bits (150), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 46/224 (20%), Positives = 66/224 (29%), Gaps = 61/224 (27%)

Query: 5   FLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALY 64
           FL  G +   +A   SA AAD  RRA                      + G YAG +A Y
Sbjct: 4   FLRAGTAIAGIAFAGSALAADLPRRAAPPPVFQP---------VPVFTWTGFYAGFNAGY 54

Query: 65  NGSFGEE-----------------------------AHHNAGGSIFAGYNVED---SCIM 92
                ++                             ++    G    GYN +    S ++
Sbjct: 55  GFGTQDDRVPTVIGVGPASLLVPPGTTAVVAFSNRESNEGFVGGGQIGYNYQFTPGSGVV 114

Query: 93  YGVEGDVRYTV-----------------PVLADNIHSLHGIGGSLRIRGGYEVSDSLLLY 135
            G+E D +Y                    V      S     G++R R GY   D  L+Y
Sbjct: 115 IGIEADAQYADFGRDRNRFLSTSPLAAQQVFNPGGLSGLDFFGTVRGRLGYAF-DRTLVY 173

Query: 136 ATVGPDVAQKYET--GKAGEITPIAIGGTAGVGVEVGGLSESLV 177
            T G           G          G  AG G+E    ++S +
Sbjct: 174 GTGGFAYGSGGGREFGTGVSSDDFQTGWAAGGGIEYALPTDSFL 217


>gi|148257935|ref|YP_001242520.1| hypothetical protein BBta_6718 [Bradyrhizobium sp. BTAi1]
 gi|146410108|gb|ABQ38614.1| putative exported protein of unknown function [Bradyrhizobium sp.
           BTAi1]
          Length = 550

 Score = 62.4 bits (150), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 24/131 (18%), Positives = 45/131 (34%), Gaps = 13/131 (9%)

Query: 74  HNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGG------SLRIRGGYE 127
            +  G +  G + +    + G++      +   +  +     +        +  +R GY 
Sbjct: 381 GDVIGGVQLGCDYQIDRFVLGIQAMADLGIINASTAVAPQLTLNARTSNLYTATVRAGYL 440

Query: 128 VSDSLLLYATVGPDVAQKYET----GKAGEITPIAI--GGTAGVGVEVGGLSESLVARLE 181
           V+  +LLYA  G    +   T          +      G T G GVE    + +  A  E
Sbjct: 441 VTPEVLLYARGGAAWTRTSVTAVNAANGQSASAAFNRSGWTVGAGVE-WMFARNWSAFAE 499

Query: 182 YRASKYSKVEG 192
           Y  + +  V G
Sbjct: 500 YDYADFGTVTG 510


>gi|156739544|gb|ABU93432.1| Omp25 [Brucella abortus]
          Length = 49

 Score = 62.4 bits (150), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 11/48 (22%), Positives = 24/48 (50%), Gaps = 1/48 (2%)

Query: 130 DSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLV 177
           + ++ Y T G   +Q        + +   +G TAG G+E   L+++++
Sbjct: 3   NPVMPYLTAGIAGSQIKLNNGLDDESKFRVGWTAGAGLEA-KLTDNIL 49


>gi|148254831|ref|YP_001239416.1| hypothetical protein BBta_3415 [Bradyrhizobium sp. BTAi1]
 gi|146407004|gb|ABQ35510.1| putative outer membrane protein of unknown function [Bradyrhizobium
           sp. BTAi1]
          Length = 680

 Score = 62.4 bits (150), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 51/239 (21%), Positives = 74/239 (30%), Gaps = 69/239 (28%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+++ L   V SLALA      AA                            + GP+ G 
Sbjct: 4   MKRIGLTSAVLSLALAIPGPTDAA-----------------PIRSAEADIQAWTGPFLGG 46

Query: 61  SALYNGSFGEEAHHNAGG-----------------------SIFAGYNVEDSC-IMYGVE 96
              Y G     +  NA                          + AGYN      ++ GVE
Sbjct: 47  HFGYVGGASSWSASNAVTTVSGSTGVFNSYDVFKGTGSYLFGLQAGYNWTLPSRLVLGVE 106

Query: 97  GDVRYTVPVLADNIHSLHGIG-----------GSLRIRGGYEVSDSLLLYATVG------ 139
            DV     V  +   +    G           G+ R R GY   D  LLYAT G      
Sbjct: 107 ADVSTPNTVAGERTVTSASAGTASYRETVLAMGTARARLGYAF-DHWLLYATGGFAWSYD 165

Query: 140 ------PDVAQKYETGKAGEITPIA---IGGTAGVGVEVGGLSESLVARLEYRASKYSK 189
                         +  AG +       +G  AG+G E+  ++    A+ E+ AS++  
Sbjct: 166 RLERTQLAGLPLVGSAVAGTVDTALTWRLGWVAGLGAELP-IAPHWTAKAEFLASEFGS 223


>gi|170748188|ref|YP_001754448.1| putative outer membrane protein [Methylobacterium radiotolerans JCM
           2831]
 gi|170654710|gb|ACB23765.1| putative outer membrane protein [Methylobacterium radiotolerans JCM
           2831]
          Length = 571

 Score = 62.4 bits (150), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 46/224 (20%), Positives = 67/224 (29%), Gaps = 65/224 (29%)

Query: 19  CSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALY-------------- 64
            +A AAD  RR        +P  AT         + G +AGL A Y              
Sbjct: 16  QTAMAADLPRR-------ALPPAATAV---PIFSWTGAHAGLFAGYGTLDRATQFVCTGP 65

Query: 65  NGSFG----------EEAHHNAGGSIFAGYNVEDSC-IMYGVEGDVRYTVPVLADNIHSL 113
           +G  G            +  +  G    GY+ + +   + G   D ++T     D     
Sbjct: 66  DGQPGARNCPVIPSKRASDGSFVGGAEVGYDWQVNSGFVAGAAADYQFTRLWGYDRREGA 125

Query: 114 HGIGG-------------------SLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAG-- 152
               G                   +LR R G+ V D  L+YAT G               
Sbjct: 126 FPAAGGGFYRRSVAHSGQRLDELATLRGRIGFAV-DRTLVYATGGLAAGTVRTDNNLSLA 184

Query: 153 -------EITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSK 189
                      + +G  AG G+E    SE L A++E        
Sbjct: 185 GFPLFDRRQGAVRLGYVAGAGIE-HAFSEHLSAKVEGLYYDLGS 227


>gi|114798934|ref|YP_759743.1| putative outer membrane protein [Hyphomonas neptunium ATCC 15444]
 gi|114739108|gb|ABI77233.1| putative outer membrane protein [Hyphomonas neptunium ATCC 15444]
          Length = 292

 Score = 62.4 bits (150), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 42/237 (17%), Positives = 67/237 (28%), Gaps = 54/237 (22%)

Query: 4   LFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL--- 60
           L  A    + +   F +   A P  +     RG+V       +    +   G  +G    
Sbjct: 23  LSTAAAPGAYSWTGFYAGVHAGPTWQDRSAERGLVTGSVAPDFDYDANLNEGGPSGGVAE 82

Query: 61  ----SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADN------- 109
               +A++   FG        G + AGYN +      G E D         D+       
Sbjct: 83  GSPLAAIFPSEFGSSEKVGMSGGVQAGYNQQYGRFALGFEADFTGLGSNGGDDGAVQGLT 142

Query: 110 ----------------IHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKY------- 146
                           + S      + R+R G  V+D  L+Y T G  V           
Sbjct: 143 ASNPAFGDAVFGTDLRVRSSMDYLATTRLRAGV-VTDRFLVYGTGGAAVGNPEHQVDFSA 201

Query: 147 ---------------ETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYS 188
                              +G       G TAG G E    ++++  + EY      
Sbjct: 202 GLTATGGTLVGPLDRSNSFSGRKDDWKGGWTAGAGGEF-AFTDNMTLKAEYLYYDLG 257


>gi|163853964|ref|YP_001642007.1| porin [Methylobacterium extorquens PA1]
 gi|240141418|ref|YP_002965898.1| putative 31 kDa outer-membrane immunogenic protein precursor
           (omp31) [Methylobacterium extorquens AM1]
 gi|163665569|gb|ABY32936.1| porin [Methylobacterium extorquens PA1]
 gi|240011395|gb|ACS42621.1| putative 31 kDa outer-membrane immunogenic protein precursor
           (omp31) [Methylobacterium extorquens AM1]
          Length = 274

 Score = 62.0 bits (149), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 50/265 (18%), Positives = 81/265 (30%), Gaps = 75/265 (28%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+   +  G++ + L+   +A AAD  RRA       +P             + G Y G 
Sbjct: 1   MRNSLILSGLAGILLSG--TALAADLPRRAEAPVFTPIP----------VFAWTGAYFGP 48

Query: 61  SALYNGSFGEEA------------------------HHNAGGSIFAGYNVE---DSCIMY 93
           +  Y  +  +                                   AGYN +    +  ++
Sbjct: 49  NGGYAYTESDTLRTTGIGALQANVTNDLRRANVALPKDGFSFGGQAGYNFQLTPGTGFVF 108

Query: 94  GVEGDVRY----------------TVPVLADNIHSLHGIGGSLRIRGGYEVSDSLLLYAT 137
           G E D +Y                   VL +   +     G++R R GY   D +L+Y T
Sbjct: 109 GFETDAQYLDLARSRTETIFRPAINPNVLRNVYAADLDFLGTVRGRVGYAF-DRVLVYGT 167

Query: 138 VGPDVAQKYETGK---------AGEITPIAIGGTAGVGVEVGGLSES---------LVAR 179
            G                    AG  + +  G   G G+E    + S         +  +
Sbjct: 168 GGFAYGTTTLAAVFRTGTPVTYAGARSGLETGYAYGGGIEYAIPANSFLDLTGSLQMTVK 227

Query: 180 LEY-RASKYSKVEGFYNTISLGVGM 203
            EY R    S+     +T   GVG 
Sbjct: 228 AEYLRYDLGSRTVLIRSTGGPGVGY 252


>gi|319403868|emb|CBI77454.1| putative Hemin binding protein b [Bartonella rochalimae ATCC
           BAA-1498]
          Length = 356

 Score = 62.0 bits (149), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 25/118 (21%), Positives = 45/118 (38%), Gaps = 27/118 (22%)

Query: 113 LHGIGGSLRIRGGYEVSDSLLLYATVGPD------VAQKYETGKAGEIT----------- 155
                G+ R+R G   +  ++ Y   G        ++ K     A + T           
Sbjct: 241 KRKWLGATRMRLGLS-AGRVMPYIAGGIAYAKVQFISSKTVNIGASKNTVPMSSLDSAEV 299

Query: 156 PIAIGGTAGVGVEVGGLSESLVARLEYRASKYS-----KVEGFY---NTISLGVGMKF 205
            + +G T G G +   +++ ++ R EYR S +      KV+  Y   N   +G+  KF
Sbjct: 300 EVMVGYTLGGGFDF-AMTDRILLRAEYRYSDFGAEKFKKVDLKYYKVNDFRIGLAYKF 356



 Score = 39.2 bits (90), Expect = 0.32,   Method: Composition-based stats.
 Identities = 16/95 (16%), Positives = 30/95 (31%), Gaps = 21/95 (22%)

Query: 47  VPIRHDFNGPYAGLSALYNGSFGEEAHHNAG-------------------GSIFAGYNVE 87
               + ++G Y G       S     H+N                     G  +AG N E
Sbjct: 20  ASPFYSWDGFYLGGQVGSFSSSMSLLHNNTDKTDERNFKDVFSSEVSGITGGFYAGVNFE 79

Query: 88  -DSCIMYGVEGDVRYTVPVLADNIHSLHGIGGSLR 121
             +  + GV+ D+ ++    A+ +         +R
Sbjct: 80  YSNRFVLGVDTDIVFS-NKKAEKVFVDEKFENLVR 113


>gi|159044248|ref|YP_001533042.1| hypothetical protein Dshi_1699 [Dinoroseobacter shibae DFL 12]
 gi|157912008|gb|ABV93441.1| hypothetical protein Dshi_1699 [Dinoroseobacter shibae DFL 12]
          Length = 198

 Score = 62.0 bits (149), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 43/191 (22%), Positives = 67/191 (35%), Gaps = 19/191 (9%)

Query: 5   FLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALY 64
           F  V   +L LA F +   A  +         + P            D+ G Y G    Y
Sbjct: 6   FSPVVALALPLALFGAPSLAGSLEDPVVEPVPMAPAPVVV----SGRDWTGGYVGAQIGY 61

Query: 65  NGSFGEEA---HHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGSLR 121
                  +        G + AGY+ +    + G    + Y +  +     SL  +   L+
Sbjct: 62  GDVGTNASGVDGDGLIGGLIAGYDYDFGSYVLG--AGIDYDIADIDLGPASLEDVL-RLK 118

Query: 122 IRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLE 181
           +R G+E +   L+YAT G   A        G       G  AG GVE   LS++L    E
Sbjct: 119 LRAGFE-AGPSLIYATGGYARAGT---DNLGSDD----GWFAGAGVEYP-LSQNLSLAGE 169

Query: 182 YRASKYSKVEG 192
               ++   +G
Sbjct: 170 VLYHEFDDFDG 180


>gi|163852300|ref|YP_001640343.1| porin [Methylobacterium extorquens PA1]
 gi|218531058|ref|YP_002421874.1| porin [Methylobacterium chloromethanicum CM4]
 gi|240139636|ref|YP_002964112.1| putative 31 kDa outer-membrane immunogenic protein precursor
           (omp31) [Methylobacterium extorquens AM1]
 gi|254562046|ref|YP_003069141.1| 31 kDa outer-membrane immunogenic protein [Methylobacterium
           extorquens DM4]
 gi|163663905|gb|ABY31272.1| porin [Methylobacterium extorquens PA1]
 gi|218523361|gb|ACK83946.1| porin [Methylobacterium chloromethanicum CM4]
 gi|240009609|gb|ACS40835.1| putative 31 kDa outer-membrane immunogenic protein precursor
           (omp31) [Methylobacterium extorquens AM1]
 gi|254269324|emb|CAX25290.1| putative 31 kDa outer-membrane immunogenic protein precursor
           (omp31) [Methylobacterium extorquens DM4]
          Length = 290

 Score = 62.0 bits (149), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 47/224 (20%), Positives = 66/224 (29%), Gaps = 61/224 (27%)

Query: 5   FLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALY 64
           FL  G +   +A   SA AAD  RRA                      + G YAG +A Y
Sbjct: 4   FLRAGTAIAGIAFAGSALAADLPRRAAPPPVFQP---------VPVFTWTGFYAGFNAGY 54

Query: 65  NGSFGEE-----------------------------AHHNAGGSIFAGYNVED---SCIM 92
                ++                             ++    G    GYN +    S ++
Sbjct: 55  GFGTQDDRVPTVIGVGPASLLVPPGTTAVVAFSNRESNEGFVGGGQIGYNYQFTPGSGVV 114

Query: 93  YGVEGDVRYTV-----------------PVLADNIHSLHGIGGSLRIRGGYEVSDSLLLY 135
            GVE D +Y                    V      S     G++R R GY   D  L+Y
Sbjct: 115 IGVEADAQYADFGRDRNRFLSTSPLAAQQVFNPGGLSGLDFFGTVRGRLGYAF-DRTLVY 173

Query: 136 ATVGPDVAQKYET--GKAGEITPIAIGGTAGVGVEVGGLSESLV 177
            T G           G          G  AG G+E    ++S +
Sbjct: 174 GTGGFAYGSGGGREFGTGVSSNDFQTGWAAGGGIEYALPTDSFL 217


>gi|254563933|ref|YP_003071028.1| 31 kDa outer-membrane immunogenic protein [Methylobacterium
           extorquens DM4]
 gi|254271211|emb|CAX27223.1| putative 31 kDa outer-membrane immunogenic protein precursor
           (omp31) [Methylobacterium extorquens DM4]
          Length = 274

 Score = 62.0 bits (149), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 50/265 (18%), Positives = 81/265 (30%), Gaps = 75/265 (28%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+   +  G++ + L+   +A AAD  RRA       +P             + G Y G 
Sbjct: 1   MRNSLILSGLAGILLSG--TALAADLPRRAEALVFTPIP----------VFAWTGAYFGP 48

Query: 61  SALYNGSFGEEA------------------------HHNAGGSIFAGYNVE---DSCIMY 93
           +  Y  +  +                                   AGYN +    +  ++
Sbjct: 49  NGGYAYTESDTLRTTGIGALQANVTNDLRRANVALPKDGFSFGGQAGYNFQLTPGTGFVF 108

Query: 94  GVEGDVRY----------------TVPVLADNIHSLHGIGGSLRIRGGYEVSDSLLLYAT 137
           G E D +Y                   VL +   +     G++R R GY   D +L+Y T
Sbjct: 109 GFETDAQYLDLARSRTETIFRPAINPNVLRNVYAADLDFLGTVRGRVGYAF-DRVLVYGT 167

Query: 138 VGPDVAQKYETGK---------AGEITPIAIGGTAGVGVEVGGLSES---------LVAR 179
            G                    AG  + +  G   G G+E    + S         +  +
Sbjct: 168 GGFAYGTTTLAAVFRTGTPVTYAGARSGLETGYAYGGGIEYAIPANSFLDLTGSLQMTVK 227

Query: 180 LEY-RASKYSKVEGFYNTISLGVGM 203
            EY R    S+     +T   GVG 
Sbjct: 228 AEYLRYDLGSRTVLIRSTGGPGVGY 252


>gi|89070001|ref|ZP_01157333.1| possible outer membrane protein [Oceanicola granulosus HTCC2516]
 gi|89044449|gb|EAR50580.1| possible outer membrane protein [Oceanicola granulosus HTCC2516]
          Length = 200

 Score = 62.0 bits (149), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 33/162 (20%), Positives = 62/162 (38%), Gaps = 11/162 (6%)

Query: 39  PTIATNRYVPIRHDFNGPYAGLSALYNGSFGEEAHHNAGGSIFAG---YNVEDSCIMYGV 95
           P  A         D++G Y G+   Y  + G+       G+++ G   Y  +   I+ G 
Sbjct: 34  PAPAPAPVTMATRDWSGAYGGVQLGYGQTDGDVFAEEEEGALYGGFVGYQRDFGSIVAGA 93

Query: 96  EGDVRYTVPVLADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEIT 155
           E D   T  +  D   +        ++R GY+ + + L YAT G  +A      +A    
Sbjct: 94  ELDYLGT-DITNDATGTDIDSLARAKLRVGYD-AGNFLPYATGGYAMANTSGGLEADAD- 150

Query: 156 PIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFYNTI 197
               G   GVG +   +++ +    E   +++   +G  +  
Sbjct: 151 ----GYFYGVGADY-MVTDRIAVGGEITKNEFEDFDGSGDDF 187


>gi|188584563|ref|YP_001928008.1| outer membrane insertion C-terminal signal [Methylobacterium populi
           BJ001]
 gi|179348061|gb|ACB83473.1| outer membrane insertion C-terminal signal [Methylobacterium populi
           BJ001]
          Length = 299

 Score = 62.0 bits (149), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 48/311 (15%), Positives = 76/311 (24%), Gaps = 118/311 (37%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+   LA+  S LA        AAD       G        A         D++G Y G 
Sbjct: 1   MRFATLALLTSVLA----TPVLAADLDYGVLRGSDDDYLPPA------PVVDWSGFYVGG 50

Query: 61  SALYNG---SFGEE-----------------------------AHHNAGGSIFAGYNVED 88
              Y+     FG                                       ++AG N + 
Sbjct: 51  HGGYSSAALGFGNAFQSIVANALRYTAAEEEMKASQFLAARGIHASGTSYGVYAGVNYQF 110

Query: 89  SCIMYGVEGDVRY----------------------TVPVLADNIHSLHGIGGSLRIRGGY 126
             ++ G+E D  Y                          LA    +     G++R R GY
Sbjct: 111 DDVVVGLEADYTYFGKTGAAFDQITRVMTTANGYRNTVALAGEASTEIEDYGTIRGRIGY 170

Query: 127 EVSDSLLLYATVGPDVAQKYETGKAG---------------------------------- 152
              +  L + T G  V +                                          
Sbjct: 171 GFGN-FLPFVTGGLAVGRAVVNDTVAIQNYAYDEAAYKANQTGGPTTYVNHFGYQIFDQK 229

Query: 153 ---------------EITPIAIGGTAGVGVEVGGLSESLVARLEYRA---SKYSKVEGFY 194
                                 G   G G+E   ++ + + R EY+    + +   +   
Sbjct: 230 SPPGSIPDYPTVHGITKKVTVTGVALGGGLEY-AITPNFLLRGEYQYVLFNDFQGHKAEL 288

Query: 195 NTISLGVGMKF 205
           NT+  G  +KF
Sbjct: 289 NTVRGGAAIKF 299


>gi|255264827|ref|ZP_05344169.1| conserved hypothetical protein [Thalassiobium sp. R2A62]
 gi|255107162|gb|EET49836.1| conserved hypothetical protein [Thalassiobium sp. R2A62]
          Length = 203

 Score = 61.6 bits (148), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 30/163 (18%), Positives = 50/163 (30%), Gaps = 10/163 (6%)

Query: 3   KLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAG--- 59
            +      S+L L +   + A    +         V       Y     D+ G YAG   
Sbjct: 1   MMKFVSVTSALVLGATTPSFAGTLEQAEIDPMVETVTMAPAPTY---GRDWTGGYAGIQL 57

Query: 60  --LSALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIG 117
                  +    +     A   + AGY  +    + G E D   T  + +  +       
Sbjct: 58  GLGQVDVDPDGADLNGDGALYGVHAGYMYDLGRYVLGGELDYDLT-EIESTELAGKVDSV 116

Query: 118 GSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIG 160
             L+ R GY+ + ++L Y T G       +T   G       G
Sbjct: 117 LRLKGRVGYD-AGAILPYMTAGFAQTDASDTALGGVDDGYFFG 158


>gi|296447726|ref|ZP_06889642.1| hypothetical protein MettrDRAFT_3358 [Methylosinus trichosporium
           OB3b]
 gi|296254758|gb|EFH01869.1| hypothetical protein MettrDRAFT_3358 [Methylosinus trichosporium
           OB3b]
          Length = 840

 Score = 61.6 bits (148), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 28/139 (20%), Positives = 45/139 (32%), Gaps = 30/139 (21%)

Query: 75  NAGGSIFAGYNVEDSCIMYGVEGDV----RYTVPVLADNIHSLH----------GIGGSL 120
              G + AG N + + ++ G+E D+      T       I                 G++
Sbjct: 652 GFIGGLQAGINQQAAGVLMGLEADLHGVSGNTDTRWRMGIKDAISTYASRTTTLNYLGTI 711

Query: 121 RIRGGYEVSDSLLLYATVGPDVA--------------QKYETGKAGEITPIAIGGTAGVG 166
           R R GY  + +L +Y T G                      +          +G T G G
Sbjct: 712 RGRLGYLATPTLAIYGTGGLAYGGVISAGIISSQRVNGGALSFNFPAFQDSLLGWTVGAG 771

Query: 167 VEVGGLSESLVARLEY-RA 184
           VE   LS     +++Y R 
Sbjct: 772 VE-WALSPDWSVKIDYLRY 789


>gi|323138506|ref|ZP_08073575.1| porin [Methylocystis sp. ATCC 49242]
 gi|322396302|gb|EFX98834.1| porin [Methylocystis sp. ATCC 49242]
          Length = 300

 Score = 61.6 bits (148), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 35/208 (16%), Positives = 52/208 (25%), Gaps = 68/208 (32%)

Query: 52  DFNGPYAGLSALYNGSFGEEAH-------------------------------HNAGGSI 80
            + G Y GL+A         A+                                   G  
Sbjct: 40  TWTGFYVGLNAGGTWGQSNSANLSSFALFNDPLWFQGNAFASSAWGAVPTSNASGFIGGG 99

Query: 81  FAGYNVED-SCIMYGVEGDVRYTVPVLADNIHSLHGIG--------------------GS 119
             GYN +     + GVE D++        +  +                         G+
Sbjct: 100 QIGYNWQFGGSFLTGVEADIQGIAASSGRSSVTGVAFNALTGAMAMTTTDVSKRLDYLGT 159

Query: 120 LRIRGGYEVSDSLLLYATVGPDVAQKYETG---------------KAGEITPIAIGGTAG 164
           +R R GY V+ +LL Y T G                              +   +G TAG
Sbjct: 160 VRGRLGYLVTPTLLAYGTGGLAYGGVGLNASQFSFDTGAFFGAGIGNTTFSNTLVGWTAG 219

Query: 165 VGVEVGGLSESLVARLEYRASKYSKVEG 192
            GVE   +     A+ EY          
Sbjct: 220 GGVEWMFM-PGWSAKGEYLYYDLGSTTN 246


>gi|146278175|ref|YP_001168334.1| hypothetical protein Rsph17025_2139 [Rhodobacter sphaeroides ATCC
           17025]
 gi|145556416|gb|ABP71029.1| hypothetical protein Rsph17025_2139 [Rhodobacter sphaeroides ATCC
           17025]
          Length = 197

 Score = 61.6 bits (148), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 39/194 (20%), Positives = 68/194 (35%), Gaps = 20/194 (10%)

Query: 20  SAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSFGEEA---HHNA 76
            A A  P+  A      +V  +     V    D++G Y G    Y     E +    + A
Sbjct: 16  PAFAGGPITVAP---EPIVEPMPAPVVVAPVTDWSGFYVGGQLGYGDVGTEISGLDGNGA 72

Query: 77  GGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGSLRIRGGYEVSDSLLLYA 136
            G + AGY  +    + G E  + Y +  +     +      +L++  G ++    LLYA
Sbjct: 73  IGGVHAGYRYDFGRAVVGAE--IAYDMTNIDIGDSAELDNVATLKLMAGGKI-GRGLLYA 129

Query: 137 TVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVA-----RLEYRASKYSKVE 191
           T G   A         +      G   G+G +   L++         R E+     +  +
Sbjct: 130 TAGGTWADVTSDAGDPDD-----GYVYGIGYDY-MLNDRWSVGAELLRHEWDTFDDAGTD 183

Query: 192 GFYNTISLGVGMKF 205
               T+   VG +F
Sbjct: 184 ADATTLQAKVGFRF 197


>gi|254485896|ref|ZP_05099101.1| outer membrane protein, putative [Roseobacter sp. GAI101]
 gi|214042765|gb|EEB83403.1| outer membrane protein, putative [Roseobacter sp. GAI101]
          Length = 198

 Score = 61.2 bits (147), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 44/200 (22%), Positives = 71/200 (35%), Gaps = 22/200 (11%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M++       + +A ++F  +  A  +         + P    N       D+ G Y GL
Sbjct: 1   MKRTMKFATAALVASSAFAGSAFAGSLSEPVVEPVMMEPVPVVNT----GGDWTGFYTGL 56

Query: 61  SALYNGSFGEEAHHNAGG--SIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGG 118
              Y  + G        G     AGYN +    + G E D   T   L +   ++  +  
Sbjct: 57  QLGYADADGPGNLDGDNGSYGFHAGYNYDFGRFVAGAELDYDKTDIDLNNGAATIDSV-A 115

Query: 119 SLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGG----TAGVGVEVGGLSE 174
             +++GGY+  +  +LYAT G   A      + G    I +      T  VG E+     
Sbjct: 116 RAKVKGGYDFGN-YMLYATGGYAQADTTLGDEDGAFYGIGMTYRVSETYSVGAEL----- 169

Query: 175 SLVARLEYRASKYSKVEGFY 194
                LE+R S    V G  
Sbjct: 170 -----LEHRFSDVGGVSGSD 184


>gi|220921616|ref|YP_002496917.1| porin [Methylobacterium nodulans ORS 2060]
 gi|219946222|gb|ACL56614.1| porin [Methylobacterium nodulans ORS 2060]
          Length = 285

 Score = 61.2 bits (147), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 33/175 (18%), Positives = 48/175 (27%), Gaps = 49/175 (28%)

Query: 51  HDFNGPYAGLSALYNGSFGEEAH---------------------------HNAGGSIFAG 83
             + G YAG +A Y                                        G    G
Sbjct: 39  FTWTGFYAGFNAGYGFDVSSNNGPTVLGVGPATGLVFAPTVIAFRNQNNLDGFVGGGQVG 98

Query: 84  YNVED---SCIMYGVEGDVRYTVPVLADNIH-----------------SLHGIGGSLRIR 123
           YN +    +  + G+E D ++       N                   +     G++R R
Sbjct: 99  YNYQFTPGAGFVIGLEADAQFADFGRNRNRFIATGPIAAQTVFNPAGIAGLDWFGTVRGR 158

Query: 124 GGYEVSDSLLLYATVGPDVAQKYETGKA-GEITPIAIGGTAGVGVEVGGLSESLV 177
            GY V D +L Y T G                     G TAG GVE    ++S +
Sbjct: 159 LGYAV-DRVLFYGTGGFAYGGGGGRDFGLPNDDDFQTGWTAGGGVEYALPTDSFL 212


>gi|163736518|ref|ZP_02143937.1| hypothetical protein RGBS107_15341 [Phaeobacter gallaeciensis
           BS107]
 gi|161390388|gb|EDQ14738.1| hypothetical protein RGBS107_15341 [Phaeobacter gallaeciensis
           BS107]
          Length = 194

 Score = 61.2 bits (147), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 33/174 (18%), Positives = 54/174 (31%), Gaps = 18/174 (10%)

Query: 4   LFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSAL 63
           +   V ++++A A    A A +             PT           D+ G Y G    
Sbjct: 1   MTRIVSMAAIAAALSTPAFAGNL----EEPVVAPAPTAPPVVVANDGGDWTGAYIGGQIG 56

Query: 64  YNGSFGEE--AHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGSLR 121
              +      +  +    + AGYN +    + G E D   T   L     +   +   +R
Sbjct: 57  QLDADTSNGLSGDDVSYGVHAGYNYDFGRFVLGGEIDYDATDVDLGGGAAT---VDSVMR 113

Query: 122 IRG--GYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIG------GTAGVGV 167
            +   GY+    +L Y T G          + GE   I +        T G  V
Sbjct: 114 GKVKAGYDF-GPVLAYVTGGVAQVDTSVGDETGEFYGIGVAYRVTDQWTVGGEV 166


>gi|39937375|ref|NP_949651.1| hypothetical protein RPA4315 [Rhodopseudomonas palustris CGA009]
 gi|39651233|emb|CAE29756.1| conserved hypothetical protein [Rhodopseudomonas palustris CGA009]
          Length = 275

 Score = 61.2 bits (147), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 48/258 (18%), Positives = 76/258 (29%), Gaps = 81/258 (31%)

Query: 19  CSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGS----------- 67
            +A AAD        G             P   ++ G Y G    Y  S           
Sbjct: 28  QTAYAADMPDYGPLRG--------ALVETPRVINWEGFYVGGQGGYGTSDMDFTNSTQGI 79

Query: 68  ---------------------FGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDV------- 99
                                 G+ + H  G   F GYN +   ++ G+E +        
Sbjct: 80  VSNLLVNTAVQGALGVSSWPVLGKSSSHGQGWGGFVGYNAQWDDVVLGIEANYMHGNFGG 139

Query: 100 ----RYTVPVLADNIHSLHGIG----------GSLRIRGGYEVSDSLLLYATVGPDVAQK 145
                    + +  ++     G          GS R+R GY    S L YA  G  + Q 
Sbjct: 140 STSGSMARQISSGGVNYGAIYGASAGINVHDVGSARLRAGYAF-GSFLPYAFGGVALGQA 198

Query: 146 YETGKAG-----------------EITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYS 188
                A                  + +    G + GVG++   L   L  R E+   K++
Sbjct: 199 DIVQSASVIGTDAGGTWVLSGSQVQNSHFIYGYSGGVGMD-MMLYRGLFVRAEWEYQKFA 257

Query: 189 K-VEGFYNTISLGVGMKF 205
             +    +T+  G+G KF
Sbjct: 258 APINTAVSTVRGGIGYKF 275


>gi|90409178|ref|ZP_01217293.1| outer membrane protein OmpA [Psychromonas sp. CNPT3]
 gi|90309723|gb|EAS37893.1| outer membrane protein OmpA [Psychromonas sp. CNPT3]
          Length = 326

 Score = 61.2 bits (147), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 30/171 (17%), Positives = 62/171 (36%), Gaps = 13/171 (7%)

Query: 47  VPIRHDFNGPYAGLSALYNGS-------FGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDV 99
               ++ N  Y G  A ++         + +    + G  +F GY+  D   + G   + 
Sbjct: 19  QAAENNTNNFYIGAKAGWSKYQDACLYGYTKCEEDSLGYGLFVGYDFTDWFAIEGGVTNH 78

Query: 100 RYTVPVLADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQK-YETGKAGEITPIA 158
                   +       I   L  + GY ++D++ LY  VG             G+ +  +
Sbjct: 79  NEVNSSYQNYDVEALAISSDLSTKFGYRLTDNVQLYTKVGISYQHINKTMSDLGDFSGSS 138

Query: 159 IGGTAGVGVEVGGLSESLVARLEYRA----SKYSKVEGFYNTISLGVGMKF 205
            GG   +G++   L  +   R EY+        + ++   +  S+G+  +F
Sbjct: 139 FGGLVAMGIDY-KLDNNWSLRGEYQFIDGIGDDTSLKADLHFTSVGIKYRF 188


>gi|296447762|ref|ZP_06889677.1| Carbohydrate-selective porin OprB [Methylosinus trichosporium OB3b]
 gi|296254739|gb|EFH01851.1| Carbohydrate-selective porin OprB [Methylosinus trichosporium OB3b]
          Length = 732

 Score = 61.2 bits (147), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 39/173 (22%), Positives = 51/173 (29%), Gaps = 32/173 (18%)

Query: 54  NGPYAGLSALYNGSFGEEAHHNAGGSIFA--GYNVEDSCIMYGVEGDVRY-TVPVLADNI 110
           +G                +H  AG SI A  GY+     I+YGVE D  Y  +   A  +
Sbjct: 59  SGGRLEGFGADAFGLAAPSHDRAGASIGAQIGYDWRKGEIVYGVETDFNYLGLRRAATGL 118

Query: 111 HSLHGIGG----------------SLRIRGGYEVSDSLLLYATVGPDVAQ---------- 144
            +     G                SLR R G       L+Y T G               
Sbjct: 119 FAAPSSFGLGGYALTADESSNSFMSLRGRLGRAY-GPWLVYGTGGVAAGGWRGASNLARL 177

Query: 145 -KYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFYNT 196
                  A       +    G GV+   L +   ARLEY        +  Y T
Sbjct: 178 PSLALYSAPLSQSSRMKYAIGAGVQ-RALGDHWSARLEYLYLNQQSQKQLYET 229


>gi|319784137|ref|YP_004143613.1| outer membrane protein [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
 gi|317170025|gb|ADV13563.1| outer membrane protein [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
          Length = 255

 Score = 61.2 bits (147), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 29/188 (15%), Positives = 52/188 (27%), Gaps = 41/188 (21%)

Query: 49  IRHDFNGPYAGLSALY-------------NGSFGEE-----------AHHNAGGSIFAGY 84
             +D++G Y G                  NG F  +                 G I AG 
Sbjct: 36  SAYDWSGLYVGGHLGVANGDITATDMTEPNGGFFTDLVPAGTEGFDFNKAGVAGGIHAGA 95

Query: 85  NVEDSCIMYGVEGDVRYTVPVL---------ADNIHSLHGIGGSLRIRGGYEVSDSLLLY 135
             +    + G E     T             +D   +      ++  R GY   D +L+Y
Sbjct: 96  QWQWGQFILGGEATWTATGIRKTITSPYFPDSDTETAKISNYATVVGRVGYAF-DRVLIY 154

Query: 136 ATVGPDVAQKYETGKAGE------ITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSK 189
           A  G    +     +  +            G   G G++   L+ +L   ++Y       
Sbjct: 155 AKAGYAGGKVDFRARDNDALVTYEKNEWQNGYALGAGIDY-ALTNNLSLGVDYTHVDLGH 213

Query: 190 VEGFYNTI 197
                + +
Sbjct: 214 KTSTGDNV 221


>gi|260459523|ref|ZP_05807778.1| outer membrane protein-like protein [Mesorhizobium opportunistum
           WSM2075]
 gi|259035077|gb|EEW36333.1| outer membrane protein-like protein [Mesorhizobium opportunistum
           WSM2075]
          Length = 436

 Score = 61.2 bits (147), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 39/200 (19%), Positives = 70/200 (35%), Gaps = 39/200 (19%)

Query: 44  NRYVPIRHDFNGPYAGLSALYNGS--------FGEEAHHNAGG-SIFA----GYNVEDSC 90
             +    +++ G Y G       S         G    +  GG   F     GY+ +   
Sbjct: 237 AAFETPAYNWTGFYIGGGLGAGASVHQIEIPPLGGAKFNGLGGEGAFGELNVGYDQDFGS 296

Query: 91  IMYGVEGDVRYTV-----PVLADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPD---V 142
            + GV  D RY+       +   +I+     G  +  R G ++++S L YA  G      
Sbjct: 297 WVAGVMVDARYSGMTSKLDLGVGSINVDTDYGFDVLGRVGMKMNESTLAYALAGYSWQHF 356

Query: 143 AQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEG---------- 192
                          + G + G G+E   +S ++   LEYR S++++ +           
Sbjct: 357 DLNASDPVGDIADWGSSGFSVGAGLET-AVSSNMTIGLEYRYSQFAEKDLSFLLGSGAPD 415

Query: 193 -------FYNTISLGVGMKF 205
                   ++T+ LG   KF
Sbjct: 416 GLVTTTPSFHTVRLGAKYKF 435



 Score = 52.3 bits (124), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 36/201 (17%), Positives = 62/201 (30%), Gaps = 38/201 (18%)

Query: 9   GVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSF 68
            VS  AL    +A AAD V+     G                 +++G Y G       + 
Sbjct: 14  AVSVFAL--MSAAHAADVVQPVEASG----------------FNWSGLYVGFGVGAGANV 55

Query: 69  GEEAHH------------NAGGSIFAGYNVE-DSCIMYGV-----EGDVRYTVPVLADNI 110
            +                   G + AGY+       + G       GD++  +     + 
Sbjct: 56  HKLGSDFIPISLNGIGGEGVYGELTAGYDYMVSPRFLLGGLLDVHVGDIKTKIDAAGFDA 115

Query: 111 HSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAG-EITPIAIGGTAGVGVEV 169
                 G    +R GY  + + L Y   G    +      AG        G   G G+E 
Sbjct: 116 SIQETYGFDAGLRVGYLFTPNTLGYVLGGYSWQKYKLDSNAGFGFDWDQSGYFVGGGIET 175

Query: 170 GGLSESLVARLEYRASKYSKV 190
             ++ +   + EYR +++   
Sbjct: 176 -AINSNWTIKTEYRYTRFGTK 195


>gi|310639322|ref|YP_003944081.1| outer membrane protein [Ketogulonicigenium vulgare Y25]
 gi|308752898|gb|ADO44042.1| outer membrane protein [Ketogulonicigenium vulgare Y25]
          Length = 261

 Score = 61.2 bits (147), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 36/224 (16%), Positives = 72/224 (32%), Gaps = 30/224 (13%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVP-IRHDFNGPYAG 59
           +        +  + +A+F ++ +A            + P +   +  P     + G Y G
Sbjct: 17  LSTFKWISIMRYICIAAFLASTSAIAANAGGLSTPVMEPPVIMVQPTPMPAPSWQGAYVG 76

Query: 60  LSALY---------------NGSFGEEAHHNAGG---SIFAGYNVEDSCIMYGVEGDV-- 99
            +  Y                G+  +     A G   +I  GY+ + +  ++G+ G+   
Sbjct: 77  ANVNYGDLSVDSTGVLETALQGAGFDTTVATADGVNYAIRGGYDWQFNNWLFGLGGEYSF 136

Query: 100 -RYTVPVLAD-------NIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKA 151
             Y   +  D       +I        +  +R GY  S S   Y  VG   A    T   
Sbjct: 137 GSYDGGLSGDLVTALGTDIDLSIDSVATAYLRAGYAFSQSTAAYLLVGYTWATAEATLGG 196

Query: 152 GEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFYN 195
              +      + G+GVE    + +     EY  + +  +    +
Sbjct: 197 TTYSEDYEAASYGLGVE-HRFNRAWSVYGEYVYTDFGDINPTND 239


>gi|289209494|ref|YP_003461560.1| OmpA domain protein transmembrane region-containing protein
           [Thioalkalivibrio sp. K90mix]
 gi|288945125|gb|ADC72824.1| OmpA domain protein transmembrane region-containing protein
           [Thioalkalivibrio sp. K90mix]
          Length = 215

 Score = 61.2 bits (147), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 40/191 (20%), Positives = 62/191 (32%), Gaps = 36/191 (18%)

Query: 50  RHDFNGPYAGLSALYNGSFGEEAHHNAGG-----------SIFAGYNVEDSCIMY-GVE- 96
              F+G Y G    + G   +    + GG            +  G+       +Y GVE 
Sbjct: 26  ASPFHGSYVGGQLGWVGYDIDYREADDGGISGLSASGLTGGVMTGWGTVLDNGLYLGVEF 85

Query: 97  ----GDVRYTVPVLADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQ------KY 146
                D   TV +    +         +  R G  V+DS+LLY   G   ++      + 
Sbjct: 86  DAQTEDADLTVRIDDAELGVDSKYSYGITGRLGTTVNDSVLLYGLAGYQRSRFDYRLTET 145

Query: 147 ETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKV------------EGFY 194
           +   +        G   GVGVE   L   L  R EY  + Y               +   
Sbjct: 146 DEDLSLRFKDSINGARIGVGVEYQ-LDNRLFMRAEYSYTFYESERYRIEDEFTLRFDPDA 204

Query: 195 NTISLGVGMKF 205
              +LG+G +F
Sbjct: 205 QRFTLGLGYRF 215


>gi|192293657|ref|YP_001994262.1| hypothetical protein Rpal_5301 [Rhodopseudomonas palustris TIE-1]
 gi|192287406|gb|ACF03787.1| conserved hypothetical protein [Rhodopseudomonas palustris TIE-1]
          Length = 561

 Score = 61.2 bits (147), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 37/191 (19%), Positives = 63/191 (32%), Gaps = 37/191 (19%)

Query: 37  VVPTIATNRYV-PIRHDFNGPYAGLSALYNG-------------SFGEEAHHNAGGSIFA 82
            +P       V P+  ++ G Y G     +                G      A   I  
Sbjct: 22  DMPRFPPLMPVAPVSWNWTGLYWGAHVGGSFGSSSFSDPAGPALYGGSVRSPAALAGIQI 81

Query: 83  GYNVE-DSCIMYGVEGDVRY------------TVPVLADNIHSLHGIGGSLRIRGGYEVS 129
           GYN + ++  + GVE D+              +   ++ N         +L  R G+   
Sbjct: 82  GYNYQPNANWLIGVEADLSSMNAKGTNTCMASSGLFISSNCRVRQDALATLTGRAGFVAG 141

Query: 130 D--SLLLYATVGPD-------VAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARL 180
                LLYA  G         +A  Y  G + ++     G T G G+E   L+ +   +L
Sbjct: 142 PGGRTLLYAKGGAAFLSERLDIAVGYPLGNSTDVNDGRWGWTVGAGIE-RALAPAWSVKL 200

Query: 181 EYRASKYSKVE 191
           EY  + +   +
Sbjct: 201 EYNYADFGSRD 211


>gi|296445959|ref|ZP_06887909.1| putative outer-membrane immunogenic protein precursor [Methylosinus
           trichosporium OB3b]
 gi|296256477|gb|EFH03554.1| putative outer-membrane immunogenic protein precursor [Methylosinus
           trichosporium OB3b]
          Length = 292

 Score = 60.8 bits (146), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 39/172 (22%), Positives = 58/172 (33%), Gaps = 36/172 (20%)

Query: 55  GPYAGLSALYNGSFGEEAHHNAGGSIFAGYNVE-DSCIMYGVEGDVRYTVPVLADNIHSL 113
           GP    SA               G    GYN +     + G+E D++      +   +S 
Sbjct: 74  GPNLATSAALATGSYPSDDARFLGGGQIGYNFQASPSFVLGLEADIQGVAGSRSTAKNSG 133

Query: 114 HGIG--------------------GSLRIRGGYEVSDSLLLYATVGPDVAQKYET----- 148
            GI                     G++R R G+  + +LLLYAT G    +   T     
Sbjct: 134 LGIPAGFLGVVASDTTTTKRLDYLGTMRGRVGFLAAPTLLLYATGGLAYGEVGSTVTIGQ 193

Query: 149 ---------GKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVE 191
                    G  G  + + +G TAG G+E   L+     +LEY       V 
Sbjct: 194 ANLPFAPSFGSFGGYSDLRVGWTAGGGLEWL-LAPKWSVKLEYLYYDLGSVT 244


>gi|85374383|ref|YP_458445.1| outer membrane protein-like [Erythrobacter litoralis HTCC2594]
 gi|84787466|gb|ABC63648.1| outer membrane protein-like [Erythrobacter litoralis HTCC2594]
          Length = 223

 Score = 60.8 bits (146), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 44/233 (18%), Positives = 81/233 (34%), Gaps = 45/233 (19%)

Query: 5   FLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALY 64
            +A+ ++  A+A+   A A      +   G            V     ++   AG S   
Sbjct: 4   AVALILAGTAMATASPALAQTVQNDSPFTGAR----------VQAVTGYDNIKAGSSVDD 53

Query: 65  NGSFGEEAHHNAGGSIFA---GYNVEDSCIMYGVEGDVRYT--VPVLADNIHSLHGIGGS 119
           +G+   +      G I+    GY+V+   ++ G E +  ++       +      G G  
Sbjct: 54  DGNPNNDQSAE--GVIYGAAVGYDVDLGPVVIGPEAEFAWSTADTDFDNGDFEGFGFGNV 111

Query: 120 -------LRIRGGYEVSDSLLLYATVGPDVAQKYETGKAG----EITPIAIGGTAGVGVE 168
                  L  R G ++ D  L Y   G   A+       G    +      G   G G+E
Sbjct: 112 SADRDLYLGARVGAKIGDQALAYVKGGYTNAKLNIRSNDGTTKFDTDYDLDGYRVGGGLE 171

Query: 169 VGGLSESLVARLEYRASKYS----------------KVEGFYNTISLGVGMKF 205
              ++ ++    EYR S YS                 V+   + +S+G+G++F
Sbjct: 172 Y-AINRNMFVNAEYRYSNYSRAEVDFDGTLPDSDRFDVDLDRHQVSVGLGVRF 223


>gi|299134299|ref|ZP_07027492.1| porin [Afipia sp. 1NLS2]
 gi|298591046|gb|EFI51248.1| porin [Afipia sp. 1NLS2]
          Length = 275

 Score = 60.8 bits (146), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 41/238 (17%), Positives = 69/238 (28%), Gaps = 86/238 (36%)

Query: 52  DFNGPYAGLSALYNGS---------------------------------FGEEAHHNAGG 78
           ++ G YAG  A Y  +                                  G+   H +  
Sbjct: 40  NWQGFYAGGQAGYGSADMNFSSSNSAMIAQLLANTNIENEMNVSSWPLLGGKTNTHQSQV 99

Query: 79  SIFAGYNVEDSCIMYGVEG------------------------DVRYTVPVLADNIHSLH 114
             F GYN +   ++ GVE                         D  Y +  +  +     
Sbjct: 100 GGFVGYNSQWDDVVLGVEANYMHGTFSGASVSAPVSRGMLLTSDSLYHIVTVNSSKSISI 159

Query: 115 GIGGSLRIRGGYEVSDSLLLYATVGPDVAQK-------------------------YETG 149
              G++R R GY   +  + Y   G  + +                            + 
Sbjct: 160 SDMGTIRARAGYVWGN-FMPYVFGGAALGRGNIYSAVSVSDQKGADSAAAQAATPVTLSA 218

Query: 150 KAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSK--VEGFYNTISLGVGMKF 205
             G    +  G TAG+G EV     ++ AR E+   ++     +   NT+  G+G KF
Sbjct: 219 SDGISGKMLYGYTAGLGTEVMLF-GNVFARAEWEYIRFVNAGADVNINTVRGGLGYKF 275


>gi|169825359|ref|YP_001691252.1| hypothetical protein M446_7000 [Methylobacterium sp. 4-46]
 gi|168199281|gb|ACA21227.1| hypothetical protein M446_7000 [Methylobacterium sp. 4-46]
          Length = 583

 Score = 60.8 bits (146), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 42/222 (18%), Positives = 62/222 (27%), Gaps = 63/222 (28%)

Query: 20  SAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSFGEEAHH----- 74
           +A AAD  +          P +A    V     + GPYAG+   Y GS  E         
Sbjct: 20  AASAADLPQLTP-------PMMAFAPLVTPSFTWTGPYAGVFFGY-GSLDESGTGRCIGP 71

Query: 75  ---------------NAGGSIFAGYNVED---SCIMYGVEGDV------RYTVPVLADNI 110
                          +       GYN++    S ++ G   D        Y   +L   +
Sbjct: 72  RCVRLPALSPGARAADLSAGSEVGYNLQASPGSGLVIGAAVDYQTTRLRGYGESILVREV 131

Query: 111 HSLHGIG------------GSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKA------- 151
                              G++R + GY   D L +Y T G                   
Sbjct: 132 DENSDFAAFYHLGQRLDTFGAVRGKAGYAF-DRLFVYGTGGLAYGYVRIDVGTALTVGDR 190

Query: 152 -----GEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYS 188
                G  +   +G  AG G E   +S  L  + E       
Sbjct: 191 QFAAQGLTSGFRLGYAAGGGAEY-AISPHLSVKAEGLYYDLG 231


>gi|148252997|ref|YP_001237582.1| hypothetical protein BBta_1454 [Bradyrhizobium sp. BTAi1]
 gi|146405170|gb|ABQ33676.1| hypothetical protein BBta_1454 [Bradyrhizobium sp. BTAi1]
          Length = 665

 Score = 60.8 bits (146), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 47/236 (19%), Positives = 74/236 (31%), Gaps = 75/236 (31%)

Query: 42  ATNRYVPIRHDFNGPYAGLSALY-------------------NGSFGEEAHHNAGGS--- 79
           A + Y    +D+ G Y G  A                     +GSFG   + +       
Sbjct: 3   AQSPYTSTVYDWTGWYIGAHAGALRGSSSWTATPLGPGGPPVSGSFGLPLNFDFMAGTGT 62

Query: 80  ----IFAGYNVEDSC-IMYGVEGDVR---------YTVPVLADNIHSLHG---------I 116
               +  GYN      +M G+EGDV          Y+V      I    G          
Sbjct: 63  YVLGLQGGYNYVLPSRVMLGIEGDVSVPNSDVVVPYSVRGGQTVISPAIGQVTYSEAVIH 122

Query: 117 GGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPI---------------AIGG 161
            GS+R R GY   D  LLY T G        T                         +G 
Sbjct: 123 YGSVRGRVGYAF-DHFLLYGTGGFAWTYDQLTRSQDASPVTGSFVPAGTLETKLLWRLGW 181

Query: 162 TAGVGVEVGGLSESLVARLEYRASKYS-------------KVEGFYNTISLGVGMK 204
            AG+GVE+  ++ +  A+ E+  + +              + +    ++ +G+  K
Sbjct: 182 VAGIGVEIP-ITGNWSAKAEFLETGFGRRGAFFAASIDAFRSDFATQSVRVGLNYK 236


>gi|311280058|ref|YP_003942289.1| hypothetical protein Entcl_2757 [Enterobacter cloacae SCF1]
 gi|308749253|gb|ADO49005.1| hypothetical protein Entcl_2757 [Enterobacter cloacae SCF1]
          Length = 234

 Score = 60.8 bits (146), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 35/183 (19%), Positives = 58/183 (31%), Gaps = 47/183 (25%)

Query: 53  FNGPYAGLSALYNGSFGEEAH---------------HNAGGSIFAGYNVE-DSCIMYGVE 96
           F+G Y G +  Y      + +                   G I AG+  + D+ I+ GVE
Sbjct: 25  FDGWYVGGNFGYGSGTNHDVYVVPGNAEASGTPRDIDGTIGGIQAGHYWQLDNNIVLGVE 84

Query: 97  GDVRYTVPVLADNIHSLHGIGG-----------SLRIRGGYEVSDSLLLYATVGPDVAQK 145
               +    ++  I +   I             +L  + GY + +  L+Y T G  VA  
Sbjct: 85  T--GWQAANISGGISNAESISEYYDQIEINQAFNLNFKAGYAIEN-WLIYTTAGLTVASM 141

Query: 146 Y----------------ETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSK 189
                                        +G   G GVE    + S  A LEY+ +   +
Sbjct: 142 DYARGCYSDPTTTIKDCLDPYDATADGTRVGYNVGAGVE-WKFNNSFSAALEYKYTDLGE 200

Query: 190 VEG 192
            + 
Sbjct: 201 SDA 203


>gi|148258433|ref|YP_001243018.1| putative outer membrane protein [Bradyrhizobium sp. BTAi1]
 gi|146410606|gb|ABQ39112.1| putative outer membrane protein [Bradyrhizobium sp. BTAi1]
          Length = 193

 Score = 60.8 bits (146), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 37/195 (18%), Positives = 63/195 (32%), Gaps = 39/195 (20%)

Query: 46  YVPIRHDFNGPYAGLSAL-----YNGSFGEEAHHNAGGSIFAGYNVED-SCIMYGVEGDV 99
            +     + G Y G          +G+FG E+     G +  G + +     + G EG  
Sbjct: 3   QISPVRSWTGLYVGGHLGGEFSGASGAFGRESR--FLGGLQFGADYQFAPNWVLGAEGQY 60

Query: 100 RYTVPVLADNIHSLHGIG------GSLRIRGGYEVSDSLLLYATVGPDVAQKY--ETGKA 151
            +       +      +       G L  R GY      LLY   G     +      +A
Sbjct: 61  SWLAGNGQTSSLGRRELTRDRNGIGGLTGRLGYTWGAG-LLYVKGGYAYQDRSYGVRSRA 119

Query: 152 GEITPIAI-----GGTAGVGVEVGGLSESLVARLEYRASKYSKV---------------- 190
           G     A+     G T G G+E    + +   +LEY+   +                   
Sbjct: 120 GAPVAFAVRDNKSGYTVGAGLEY-MFAPNWSTKLEYQYYDFGTARFVAPSPGRLVRNGTF 178

Query: 191 EGFYNTISLGVGMKF 205
           +   +T+S+GV  +F
Sbjct: 179 DSTLHTVSVGVNYRF 193


>gi|188583655|ref|YP_001927100.1| porin [Methylobacterium populi BJ001]
 gi|179347153|gb|ACB82565.1| porin [Methylobacterium populi BJ001]
          Length = 288

 Score = 60.4 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 36/177 (20%), Positives = 51/177 (28%), Gaps = 52/177 (29%)

Query: 52  DFNGPYAGLSALYNGSFGEE-----------------------------AHHNAGGSIFA 82
            + G YAG +A Y     ++                             ++    G    
Sbjct: 40  TWTGFYAGFNAGYGFGTQDDRAPTVIGVGPASLLVPPGTTAVVAFSNRESNEGFVGGGQI 99

Query: 83  GYNVED---SCIMYGVEGDVRYTVPVLADNIH-----------------SLHGIGGSLRI 122
           GYN +    S  + GVE D +Y       N                   S     G++R 
Sbjct: 100 GYNYQFTPGSGFVIGVEADAQYADFGRNRNRFVSTSPLAAQQVFNPAGLSGLDFFGTVRG 159

Query: 123 RGGYEVSDSLLLYATVGPDVAQKYET--GKAGEITPIAIGGTAGVGVEVGGLSESLV 177
           R GY   D  L+Y T G           G          G  AG GVE    ++S +
Sbjct: 160 RLGYAF-DRTLVYGTGGFAYGSGGGREFGTGVSSDDFQTGWVAGGGVEYALPTDSFL 215


>gi|220924333|ref|YP_002499635.1| PE-PGRS family protein [Methylobacterium nodulans ORS 2060]
 gi|219948940|gb|ACL59332.1| PE-PGRS family protein [Methylobacterium nodulans ORS 2060]
          Length = 494

 Score = 60.4 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 31/141 (21%), Positives = 47/141 (33%), Gaps = 39/141 (27%)

Query: 32  HGGRGVVPTIATNRYVPIRHDFNGPYAG--LSALYNGSFGEEAHHNAGGS---------- 79
                 +P  A      +  D++G Y G  L  + +G          GG           
Sbjct: 20  ASRAADLPAQAAPIPAFVVQDWSGFYVGSHLGGVVSGRGERRVVSGDGGGLIPAGFGGRG 79

Query: 80  ------------------IFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGSLR 121
                             + AGYN +    + G+E D+    PV          + GS+R
Sbjct: 80  GRTGIAIGRIEGRTVFQGVHAGYNWQQGSAVAGIEADLASLGPV--------DDLLGSVR 131

Query: 122 IRGGYEVSDSLLLYATVGPDV 142
            R G+  SD LL+Y T G  +
Sbjct: 132 GRLGFG-SDRLLIYGTGGLAI 151



 Score = 47.0 bits (110), Expect = 0.001,   Method: Composition-based stats.
 Identities = 24/131 (18%), Positives = 38/131 (29%), Gaps = 44/131 (33%)

Query: 52  DFNGPYAGLSALYNGSFGEEAHHNAG---------------------------------- 77
            + G Y G       +       +                                    
Sbjct: 265 SWAGAYVGGHLGALHTLSGRTFGSTALAGGEPGGAGQRGIDGGGGGGGAVAFAGLARSPA 324

Query: 78  --GSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGSLRIRGGYEVSDSLLLY 135
             G    GYN +++ ++YG EGDV  +           H   G++R R G+    + L+Y
Sbjct: 325 ILGGAHLGYNWQNAALVYGAEGDVSVSAADS-------HRYLGTIRGRLGWS-GGATLVY 376

Query: 136 ATVGPDVAQKY 146
           AT G   A   
Sbjct: 377 ATAGVAFAGNE 387


>gi|170747715|ref|YP_001753975.1| porin [Methylobacterium radiotolerans JCM 2831]
 gi|170654237|gb|ACB23292.1| porin [Methylobacterium radiotolerans JCM 2831]
          Length = 276

 Score = 60.4 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 35/172 (20%), Positives = 51/172 (29%), Gaps = 48/172 (27%)

Query: 53  FNGPYAGLSALYN-----------------------GSFGEEAHHNAGGSIFAGYNVE-- 87
           + G Y G++A Y                         SF + +     G    GYN +  
Sbjct: 41  WTGAYFGINAGYAFDASSRTNNTFAVPFPYAAPGTVASFRDRSQDGFSGGAQIGYNWQIT 100

Query: 88  -DSCIMYGVEGDVRYTVPVLADNIH------------------SLHGIGGSLRIRGGYEV 128
             S ++ G E D +Y       N                    S     G++R R GY  
Sbjct: 101 PGSGVVIGFEADAQYLDFGRNRNNAFISGAVAPGYYVTDPRGLSSLDYFGTVRGRLGYAF 160

Query: 129 SDSLLLYATVGPDVAQKYETGKAG---EITPIAIGGTAGVGVEVGGLSESLV 177
            D  L+YAT G            G          G   G G+E    ++S +
Sbjct: 161 -DRTLVYATGGFAYGSGSADRSFGGYAGNDSFRTGYAVGGGIEYALPTDSFL 211


>gi|119385805|ref|YP_916860.1| putative outer membrane protein [Paracoccus denitrificans PD1222]
 gi|119376400|gb|ABL71164.1| putative outer membrane protein [Paracoccus denitrificans PD1222]
          Length = 203

 Score = 60.4 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 34/167 (20%), Positives = 64/167 (38%), Gaps = 20/167 (11%)

Query: 51  HDFNGPYAGLSALYNGSF--GEEAHHNAGG--SIFAGYNVE-DSCIMYGVEGDVRYTVPV 105
           + + G YAG+   Y+      +      GG   I AGYN +  + ++ G E    ++   
Sbjct: 45  NTWTGFYAGMQMSYSDFSVNRDGVDDATGGVYGIHAGYNHQLHNNMVIGGEITFDHS--- 101

Query: 106 LADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGV 165
            ADN         ++R + GY   ++ L+Y   G    +     +A   +    G   G+
Sbjct: 102 SADNDVWQVERLMTVRAKVGYA-HNNWLVYGLAGYAHVRTEGADRAHGKSG---GAVFGI 157

Query: 166 GVEVGGLSESLVARLE---YRASKYS----KVEGFYNTISLGVGMKF 205
           G +   +S+  +       YR S +      +E    ++   V  +F
Sbjct: 158 GADY-AVSDKWLVGGSWEGYRFSDFKNDPDNMEVDGGSVRFRVSYRF 203


>gi|296446346|ref|ZP_06888291.1| putative 31 kDa outer-membrane immunogenic protein precursor
           [Methylosinus trichosporium OB3b]
 gi|296256119|gb|EFH03201.1| putative 31 kDa outer-membrane immunogenic protein precursor
           [Methylosinus trichosporium OB3b]
          Length = 247

 Score = 60.4 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 34/194 (17%), Positives = 53/194 (27%), Gaps = 41/194 (21%)

Query: 53  FNGPYAGLSALYNG----SFGEEAHHNAGGSIFAG---------------------YNVE 87
           + G Y G +  Y      + G       G    AG                     YN +
Sbjct: 40  WTGFYLGANVGYGWLDNYTRGNSITGWNGAGWVAGAPNVADNGSSNGGVVGGGQVGYNYQ 99

Query: 88  -DSCIMYGVEGDVRYTVPVLAD----NIHSLHGIGGSLRIRGGYEVSDS-LLLYATVGPD 141
                + GVE D++                     G++R R G  +    LL+Y T G  
Sbjct: 100 FHPAWVVGVEADMQAANIGDNGPSFLGTTRAVDWFGTVRARIGTTLFSPELLIYGTGGFA 159

Query: 142 VAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVE--GFYN---- 195
                              G    G      + +  A++EY  +     +  GF N    
Sbjct: 160 YGDVRLKHALLGTLGQTGTGWTAGGGLEWLFAPNWSAKVEYLYTDIGSSDWGGFNNFEQR 219

Query: 196 ----TISLGVGMKF 205
               ++  GV   F
Sbjct: 220 VHVQSVRAGVNYHF 233


>gi|163853839|ref|YP_001641882.1| porin [Methylobacterium extorquens PA1]
 gi|218532784|ref|YP_002423600.1| porin [Methylobacterium chloromethanicum CM4]
 gi|240141293|ref|YP_002965773.1| putative 31 kDa outer-membrane immunogenic protein precursor
           (omp31) [Methylobacterium extorquens AM1]
 gi|254563802|ref|YP_003070897.1| 31 kDa outer-membrane immunogenic protein [Methylobacterium
           extorquens DM4]
 gi|163665444|gb|ABY32811.1| porin [Methylobacterium extorquens PA1]
 gi|218525087|gb|ACK85672.1| porin [Methylobacterium chloromethanicum CM4]
 gi|240011270|gb|ACS42496.1| putative 31 kDa outer-membrane immunogenic protein precursor
           (omp31) [Methylobacterium extorquens AM1]
 gi|254271080|emb|CAX27087.1| putative 31 kDa outer-membrane immunogenic protein precursor
           (omp31) [Methylobacterium extorquens DM4]
          Length = 296

 Score = 60.4 bits (145), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 37/197 (18%), Positives = 51/197 (25%), Gaps = 60/197 (30%)

Query: 40  TIATNRYVP-IRHDFNGPYAGLSALYN-----------------------------GSFG 69
                 + P     + G YAG +A Y                                 G
Sbjct: 27  AAPPPVFTPIPVFTWTGFYAGFNAGYGFGVDDNGAAPVVGVNSLTGLVRPGQTAVIAFGG 86

Query: 70  EEAHHNAGGSIFAGYNVED---SCIMYGVEGDVRY-----------------------TV 103
                   G    GYN +    S ++ G+E D +Y                         
Sbjct: 87  NSRSDGFVGGGQIGYNYQFTPGSGVVIGIEADAQYVDFGRDRNQFAVANSNPAFPGVAAQ 146

Query: 104 PVLADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKA---GEITPIAIG 160
            V   N  S     G++R R GY   D +L Y T G                       G
Sbjct: 147 QVFNPNGLSSLDFFGTVRGRLGYAF-DRVLFYGTGGFAYGAGGGRQFGLPNSSSDDFRTG 205

Query: 161 GTAGVGVEVGGLSESLV 177
             AG GVE    ++S +
Sbjct: 206 YAAGGGVEYALPTDSFL 222


>gi|94497477|ref|ZP_01304047.1| outer membrane protein-like [Sphingomonas sp. SKA58]
 gi|94423108|gb|EAT08139.1| outer membrane protein-like [Sphingomonas sp. SKA58]
          Length = 217

 Score = 60.4 bits (145), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 48/234 (20%), Positives = 81/234 (34%), Gaps = 46/234 (19%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+KL +A  ++ + +        A P      G     P +       + +D  G  AG 
Sbjct: 1   MRKLMVATLLAGVGV--------ATPALAQDVGSTFTGPRV----EAILGYDHVG--AGS 46

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGSL 120
               N    +++       I AGY+V     + GVEG+  +T      + + L    G  
Sbjct: 47  DVDNNNGRDDQSIDGLLYGIGAGYDVNLGSAVVGVEGE--WTDSTAKSDRYDLTDQFGFG 104

Query: 121 R----------IRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAI----GGTAGVG 166
           R           R G   + + L+Y   G   ++        + T        G   G G
Sbjct: 105 RVSQGRDLYIGARAGILANPATLVYVKGGYTNSKLNILAGNTDETTDRSFKLDGWRIGAG 164

Query: 167 VEVGGLSESLVARLEYRASKYS---------------KVEGFYNTISLGVGMKF 205
           VE   ++ +  A+LEYR S Y+                V+   + +   VG +F
Sbjct: 165 VE-RAINTNTFAKLEYRYSNYTDAHIDYMDGATSADFDVDTDRHQVVASVGWRF 217


>gi|87199458|ref|YP_496715.1| hypothetical protein Saro_1437 [Novosphingobium aromaticivorans DSM
           12444]
 gi|87135139|gb|ABD25881.1| hypothetical protein Saro_1437 [Novosphingobium aromaticivorans DSM
           12444]
          Length = 223

 Score = 60.4 bits (145), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 38/199 (19%), Positives = 71/199 (35%), Gaps = 43/199 (21%)

Query: 49  IRHDFNGPYAGLSALYNGSF---------GEEAHHNAGGSIFAG---YNVEDS-CIMYGV 95
               F+G +A     Y+ +            +   +  G  + G   Y++     ++ G 
Sbjct: 26  PAEAFSGFHAEALVGYDHNRSGSSEDVDNTRDLKQSIDGVEYGGAIGYDIPLGTNLVAGA 85

Query: 96  EGDVRYTVPVLADNIHSLHGIGGS---------LRIRGGYEVSDSLLLYATVGPDVAQKY 146
           E ++  +     +N    +              +  R GY +S S ++Y   G   A+  
Sbjct: 86  EAEITDSSASWDNNNDQPNVFNLGRVEAGRQYYVGARLGYAMSPSTMVYVKGGYSNARYN 145

Query: 147 ETGKAGE----ITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSK------------- 189
             G  G         A G   G GVE   + E+   +LEY+ + YSK             
Sbjct: 146 LQGTDGTTNLRQRLDADGYRVGAGVE-QKVGENAFVKLEYKYANYSKGEFDFNGDTPDSS 204

Query: 190 ---VEGFYNTISLGVGMKF 205
              ++   ++I+ GVG++F
Sbjct: 205 RFNLDTDRHSITAGVGVRF 223


>gi|148555915|ref|YP_001263497.1| hypothetical protein Swit_3008 [Sphingomonas wittichii RW1]
 gi|148501105|gb|ABQ69359.1| hypothetical protein Swit_3008 [Sphingomonas wittichii RW1]
          Length = 172

 Score = 60.0 bits (144), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 43/160 (26%), Positives = 66/160 (41%), Gaps = 15/160 (9%)

Query: 52  DFNGPYAGLSALYNGSFGEEA-----HHNAGGSIFAGYNVEDS-CIMYGVEGDVRYTVPV 105
           DF GPY G     +   G  A         G + FAGYN+        GVE ++      
Sbjct: 22  DFAGPYVGGGVTLDNVQGSGALEGVGFSGVGATAFAGYNLPVGASTFAGVEANIDLN-TA 80

Query: 106 LADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGV 165
            A  I +  G G  +  R GY+++DS  LYA  G    +    G +G    +      G 
Sbjct: 81  DAGGIEAKWGWG--VGARFGYKLNDSTALYARAGYARGKIEVLGSSGWGDGVRY----GA 134

Query: 166 GVEVGGLSESLVARLEYRASKYSKVEGFYNTISLGVGMKF 205
           G+E   +++S+  R E+  + Y   +   N  +LG+   F
Sbjct: 135 GLETR-VTDSVSLRAEFTQTNYES-DIINNQGTLGIVFGF 172


>gi|296446925|ref|ZP_06888861.1| porin [Methylosinus trichosporium OB3b]
 gi|296255600|gb|EFH02691.1| porin [Methylosinus trichosporium OB3b]
          Length = 429

 Score = 60.0 bits (144), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 36/181 (19%), Positives = 56/181 (30%), Gaps = 30/181 (16%)

Query: 38  VPTIATNRYVPIRHDFNGPYAGLSALYNGSFGEE---AHHNAGGSIFAGYNVE-DSCIMY 93
            PT+             G   G +   +G+F +          G +  GY+ +     + 
Sbjct: 218 PPTLPPFEGGGPSF---GVLVGTAVG-DGAFADPVPMQGAGFLGGLRLGYDFKLTPRFLV 273

Query: 94  GVEGDVRYTVPVLADNIHSLH------GIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYE 147
           G E D +Y   +   +           G  G+ R R GY V D   +Y T G        
Sbjct: 274 GFETDSQYRSDLGGGSNSHGSISGVRGGYLGTFRGRLGY-VIDRWTVYGTGGLAYGHILA 332

Query: 148 --------------TGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGF 193
                         T    +   +  G T G GV+   L+  L  R EY  ++       
Sbjct: 333 PRTFSGSNLINSIPTTGVSQSYQLVPGWTVGAGVQF-ALAPGLSLRAEYLYTQLQHSNPT 391

Query: 194 Y 194
           Y
Sbjct: 392 Y 392


>gi|170726262|ref|YP_001760288.1| OmpA domain-containing protein [Shewanella woodyi ATCC 51908]
 gi|169811609|gb|ACA86193.1| OmpA domain protein transmembrane region-containing protein
           [Shewanella woodyi ATCC 51908]
          Length = 184

 Score = 60.0 bits (144), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 38/178 (21%), Positives = 69/178 (38%), Gaps = 18/178 (10%)

Query: 40  TIATNRYVPIRHDFNGPYAGLSALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDV 99
            I  +  V   +D +G Y G S        E++ +  G   + GYN  D    +G+E ++
Sbjct: 13  AIFASSNVAAANDHSGFYVGGSLGQLKVKTEDSDNGLGFGAYGGYNFND---WFGLEANM 69

Query: 100 RYTVPVLADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAG-EITPIA 158
             +  +  +      G   +   +  Y+++D+  +Y  VG            G +     
Sbjct: 70  YLSGDLGGNGYDLGAGTF-AFTPKFTYQINDTFAVYGKVGIASMAVVYRPDRGIDEDFTG 128

Query: 159 IGGTAGVGVEVGGLSESLVARL-----------EYRASKYSKVEGFYNTISLGVGMKF 205
            G   GVGV    ++E+L  RL           EY  S+   V+   +  +LG+  +F
Sbjct: 129 FGWVYGVGVNAS-ITENLNIRLGYDIVKGDLDSEYSFSE-QNVDTDISNFALGMHYQF 184


>gi|319783372|ref|YP_004142848.1| outer membrane protein-like protein [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317169260|gb|ADV12798.1| outer membrane protein-like protein [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 400

 Score = 59.7 bits (143), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 29/172 (16%), Positives = 53/172 (30%), Gaps = 21/172 (12%)

Query: 43  TNRYVPIRHDFNGPYAGLSALYNGS----------FGEEAHHNAGGSIFAGYNVE-DSCI 91
                    +++G Y G+   +  S          F     +   G + AGY+       
Sbjct: 2   QPVEEAAGFNWSGAYVGIGGGFGASVHKFSVPGLDFNGLGGNGVFGELTAGYDYMVSERF 61

Query: 92  MYGVEGDVRYTV-----PVLADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKY 146
           + G   D   +       +   ++   +  G  + +R GY ++ + L Y   G       
Sbjct: 62  LLGGFIDANLSNIGPSLSIAGGDVDLTNSYGFDVGLRAGYLLNPNTLGYVLGGYTWQHFK 121

Query: 147 ETGKAGEI----TPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFY 194
             G         +    G   GVG+E   L  +   + EYR + Y       
Sbjct: 122 LDGSGAADGLEFSQNRSGYVLGVGMET-VLRGNWTLKTEYRYADYGDKSVLD 172



 Score = 52.0 bits (123), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 41/194 (21%), Positives = 64/194 (32%), Gaps = 35/194 (18%)

Query: 47  VPIRHDFNGPYAGLSALY----------NGSFGEEAHHNAGG-SIFA----GYNVEDSCI 91
               +D+ G YAG +              G       +  GG  +F     GY+ +    
Sbjct: 206 AAPTYDWTGFYAGGALGAGTMVHDLNLNLGLGASGELNGIGGEGVFGEASVGYDHDFGSW 265

Query: 92  MYGVEGDVRYTVPVLADN-----IHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKY 146
           + GV+ D RY+      +     I      G     R G +V++S L Y   G       
Sbjct: 266 VAGVQLDARYSGIQTKLDLGPVSIKGDADYGFDALARIGAKVNESTLAYVLGGYSWQHFD 325

Query: 147 ETGKA-GEITPIAIGGTAGVGVEVG----GLSESLVARLEYRASKYSKVEGFY------- 194
              +A G  +       +      G     +S ++   LEYR S+Y K +          
Sbjct: 326 LHAEAPGGGSADIYDWGSSGFSIGGGLETAVSSNMTVGLEYRYSQYQKEDFGSGGILEDT 385

Query: 195 ---NTISLGVGMKF 205
               T+ LG   KF
Sbjct: 386 PSFQTVRLGAKYKF 399


>gi|299134642|ref|ZP_07027834.1| conserved hypothetical protein [Afipia sp. 1NLS2]
 gi|298590452|gb|EFI50655.1| conserved hypothetical protein [Afipia sp. 1NLS2]
          Length = 486

 Score = 59.7 bits (143), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 40/192 (20%), Positives = 63/192 (32%), Gaps = 34/192 (17%)

Query: 47  VPIRHDFNGPYAGLSALYNGSFGEEAHHNAG---------------GSIFAGYNVE-DSC 90
           V    ++ G Y      Y     ++     G               G++  GY+ +    
Sbjct: 33  VAPVSNWTGFYVTGGFGYGLMSSDQHSTTGGAATSVDTRTGGRGYFGTVGLGYDYQLTPA 92

Query: 91  IMYGVEGDVRYTVPVLADNIHSLHGIGG--------SLRIRGGYEVSDSLLLYATVGPDV 142
            + GV GD ++          +  GI G        S   R GY V+ ++L Y   G   
Sbjct: 93  WVVGVFGDAQWGDIRGDLIDITTPGISGRLKNDAAYSAGARLGYLVAPNVLSYVNAGYSY 152

Query: 143 AQKYETGKAGE----ITPIAIGGTAGVGVE-----VGGLSESLVARLEYRASKYSKVEGF 193
            Q   +  +            G   G GVE      G  +     + EYR ++Y +    
Sbjct: 153 GQFKGSTFSDGVTAIDKSHRDGWFIGGGVENDLNFFGIKAPGWFMKTEYRVTEYDRKNSL 212

Query: 194 YNTISLGVGMKF 205
           YN  S G G+ F
Sbjct: 213 YNDGS-GNGIAF 223



 Score = 37.3 bits (85), Expect = 1.2,   Method: Composition-based stats.
 Identities = 31/186 (16%), Positives = 54/186 (29%), Gaps = 42/186 (22%)

Query: 49  IRHDFNGPY----------------AGLSALYNGSFGEEAHHNAGGSIFAGYNVE-DSCI 91
             +++ G Y                  L+   NG           G++  GY+ + +   
Sbjct: 260 AAYNWTGFYLAGGGGYGLMSSDQHTVDLATGANGLDTRAGGRGYFGTVGGGYDWQINPTW 319

Query: 92  MYGVEGDVRYTVPVLADNIHS------------LHGIGGSLRIRGGYEVSDSLLLYATV- 138
           + GV GD ++     +    +             +    +   R GY +S + L Y  V 
Sbjct: 320 VVGVFGDAQFGDIRGSLADATGGGLGAGVTGRLKNDTNYAAGARLGYLISPNALSYVNVG 379

Query: 139 -------GPDVAQKYETGKAGEITPIAIGGTAGVGVE-----VGGLSESLVARLEYRASK 186
                  G  +                 G   G GVE      G  S     + EYR ++
Sbjct: 380 YSHADFKGVALTNATGAAVGSTGKSHRDGWFLGGGVENSLNIFGISSPGWFMKTEYRVAE 439

Query: 187 YSKVEG 192
           Y +   
Sbjct: 440 YDRKTS 445


>gi|21111442|gb|AAM39773.1| membrane protein [Xanthomonas campestris pv. campestris str. ATCC
           33913]
 gi|66572140|gb|AAY47550.1| membrane protein [Xanthomonas campestris pv. campestris str. 8004]
          Length = 377

 Score = 59.3 bits (142), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 36/171 (21%), Positives = 60/171 (35%), Gaps = 29/171 (16%)

Query: 55  GPYAGLSALYNGSFG-EEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHS- 112
           G   G +A    + G  +    A   + AGY+ +    +YGV  +  YT   L D++ + 
Sbjct: 175 GFCGGAAAGRTPASGCSKDKGGAEYGVRAGYDWQVGDWVYGVVAE--YTRNDLRDSVSAF 232

Query: 113 -----------LHGIGGSLRIRGGYEV--SDSLLLYATVGPDVAQ--------KYETGKA 151
                            +LR R GY        L Y T G    +               
Sbjct: 233 STTPALYTFTRQLNRTAALRGRVGYAFGAQGDYLAYVTAGVARGEFDHSFASSNTANSFT 292

Query: 152 GEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFYNTISLGVG 202
           G     A G  AG+G++   LS+ +   +EY  ++    +     + +G G
Sbjct: 293 GSGGDSANGYQAGIGLQ-RRLSDHVSVGVEYLFTRLQDEDT---RVRVGPG 339


>gi|240142350|ref|YP_002966860.1| putative porin [Methylobacterium extorquens AM1]
 gi|240012294|gb|ACS43519.1| putative porin [Methylobacterium extorquens AM1]
          Length = 293

 Score = 59.3 bits (142), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 34/181 (18%), Positives = 50/181 (27%), Gaps = 54/181 (29%)

Query: 50  RHDFNGPYAGLSALYNGSFGEEAH-----------------------------HNAGGSI 80
              + G +AG +A Y     ++                                   G  
Sbjct: 40  VFTWTGFFAGFNAGYGFGTSDDRGPITAAVPGTYGVFSNPGPQVIAFAGQRSADGFVGGG 99

Query: 81  FAGYNVED---SCIMYGVEGDVRYTV------------------PVLADNIHSLHGIGGS 119
             GYN +    S ++ GVE D +Y                         N  +     G+
Sbjct: 100 QIGYNYQFTPGSGVVVGVEADAQYVDFGSDRNRFVATSPLAPGAVAFNPNTLTGLDYFGT 159

Query: 120 LRIRGGYEVSDSLLLYATVGPDVAQKYETGKAG---EITPIAIGGTAGVGVEVGGLSESL 176
           +R R GY   D  L+YAT G                       G T G GVE    ++S 
Sbjct: 160 VRGRLGYAF-DRTLVYATGGFAYGSGGGRDFGLPNFTRDEFQTGWTVGGGVEYALPTDSF 218

Query: 177 V 177
           +
Sbjct: 219 L 219


>gi|259415944|ref|ZP_05739864.1| putative outer membrane protein [Silicibacter sp. TrichCH4B]
 gi|259347383|gb|EEW59160.1| putative outer membrane protein [Silicibacter sp. TrichCH4B]
          Length = 198

 Score = 59.3 bits (142), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 36/165 (21%), Positives = 56/165 (33%), Gaps = 22/165 (13%)

Query: 52  DFNGPYAG-----LSALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVL 106
           D+ G Y G       A  +      +       +  GYN +    + G E  + Y     
Sbjct: 45  DWTGFYGGLQYGQGEADLSLGGASASEDFDAFGVHGGYNHDFGRYVLGGE--LMYNDI-- 100

Query: 107 ADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVG 166
               +   G   SLR R G ++    + Y T G   +         +I+    G T GVG
Sbjct: 101 -SGDNGGDGDLTSLRARAGMDL-GRFMPYVTAGV--SHLSLASGGADISE--NGFTYGVG 154

Query: 167 VEVGGLSESLVARLEYRASKYSK------VEGFYNTISLGVGMKF 205
            E   +SE     LEY  S +S        +   + + L    +F
Sbjct: 155 AEYL-VSERFSVGLEYTKSDFSDAGGVAGADLDTDKVQLRASYRF 198


>gi|163853385|ref|YP_001641428.1| porin [Methylobacterium extorquens PA1]
 gi|218532243|ref|YP_002423059.1| porin [Methylobacterium chloromethanicum CM4]
 gi|240140802|ref|YP_002965282.1| putative outer-membrane immunogenic protein precursor
           [Methylobacterium extorquens AM1]
 gi|254563312|ref|YP_003070407.1| outer-membrane immunogenic protein [Methylobacterium extorquens
           DM4]
 gi|163664990|gb|ABY32357.1| porin [Methylobacterium extorquens PA1]
 gi|218524546|gb|ACK85131.1| porin [Methylobacterium chloromethanicum CM4]
 gi|240010779|gb|ACS42005.1| putative outer-membrane immunogenic protein precursor
           [Methylobacterium extorquens AM1]
 gi|254270590|emb|CAX26593.1| putative outer-membrane immunogenic protein precursor
           [Methylobacterium extorquens DM4]
          Length = 288

 Score = 59.3 bits (142), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 35/177 (19%), Positives = 52/177 (29%), Gaps = 52/177 (29%)

Query: 52  DFNGPYAGLSALYNGSFGEE-----------------------------AHHNAGGSIFA 82
            + G YAG +A Y     ++                             ++    G    
Sbjct: 40  TWTGFYAGFNAGYGFGTQDDRVPTVIGVGPASLLVPPGTTAVVAFSNRESNEGFVGGGQI 99

Query: 83  GYNVED---SCIMYGVEGDVRYTV-----------------PVLADNIHSLHGIGGSLRI 122
           GYN +    S ++ GVE D +Y                    V      S     G++R 
Sbjct: 100 GYNYQFTPGSGVVIGVEADAQYADFGRDRNRFLSTSPLAAQQVFNPGGLSGLDFFGTVRG 159

Query: 123 RGGYEVSDSLLLYATVGPDVAQKYET--GKAGEITPIAIGGTAGVGVEVGGLSESLV 177
           R GY   D  L+Y T G           G          G  AG G+E    ++S +
Sbjct: 160 RLGYAF-DRTLVYGTGGFAYGSGGGREFGTGVSSNDFQTGWAAGGGIEYALPTDSFL 215


>gi|157377581|ref|YP_001476181.1| outer membrane protein, putative [Shewanella sediminis HAW-EB3]
 gi|157319955|gb|ABV39053.1| outer membrane protein, putative [Shewanella sediminis HAW-EB3]
          Length = 182

 Score = 58.9 bits (141), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 45/161 (27%), Positives = 70/161 (43%), Gaps = 16/161 (9%)

Query: 55  GPYAGLSALYNG---SFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIH 111
           G Y G    +     + G       G  I+ GYN  DS   +G+E  +  T  ++ +   
Sbjct: 26  GFYLGGQVNHTSVEDNIGTLDESAIGLGIYGGYNFNDS---FGIETSIFLTDSLVDEMDL 82

Query: 112 SLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGG 171
            +  +  S  IR  +  +DS+  Y   G  V + Y      +      G   G GV+V  
Sbjct: 83  RIAAVTISPVIR--HAFTDSVTGYLKAGLVVNKTYSNDDGVDEDYRGTGWLFGAGVDVT- 139

Query: 172 LSESLVARLEYRAS----KYSKVEGFYNTISL---GVGMKF 205
           L+ESL  R+ Y  S    +YS++E +Y  ISL   GVG+ +
Sbjct: 140 LTESLALRVSYEMSETEPEYSELENYYADISLKQFGVGLHY 180


>gi|296446779|ref|ZP_06888717.1| putative outer-membrane immunogenic protein precursor [Methylosinus
           trichosporium OB3b]
 gi|296255654|gb|EFH02743.1| putative outer-membrane immunogenic protein precursor [Methylosinus
           trichosporium OB3b]
          Length = 312

 Score = 58.9 bits (141), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 33/201 (16%), Positives = 52/201 (25%), Gaps = 50/201 (24%)

Query: 40  TIATNRYVPIRHDFNGPYAGLSAL----YNGSFGEEAHHNAGGSIFAGYN-VEDSCIMYG 94
           T     Y    +D+     G+       Y             G    GYN V  +  ++G
Sbjct: 59  TSEARTYGYSVYDWASGALGMPFGFSSPYVSGLASLQQDGFIGGAQIGYNHVGPAGFLFG 118

Query: 95  VEGDVRYTVPVLAD----------------------NIHSLHGIGGSLRIRGGYEVSDSL 132
           VE D   +    +                       ++ +  G  GS+R R GY  + +L
Sbjct: 119 VETDFDGSTLRGSGASNGFASQVDAHGLLHLQAGRADVRAGLGWLGSVRGRFGYFFNPAL 178

Query: 133 LLYATVGPDVAQKYET----------------------GKAGEITPIAIGGTAGVGVEVG 170
           L Y T G      + +                         G      +G  AG G E  
Sbjct: 179 LFYGTGGLAYGGTFGSISTLGFHWHPQDPIGHPDNPVLPAWGSFDAARVGWIAGGGFEWS 238

Query: 171 GLSESLVARLEYRASKYSKVE 191
             +     + E          
Sbjct: 239 -FAPQWSVKTEALYYDLGSRR 258


>gi|92117608|ref|YP_577337.1| putative outer-membrane protein precursor [Nitrobacter hamburgensis
           X14]
 gi|91800502|gb|ABE62877.1| putative outer-membrane protein precursor [Nitrobacter hamburgensis
           X14]
          Length = 251

 Score = 58.9 bits (141), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 34/182 (18%), Positives = 56/182 (30%), Gaps = 29/182 (15%)

Query: 39  PTIATNRYVPIRHDFNGPYAGLSALY--NGSFGEEAHHNAGG---------SIFAGYNVE 87
           P       +   +D++G Y G +  +  + S  +     AGG             GY  +
Sbjct: 30  PYTKAPPMIAAIYDWSGFYVGANGGWGSSRSCWDLTAPVAGGCHDATGGTIGGQIGYRWQ 89

Query: 88  DSCIMYGVEGDVRYTVPVLAD--------NIHSLHGIGGSLRIRGGYEVSDSLLLYATVG 139
            + +++G+E    +      +          HS     G    + GY   D+ LLY   G
Sbjct: 90  SNNLVFGLEAQGNWADLNGRNVSIDFSRFTNHSRLDAFGLFTGQIGYSW-DATLLYVKGG 148

Query: 140 PDVAQKYETG--------KAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVE 191
             V                A  +     GG  GVG+E  G + +     EY         
Sbjct: 149 AAVTSNRYRSVDNVSGLQAADSVNDTRWGGVVGVGLEY-GFAPNWSLGFEYDHIFMGNSS 207

Query: 192 GF 193
             
Sbjct: 208 HT 209


>gi|27380285|ref|NP_771814.1| hypothetical protein blr5174 [Bradyrhizobium japonicum USDA 110]
 gi|27353449|dbj|BAC50439.1| blr5174 [Bradyrhizobium japonicum USDA 110]
          Length = 256

 Score = 58.9 bits (141), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 34/195 (17%), Positives = 54/195 (27%), Gaps = 35/195 (17%)

Query: 38  VPTIATNRYVPIRHDFNGPYAGLSALYNGSFGEEAHHNAGGSIFA--------------G 83
             T A    V   +D+ G Y G +  +  S G        G++                G
Sbjct: 29  PYTKAPPPIVAPIYDWTGFYIGANGGWGQSRGCVDFVTLAGTVAGGCASRSGGLVGGQIG 88

Query: 84  YNVEDSCIMYGVEGDVRYTVPVLAD--------NIHSLHGIGGSLRIRGGYEVSDSLLLY 135
           Y  + +  + G+E    +               +        G    + G+  + S LLY
Sbjct: 89  YRWQTNQFVLGLEAQGDWADIKNTRVSLIDPLLSTTGKTDGIGLFTAQLGWAWNAS-LLY 147

Query: 136 ATVGPDVAQKYET-------GKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYS 188
              G  V                   +    GG  GVG E  G + +    +EY      
Sbjct: 148 VKGGAAVTHNRLDVFNNLTGVGLDSASHTRWGGALGVGWEY-GFAPNWSVGVEYDHLWMG 206

Query: 189 KVEGFYNTISLGVGM 203
                 N    G G+
Sbjct: 207 N----DNRTFAGAGV 217


>gi|296445166|ref|ZP_06887126.1| hypothetical protein MettrDRAFT_0842 [Methylosinus trichosporium
           OB3b]
 gi|296257340|gb|EFH04407.1| hypothetical protein MettrDRAFT_0842 [Methylosinus trichosporium
           OB3b]
          Length = 467

 Score = 58.5 bits (140), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 37/196 (18%), Positives = 62/196 (31%), Gaps = 18/196 (9%)

Query: 25  DPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNG-----------SFGEEAH 73
           D            +  +           + G + G +                +F     
Sbjct: 58  DVTGSIPMAASAPLVGVDAAHAALSAPLWTGFHVGATIGSGWAITPLAIPNAATFSGVGM 117

Query: 74  HNAGGSIFAGYNVEDSCIMYGVEGDVRY---TVPVLADNIHSLHGIGGSLRIRGGYEVSD 130
               G + AG++     ++ G+  D      +  +   ++        +LR R G   S+
Sbjct: 118 SGVAGGVTAGFDYRFGSVVAGIAADGNLKSTSAYLSGVDVTFREAASWALRGRLGGLASE 177

Query: 131 SLLLYATVGPDVAQKYETGKAGEITPIAI-GGTAGVGVEVGGLSESLVARLEYRASKYS- 188
             L+YAT G   A    T   G+   +   G   GVGVE   L+  L  R EY  S +  
Sbjct: 178 DTLVYATAGVTQAITKLTYPTGDSDDVRYTGAIFGVGVETR-LAAGLYGRAEYLQSLFGQ 236

Query: 189 -KVEGFYNTISLGVGM 203
              +G      L  G+
Sbjct: 237 RNFDGGRYNARLESGV 252



 Score = 53.5 bits (127), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 42/182 (23%), Positives = 59/182 (32%), Gaps = 24/182 (13%)

Query: 33  GGRGVVPTIATNRYVPIRHDFNGPYAGLSALY----------NGSFGEEAHHNAGGSIFA 82
           G    +P             + G + G    Y          + +          G    
Sbjct: 265 GDWSGLPVGLAAASSTQPESWTGAHIGAHGGYAFGSTKLTSGSWTGDGVGGAGGVGGALL 324

Query: 83  GYNVEDSCIMYGVEGD---------VRYTVPVLADNIHSLHGIGGSLRIRGGYEVSDSLL 133
           GY+ +    + GVE D            T+   + N    +    S+R R G  +  S L
Sbjct: 325 GYDYQWGRSVLGVEIDGSGGGARSTASVTLRRFSANAQIAYDWDYSIRARAG-RLFGSTL 383

Query: 134 LYATVGPDVAQKYETG---KAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKV 190
           L+ TVG        T       E + +  G   G GVE   L+  L ARLEY  S Y K 
Sbjct: 384 LFGTVGWTQTYGRLTTAGLGGIETSHLFSGVQLGGGVET-MLTTHLGARLEYLHSFYDKY 442

Query: 191 EG 192
            G
Sbjct: 443 AG 444


>gi|323139417|ref|ZP_08074467.1| putative outer-membrane immunogenic protein precursor
           [Methylocystis sp. ATCC 49242]
 gi|322395349|gb|EFX97900.1| putative outer-membrane immunogenic protein precursor
           [Methylocystis sp. ATCC 49242]
          Length = 304

 Score = 58.5 bits (140), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 32/177 (18%), Positives = 49/177 (27%), Gaps = 43/177 (24%)

Query: 58  AGLSALYNGSFGEEAHHNAGGSIFAGYNVE-DSCIMYGVEGDVRYTVPVLADNIHS---- 112
           A  +    G  G   +    G    GY  +    I+ GVE D++     +     +    
Sbjct: 79  AAAALGATGVLGASGNGGFIGGGQIGYTWQFHRNIVAGVEADIQGIASGVGGGSLTTTVP 138

Query: 113 -------------------LHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETG---- 149
                                   G++R R GY  S +LLLY T G              
Sbjct: 139 VMLPAAPFPSANTVMSASRSLDYLGTVRGRIGYLFSPTLLLYGTGGLAYGGVSLNVTGLQ 198

Query: 150 --------------KAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEG 192
                              +   +G +AG G+E      +  A+ EY       V  
Sbjct: 199 SFTLGTPGFITTGFGGSSFSDTRVGWSAGGGLE-WMFWPNWSAKAEYLYYDLGSVRT 254


>gi|310815861|ref|YP_003963825.1| putative outer-membrane immunogenic protein precursor
           [Ketogulonicigenium vulgare Y25]
 gi|308754596|gb|ADO42525.1| putative outer-membrane immunogenic protein precursor
           [Ketogulonicigenium vulgare Y25]
          Length = 220

 Score = 58.5 bits (140), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 46/208 (22%), Positives = 79/208 (37%), Gaps = 41/208 (19%)

Query: 36  GVVPTIATNRYVP------IRHDFNGPYAG-------LSALYNGSFGEEAH--------- 73
           G +P  A  ++VP          F+G Y G        S   NG  G++A          
Sbjct: 16  GTLPMAAAAQHVPRIVVMTPSVGFSGGYVGFGLNRDSGSIDMNGETGDQAQQLLGTRSLG 75

Query: 74  --HNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPV-------LADNIHSLHGIGGSLRIRG 124
                G ++ AGY+      ++GV G++  +          ++D      G   +  +R 
Sbjct: 76  EPSGLGLNLRAGYDWRTGNTIFGVWGEIAQSWAKDDVVIPAVSDTWSVGFGTSTAAMLRL 135

Query: 125 GYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRA 184
           GY++   +++Y+  G           +G  +  + G + GVG+E    S  +   LE+  
Sbjct: 136 GYDMGG-VMVYSNAGYRWTDVELETFSGAYSDRSGGISYGVGIETE-FSHHMSGYLEF-H 192

Query: 185 SKYSKV-------EGFYNTISLGVGMKF 205
               KV       +   NT +LGV  KF
Sbjct: 193 RNTGKVDIEGLTADLSLNTFTLGVNYKF 220


>gi|188584143|ref|YP_001927588.1| porin [Methylobacterium populi BJ001]
 gi|179347641|gb|ACB83053.1| porin [Methylobacterium populi BJ001]
          Length = 302

 Score = 58.5 bits (140), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 37/207 (17%), Positives = 56/207 (27%), Gaps = 68/207 (32%)

Query: 34  GRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSFGEE---------------------- 71
            R   P + T         + G YAG +A Y     +                       
Sbjct: 24  PRRAAPPVFTPV---PVFTWTGFYAGFNAGYGFGVEDSLAPTQVVTIDRRVVGGPVGAIA 80

Query: 72  --------AHHNAGGSIFAGYNVED---SCIMYGVEGDVRYTVPVLADNIHS-------- 112
                         G    GYN +    S ++ G+E D +Y         +         
Sbjct: 81  GFAFDNGGRSDGFVGGGQIGYNYQFTPGSGVVIGIEADAQYADLGGRFGRNGLCGTGGIA 140

Query: 113 ----------------------LHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGK 150
                                      G++R R GY   D +L Y T G      +  G+
Sbjct: 141 CAVTPGAFVQPGVTLINPTGLQGLDFFGTVRGRIGYAF-DRVLFYGTGGFAYG-SFGGGR 198

Query: 151 AGEITPIAIGGTAGVGVEVGGLSESLV 177
           A +      G  AG GVE    ++S +
Sbjct: 199 AVDTDDFKTGYAAGGGVEYALPTDSFL 225


>gi|114809812|gb|ABI81409.1| bacteria phage-associated hemin-binding membrane protein Pap31
           [Bartonella vinsonii subsp. berkhoffii]
          Length = 182

 Score = 58.1 bits (139), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 35/186 (18%), Positives = 55/186 (29%), Gaps = 62/186 (33%)

Query: 11  SSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSAL------- 63
           S +AL S  +AQAAD V         V P ++     P    + G Y G           
Sbjct: 2   SVIALISTSAAQAADIVVPHEVVSPRVTPIVS-----PSTFSWTGFYLGGQVGNFSSKVE 56

Query: 64  ------YNGSFGEEAH---HNAGGSIFAGYNVEDS-CIMYGVEGDVRYTVPVLADNIHS- 112
                  N  FG++         G I+AG N+E    ++ GVE D  +        + + 
Sbjct: 57  ITDSGKKNEFFGKDQTPKPSGFMGGIYAGSNIELGNNLILGVETDAVWADRGDTKTLSTK 116

Query: 113 ---------------------------------------LHGIGGSLRIRGGYEVSDSLL 133
                                                       G+ R R G+  ++ ++
Sbjct: 117 ELEGDDLEDFNNTFTDAGIKLGDDEKFVAGDTGSYSFTYKEKWSGATRARIGFAAANCIM 176

Query: 134 LYATVG 139
            Y   G
Sbjct: 177 PYVAGG 182


>gi|89054446|ref|YP_509897.1| outer membrane protein, putative [Jannaschia sp. CCS1]
 gi|88863995|gb|ABD54872.1| outer membrane protein putative [Jannaschia sp. CCS1]
          Length = 207

 Score = 58.1 bits (139), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 33/153 (21%), Positives = 56/153 (36%), Gaps = 16/153 (10%)

Query: 51  HDFNGPYAGLSALYNGSFGEEA-------HHNAGGSIFAGYNVEDSCIMYGVEGDVRYTV 103
           +D++G Y G+   Y     + A          A   +F GY  +   ++ G E D+    
Sbjct: 44  YDWSGFYGGVQLEYGDVTADTAAGVEAATGDGALYGLFGGYRYDLGNVVVGAELDLNLAD 103

Query: 104 PVLADNIHSLHGIGGSLR---IRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIG 160
             L D   +  G   S+       GY+ +   LLY TVG   A    T   G       G
Sbjct: 104 IDLDDPTGATIGSLDSVHRLGAEVGYD-AGPALLYGTVGVAQA----TATLGAADLQDNG 158

Query: 161 GTAGVGVEVGGLSESLVARLEYRASKYSKVEGF 193
              G G++   +++ +    E    ++   +G 
Sbjct: 159 YFYGAGIDYL-VTDQITVGAEVLQHEFDDFDGT 190


>gi|296282661|ref|ZP_06860659.1| outer membrane protein-like [Citromicrobium bathyomarinum JL354]
          Length = 222

 Score = 57.7 bits (138), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 36/201 (17%), Positives = 70/201 (34%), Gaps = 42/201 (20%)

Query: 46  YVPIRHDFNGPYAGLSALYN---------GSFGEEAHHNAGGSIFA---GYNVEDSCIMY 93
            V     F+G     +  Y+             +    +A G I+    GY+V+   I+ 
Sbjct: 23  QVDPDSPFSGFRIQGTTGYDQITAGSSVDDDGNDNNDQSAEGVIYGATIGYDVDLGNIVI 82

Query: 94  GVEGDVRYT--VPVLADNIHSLHGIGGS-------LRIRGGYEVSDSLLLYATVGPDVAQ 144
           G E ++  +       +      G G         +  R G + + +++ YA  G   A+
Sbjct: 83  GPEAELTGSTADTDYENGDFEGFGFGNVSAGRDVYVGARIGVKANPNMMFYAKGGYTNAK 142

Query: 145 KYETGKAG----EITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYS------------ 188
                  G    +      G   G G+E     +++   +EYR S YS            
Sbjct: 143 LNVRSNDGTTEFDTDYDLDGYRVGGGLEY-AFGKNMFTNIEYRYSNYSDANVDFNGTLPD 201

Query: 189 ----KVEGFYNTISLGVGMKF 205
                V+   + +++G+G++F
Sbjct: 202 TDQFDVDTDRHQVTVGLGVRF 222


>gi|217971469|ref|YP_002356220.1| OmpA domain-containing protein transmembrane region-containing
           protein [Shewanella baltica OS223]
 gi|217496604|gb|ACK44797.1| OmpA domain protein transmembrane region-containing protein
           [Shewanella baltica OS223]
          Length = 187

 Score = 57.7 bits (138), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 30/152 (19%), Positives = 58/152 (38%), Gaps = 9/152 (5%)

Query: 51  HDFNGPYAGLSALYNGSFGEEAHHNAGG---SIFAGYNVEDSCIMYGVEGDVRYTVPVLA 107
           +D  G Y G +       G++   +  G     + GYN       +G+E ++  T  +  
Sbjct: 24  NDTTGFYVGGALNKVTLDGDDVTDSRSGTGLGAYGGYNF---NEWFGLEANLFATGDLGN 80

Query: 108 DNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGV 167
            ++ +  G   S   +    ++D   +YA  G             ++     G T G GV
Sbjct: 81  KDVDASAG-ALSFTPKFTAHINDIFSVYAKAGVATMLVKFESNGQKLDFTGFGWTYGAGV 139

Query: 168 EVGGLSESLVARLEYRASKYSKVEGFYNTISL 199
               ++E L  R+ Y  +   K++   N++ L
Sbjct: 140 NA-AVTEHLNIRVSYDVTT-GKLDADNNSLGL 169


>gi|27379810|ref|NP_771339.1| outer-membrane protein [Bradyrhizobium japonicum USDA 110]
 gi|27352963|dbj|BAC49964.1| blr4699 [Bradyrhizobium japonicum USDA 110]
          Length = 259

 Score = 57.7 bits (138), Expect = 9e-07,   Method: Composition-based stats.
 Identities = 39/205 (19%), Positives = 60/205 (29%), Gaps = 38/205 (18%)

Query: 15  LASFCSAQAADPVRRAHHGGRGVVP-TIATNRYVPIRHDFNGPYAG--LSALYNGSFGEE 71
           L     A A      A        P T A    V   +D++G Y G            + 
Sbjct: 5   LIGAIGAVALSLSAPASAADLAARPYTKAPPPMVAAIYDWSGFYIGINGGGGSAHKCWDF 64

Query: 72  AHHNAGGSIFAG--------------YNVEDSCIMYGVEGDVRYTVPVLADNIH------ 111
                G  I  G              Y  + +  ++G+EG   +      DN+       
Sbjct: 65  VTPVTGVLIGEGCHNATGGTVGGQVGYRWQSANWVFGLEGQGNWA-DFSGDNVSTTFIGT 123

Query: 112 -----SLHGIGGSLRIRGGYEVSDSLLLYATVGPDVA----QKYETGKA---GEITPIAI 159
                S     G    + GY   +++L Y   G  V     + Y+               
Sbjct: 124 GLRDRSKINAFGLFTGQVGYAW-NNVLFYVKGGGAVVSDRYRGYDVITGLEFDRANETRW 182

Query: 160 GGTAGVGVEVGGLSESLVARLEYRA 184
           GGT G G+E  G + +    +EY  
Sbjct: 183 GGTVGAGLEF-GFAPNWTVGVEYDH 206


>gi|66934583|gb|AAY58302.1| hemin-binding protein [Bartonella vinsonii subsp. berkhoffii]
          Length = 182

 Score = 57.7 bits (138), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 34/186 (18%), Positives = 54/186 (29%), Gaps = 62/186 (33%)

Query: 11  SSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSAL------- 63
           S +AL S  +AQAAD V         V P ++     P    + G Y G           
Sbjct: 2   SVIALISTSTAQAADIVVPHEVVSPRVTPIVS-----PSTFSWTGFYLGGQVGNFSSKVE 56

Query: 64  ------YNGSFGEEAH---HNAGGSIFAGYNVEDS-CIMYGVEGDVRYTVPVLADNIHS- 112
                  N  FG++         G I+ G N+E    ++ GVE D  +        + + 
Sbjct: 57  ITDSGKKNEFFGKDQTPKPSGFMGGIYTGSNIELGNNLILGVETDAVWADRGDTKTLSTK 116

Query: 113 ---------------------------------------LHGIGGSLRIRGGYEVSDSLL 133
                                                       G+ R R G+  ++ ++
Sbjct: 117 ELEGDDLEDFNNTFTDAGIKLGGDEKFVVGDTGSYSFTYKEKWSGATRARIGFAAANCIM 176

Query: 134 LYATVG 139
            Y   G
Sbjct: 177 PYVAGG 182


>gi|209886818|ref|YP_002290675.1| carbohydrate-selective porin OprB [Oligotropha carboxidovorans OM5]
 gi|209875014|gb|ACI94810.1| carbohydrate-selective porin OprB [Oligotropha carboxidovorans OM5]
          Length = 660

 Score = 57.7 bits (138), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 44/229 (19%), Positives = 72/229 (31%), Gaps = 75/229 (32%)

Query: 49  IRHDFNGPYAG-------------------LSALYNGSFGEEAHHNAGGS-------IFA 82
             +D+NG YAG                    +   +GSF    + +  G        +  
Sbjct: 5   ALYDWNGWYAGVHVGAIRGLSNWSAIPPGAGAPGLSGSFDLPFNFDFIGGTGNYVAGLQG 64

Query: 83  GYNVEDSC-IMYGVEGDVRY--TVPVLADNIHSLHGIG----------------GSLRIR 123
           GYN       M G E D+ +  +   +  ++     +                 GS R R
Sbjct: 65  GYNHVFPSRAMLGFESDISFPNSDVQVPFSVRGSQTVSSPLTGQVTYGEAVIHYGSARAR 124

Query: 124 GGYEVSDSLLLYATVGPD-----VAQKYETGKAGEITPI----------AIGGTAGVGVE 168
            GY   D  LLY T G       V +    G +                 +G  AG G+E
Sbjct: 125 AGYAF-DHFLLYGTGGLAWSYDQVTRTQVDGVSVGGAATPGTVDTRLLWRLGWAAGAGIE 183

Query: 169 VGGLSESLVARLEYRASKYS-------------KVEGFYNTISLGVGMK 204
           +  L+ +  A+ EY A+ +                +    +I LG+  +
Sbjct: 184 IP-LAANWTAKAEYLATGFGHKGMRFTGASEAFNSDLTMQSIRLGLNYR 231


>gi|170741349|ref|YP_001770004.1| porin [Methylobacterium sp. 4-46]
 gi|168195623|gb|ACA17570.1| porin [Methylobacterium sp. 4-46]
          Length = 255

 Score = 57.4 bits (137), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 50/223 (22%), Positives = 76/223 (34%), Gaps = 60/223 (26%)

Query: 8   VGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLS--ALYN 65
                LA+ +   AQAAD  RRA       VPT            + G Y G +   L +
Sbjct: 5   AASGLLAVLAATGAQAADLPRRAAPPVVAPVPT----------FTWTGAYFGANVAGLVD 54

Query: 66  GSF---------GEEAHHNAGGSIFA---GYNVE---DSCIMYGVEGDVRYTVPV----- 105
           G+F         G  +  +AGG +     GYN +   ++  + G+EGD+ Y+        
Sbjct: 55  GNFLLRSLAPLPGAASRPSAGGFVAGGTVGYNYQFAPENGFVAGLEGDIGYSGVRHTGII 114

Query: 106 ------LADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEI----- 154
                  A+          ++R R GY     +L+YAT G    +    G A        
Sbjct: 115 AAAGLGTANGRLQTDTYHATIRGRIGYAW-GPVLVYATGGWAFTEFNAEGVAATQRFGLG 173

Query: 155 ---------------TPIAIGGTAGVGVEVGGLSESLVARLEY 182
                          +    G T G GV    ++     + EY
Sbjct: 174 AGRPFVGAFAGPVRRSIPLDGYTVGGGV-AYKITPDWSLKAEY 215


>gi|212633150|ref|YP_002309675.1| OmpA-like transmembrane region [Shewanella piezotolerans WP3]
 gi|212554634|gb|ACJ27088.1| OmpA-like transmembrane region [Shewanella piezotolerans WP3]
          Length = 184

 Score = 57.4 bits (137), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 32/161 (19%), Positives = 60/161 (37%), Gaps = 14/161 (8%)

Query: 55  GPYAGLSAL-YNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSL 113
           G YAG     ++      +        + GYN       +G+EG +  T   + +   + 
Sbjct: 28  GAYAGGQIGAFSADLEGGSESGQSYGAYGGYNF---NEWFGLEGALYLTNDFIDEGEATA 84

Query: 114 HGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLS 173
           + +  S   +  + ++D+  LY  VG   A         +I    +G T G GV    ++
Sbjct: 85  NALSFSAAPKFTWVINDTFSLYGKVGIASAAIVIESALPDIDYTGVGLTYGAGVNA-AIT 143

Query: 174 ESLVARLEYRAS---------KYSKVEGFYNTISLGVGMKF 205
           E L  RL Y                 +  ++ ++LG+  +F
Sbjct: 144 EKLTVRLGYDFMSATLESDDFDLPDADVEFSNVTLGMHYQF 184


>gi|46251212|gb|AAS84577.1| truncated Omp25b [Brucella canis]
          Length = 120

 Score = 57.4 bits (137), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 16/72 (22%), Positives = 25/72 (34%), Gaps = 10/72 (13%)

Query: 42  ATNRYVPIRHDFNGPYAGLSALYNGSFGEEAHHNAG---------GSIFAGYNVEDS-CI 91
                V     +NG Y G    Y       +  +           G ++AGYN +     
Sbjct: 31  PAPVVVAPTFTWNGAYLGGQIGYGWGRSTLSDEDTSIRVKPDGFLGGLYAGYNFDMGNNF 90

Query: 92  MYGVEGDVRYTV 103
           + GV+GD+ Y  
Sbjct: 91  VLGVDGDITYND 102


>gi|310816897|ref|YP_003964861.1| outer membrane protein [Ketogulonicigenium vulgare Y25]
 gi|308755632|gb|ADO43561.1| outer membrane protein [Ketogulonicigenium vulgare Y25]
          Length = 237

 Score = 57.4 bits (137), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 40/186 (21%), Positives = 56/186 (30%), Gaps = 28/186 (15%)

Query: 40  TIATNRYVPIR--HDFNGPYAGLSALY------------------NGSFGEEAHHNAGGS 79
                  V     + F G Y GL   +                   G  G+         
Sbjct: 33  EAPVVIPVAPVLTNRFAGGYVGLGYGHVVSSDDRVGMVDQTTNLLTGVLGDLDLEGGAAI 92

Query: 80  IFAGYNVEDSCIMYG----VEGDVRYTVPVLADNIHSLHGIGGSLRIRGGYEVSDSLLLY 135
           + AGY   +  ++YG    V G              S      +LR   GY V+ SLLLY
Sbjct: 93  LQAGYRWANGNLVYGPTLRVRGGGIDAELTGTSTGSSTVNWEAALRGNLGYTVTPSLLLY 152

Query: 136 ATVGPDVAQKYETGKAG---EITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEG 192
             VG   A+             T    G  AG+G E   L+++     EY  + Y     
Sbjct: 153 GFVGYTYAEVEYDVAGAINVAETVNFGGVNAGLGAEY-ALNDNWSLFGEYEYAGYEGKNL 211

Query: 193 FYNTIS 198
               I+
Sbjct: 212 VDPAIN 217


>gi|254693693|ref|ZP_05155521.1| porin [Brucella abortus bv. 3 str. Tulya]
          Length = 81

 Score = 57.4 bits (137), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 17/74 (22%), Positives = 27/74 (36%), Gaps = 16/74 (21%)

Query: 147 ETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVE--------------- 191
                   +    G  AG GV+    +++++ RLEYR + Y   +               
Sbjct: 9   IESIGVSQSKTMTGWAAGAGVDYAA-TDNVIVRLEYRYTDYGHKDFSVVDGDLSVEARNK 67

Query: 192 GFYNTISLGVGMKF 205
              + I LGV  KF
Sbjct: 68  FKTHDIRLGVAYKF 81


>gi|161347191|gb|ABX65299.1| 31 kDa bacteriophage-associated heme binding protein [Bartonella
           vinsonii subsp. berkhoffii]
          Length = 182

 Score = 57.4 bits (137), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 34/186 (18%), Positives = 54/186 (29%), Gaps = 62/186 (33%)

Query: 11  SSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSAL------- 63
           S +AL S  +AQAAD V         V P ++     P    + G Y G           
Sbjct: 2   SVIALISTSTAQAADIVVPHEVVSPRVTPIVS-----PSTFSWTGFYLGGQVGNFSSKVK 56

Query: 64  ------YNGSFGEEAH---HNAGGSIFAGYNVEDS-CIMYGVEGDVRYTVPVLADNIHS- 112
                  N  FG++         G I+ G N+E    ++ GVE D  +        + + 
Sbjct: 57  ITDSGKKNEFFGKDQTPKPSGFMGGIYTGSNIELGNNLILGVETDAVWADRGDTKTLSTK 116

Query: 113 ---------------------------------------LHGIGGSLRIRGGYEVSDSLL 133
                                                       G+ R R G+  ++ ++
Sbjct: 117 ELEGDDLEDFNNTFTDAGIKLGDDEKFVAGDTGSYSFTYKEKWSGATRARIGFAAANCIM 176

Query: 134 LYATVG 139
            Y   G
Sbjct: 177 PYFAGG 182


>gi|126735153|ref|ZP_01750899.1| hypothetical protein RCCS2_14789 [Roseobacter sp. CCS2]
 gi|126715708|gb|EBA12573.1| hypothetical protein RCCS2_14789 [Roseobacter sp. CCS2]
          Length = 230

 Score = 57.4 bits (137), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 36/190 (18%), Positives = 60/190 (31%), Gaps = 32/190 (16%)

Query: 37  VVPTIATNRYVPIRHDFNGPYAGLSA--------LYNGSFGEEAHHNAGG--------SI 80
           V+    T        D++G Y G +                ++   + G           
Sbjct: 15  VIAASPTALVADQPFDWSGTYGGFNLDLADPILSGIQDCCADDPGDDPGNLDPSAVALGG 74

Query: 81  FAGYNVEDSCIMYGVEGDVRYTVPVLAD-------NIHSLHGIG--GSLRIRGGYEVSDS 131
             G+N+  +  +YGVEG   Y   V +           S   I   GSLR R G    D+
Sbjct: 75  HFGFNIVQNQWVYGVEGAFFYGGLVDSQLSQSEPIANESDIDINGIGSLRGRIGRIAGDA 134

Query: 132 LLL------YATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRAS 185
           ++       YA     +         G       G   G G+++  L+E+  AR+ Y   
Sbjct: 135 MVFGILGASYADATYTMRDPDAANSKGSADLSGWGYMIGAGIDLP-LTENTSARVSYERH 193

Query: 186 KYSKVEGFYN 195
            +       +
Sbjct: 194 IFDTRVATDD 203


>gi|220922032|ref|YP_002497333.1| porin [Methylobacterium nodulans ORS 2060]
 gi|219946638|gb|ACL57030.1| porin [Methylobacterium nodulans ORS 2060]
          Length = 294

 Score = 57.4 bits (137), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 33/183 (18%), Positives = 49/183 (26%), Gaps = 57/183 (31%)

Query: 51  HDFNGPYAGLSALYN-----------------------------GSFGEEAHHNAGGSIF 81
             + G YAG +  Y                                 G        G   
Sbjct: 40  FTWTGFYAGFNVGYGFDASDNRGPTVIGVGPATGLVPPGATAVIAFTGNRNLEGFVGGGQ 99

Query: 82  AGYNVED---SCIMYGVEGDVRYTV-----------------------PVLADNIHSLHG 115
            GYN +    S ++ G+E D ++                          V   N  +   
Sbjct: 100 VGYNYQFTPGSGVVVGIEADAQFADFGRDRNRFIVATNPAALGGVAAQQVFNPNGLAGLD 159

Query: 116 IGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKA-GEITPIAIGGTAGVGVEVGGLSE 174
             G++R R GY   D +L Y T G                     G TAG G+E    ++
Sbjct: 160 WFGTVRGRLGYAF-DRVLFYGTGGFAYGGGGGRDFGLPNRDDFQTGWTAGGGIEYALPTD 218

Query: 175 SLV 177
           S +
Sbjct: 219 SFL 221


>gi|51320045|gb|AAU00343.1| Pap31 [Bartonella phage CO-04-1]
          Length = 186

 Score = 57.4 bits (137), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 34/184 (18%), Positives = 54/184 (29%), Gaps = 62/184 (33%)

Query: 13  LALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSAL--------- 63
           +AL S  +AQAAD V         V P ++     P    + G Y G             
Sbjct: 2   IALISTSAAQAADIVIPHEVVSPRVTPIVS-----PSTFSWTGFYLGGQVGNFSSKVEIT 56

Query: 64  ----YNGSFGEEAH---HNAGGSIFAGYNVEDS-CIMYGVEGDVRYTVPVLADNIHS--- 112
                N  FG++         G I+AG N+E    ++ GVE D  +        + +   
Sbjct: 57  DSGKKNEFFGKDQTPKPSGFMGGIYAGSNIELGNNLILGVETDAVWADRGDTKTLSTKEL 116

Query: 113 -------------------------------------LHGIGGSLRIRGGYEVSDSLLLY 135
                                                     G+ R R G+  ++ ++ Y
Sbjct: 117 EGDDLEDFNNTFTDAGIKLGDDEKFVAGDTGSYSFTYKEKWSGATRARIGFAAANCIMPY 176

Query: 136 ATVG 139
              G
Sbjct: 177 FAGG 180


>gi|92116695|ref|YP_576424.1| hypothetical protein Nham_1117 [Nitrobacter hamburgensis X14]
 gi|91799589|gb|ABE61964.1| conserved hypothetical protein [Nitrobacter hamburgensis X14]
          Length = 274

 Score = 57.4 bits (137), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 59/286 (20%), Positives = 96/286 (33%), Gaps = 93/286 (32%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M++L LA    ++   +   A AAD        G        ++ +  +R  + G Y G 
Sbjct: 1   MRRLLLA----AVMCGTAHGAYAADMPDLPILRGSL------SDGFGTVRTVWQGYYVGG 50

Query: 61  SALYNGS--------------------------------FGEEAHHNAGGSIFAGYNVED 88
            A    S                                 G+ +    G   F GYN + 
Sbjct: 51  QAGVGESDMNFTGATRNVAARLLSGTAIENSGQVSSWPLGGKASVRGDGWGGFVGYNSQW 110

Query: 89  SCIMYGVEGD---------------------VRYTVPVLADNIHSLHGIG-GSLRIRGGY 126
             ++ GVE +                     + YT  V   +  ++     G+LR R GY
Sbjct: 111 DDVVIGVEANYMHGKFGGSRSDSMSRFFTDSLGYTDGVTYQSTATMSISDMGTLRARAGY 170

Query: 127 EVSDSLLLYATVGPDVAQKY--------------------------ETGKAGEITPIAIG 160
            V  + L Y   G  + Q                             +G  G+ + +  G
Sbjct: 171 -VVGAFLPYMFGGVALGQADIVRSAHIFGTQVNPAAAPGFTNVPFNVSGTDGKYSHLIYG 229

Query: 161 GTAGVGVEVGGLSESLVARLEYRASKY-SKVEGFYNTISLGVGMKF 205
            +AGVG++V  L   L AR+E+   ++ S ++   NT+  GVG KF
Sbjct: 230 YSAGVGLDVN-LIGGLFARVEWEYIRFTSSIDTNVNTVRAGVGYKF 274


>gi|260574728|ref|ZP_05842731.1| putative outer membrane protein [Rhodobacter sp. SW2]
 gi|259023145|gb|EEW26438.1| putative outer membrane protein [Rhodobacter sp. SW2]
          Length = 213

 Score = 57.0 bits (136), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 45/204 (22%), Positives = 71/204 (34%), Gaps = 28/204 (13%)

Query: 19  CSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSAL--------YNGSFGE 70
            +AQA  PV  A       V T+          D++G YAGL            N     
Sbjct: 21  TAAQAGGPVVVAEEPQLAYVQTVQQ-----PTADWSGFYAGLGYGVSSGDIDFTNPDVAN 75

Query: 71  EAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGSLRIRGGYEVSD 130
           +       S F GY V+   ++YG E                       L+ + GY  ++
Sbjct: 76  KLDDGHAASAFVGYLVQRDALVYGAELAYTGLDKNTVTGFADEIDQTIDLKGKVGYA-AN 134

Query: 131 SLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKY--- 187
             L Y  +G  VA        G   P  +    G+G++   +++ +   LEY A      
Sbjct: 135 RALFYGVLGYSVA--SFDTAGGSWDPAGVNY--GLGMDYL-VTDRMTVGLEYLARDLTGD 189

Query: 188 ------SKVEGFYNTISLGVGMKF 205
                  + +   +T+SL VG +F
Sbjct: 190 NPDGLGQQAKIDLDTVSLRVGFQF 213


>gi|296447763|ref|ZP_06889678.1| Carbohydrate-selective porin OprB [Methylosinus trichosporium OB3b]
 gi|296254740|gb|EFH01852.1| Carbohydrate-selective porin OprB [Methylosinus trichosporium OB3b]
          Length = 723

 Score = 57.0 bits (136), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 43/228 (18%), Positives = 66/228 (28%), Gaps = 76/228 (33%)

Query: 48  PIRHDFNGPYAGLSAL-----YNGSFGEEAHH-------------NAGGSIFA---GYNV 86
           P    + G + G+ A       +G   E A               +  G  F    GY+ 
Sbjct: 26  PPIFSWAGLHLGVDAGVGLPVASGGRVEAAAGLSPTAHALIAPGRDRAGVSFGARIGYDW 85

Query: 87  EDSCIMYGVEGDVRY-TVPVLADNIHSLHGIGG----------------SLRIRGGYEVS 129
           +    +YG+E ++ +  +    D + +  G  G                S+R R GY   
Sbjct: 86  QKGPWVYGLESELNFLDLRRGDDGVFAGFGALGAATRRLTTQENGQYVASVRGRLGYAFG 145

Query: 130 DSL----------------LLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLS 173
            +L                LL  T G           A       +    G GVE   L 
Sbjct: 146 RTLVYAAAGVAAGGWRGASLLTVTPGVAGP-----FFAPVSDSSRMKFVIGAGVE-QALF 199

Query: 174 ESLVARLEYRA----------SKYSKV------EGFYNTISLGVGMKF 205
           +   ARLEY              YS            + + LG+  +F
Sbjct: 200 DRWSARLEYTYVNQQLQIRHFDDYSSSAFDVRQRSEAHLLRLGLDYRF 247


>gi|255262225|ref|ZP_05341567.1| outer membrane protein [Thalassiobium sp. R2A62]
 gi|255104560|gb|EET47234.1| outer membrane protein [Thalassiobium sp. R2A62]
          Length = 194

 Score = 57.0 bits (136), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 32/187 (17%), Positives = 62/187 (33%), Gaps = 21/187 (11%)

Query: 27  VRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL-----SALYNGSFGEEAHHNAGGSI- 80
            +  +      VP +A+        D+ G YAGL     +             +  GSI 
Sbjct: 2   AQAGNLEEVIDVPPVASIVTPAEVSDWTGFYAGLQFDAVAGKTERDSLSSFKADLEGSIV 61

Query: 81  --FAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHG------IGGSLRIRGGYEVSDSL 132
             F GY       + G E D+               G      I  +LR  G +      
Sbjct: 62  SGFVGYRWAVGRYIVGAELDIALNGDGRMIYTEGGLGPERPYDINSALRFGGEFGGELGG 121

Query: 133 LL-YATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVE 191
            L Y  +G  +       +  +      G   G+G +   +++S++  +E     + +++
Sbjct: 122 GLAYMGLGFTMLDVKLDSEFDDQ-----GYYVGIGYDY-FVTDSIMVGVEINYHDFGELD 175

Query: 192 GFYNTIS 198
           G  + ++
Sbjct: 176 GASDRVT 182


>gi|188580104|ref|YP_001923549.1| porin [Methylobacterium populi BJ001]
 gi|179343602|gb|ACB79014.1| porin [Methylobacterium populi BJ001]
          Length = 254

 Score = 57.0 bits (136), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 35/171 (20%), Positives = 54/171 (31%), Gaps = 34/171 (19%)

Query: 51  HDFNGPYAGLSALYNGSFGEEAHHNAGGSIFA--------------GYNVE---DSCIMY 93
             + G Y G +A Y    G   + +A                    GYN +    S  + 
Sbjct: 50  FTWTGFYVGANAGYGFRGGSSRYSDATYGTVTESGGKGGFVGGGQIGYNYQITPGSGWVL 109

Query: 94  GVEGDVRYTVPVLAD----------NIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVA 143
           G E D++ T                 +       G+LR R GY   D  L+Y T G    
Sbjct: 110 GAEADLQATGFGRRGDGTVGATPYYGVAPSLDWYGTLRGRVGYAF-DRWLVYGTGGFAYG 168

Query: 144 QKYETGKAGE-----ITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSK 189
               +  A            +G  AG G+E   L++ +  ++E       K
Sbjct: 169 GGSRSPYASAYPYTLPDTTRLGYAAGAGIEY-ALTDHVSVKVEGLYVDLGK 218


>gi|87199324|ref|YP_496581.1| hypothetical protein Saro_1303 [Novosphingobium aromaticivorans DSM
           12444]
 gi|87135005|gb|ABD25747.1| hypothetical protein Saro_1303 [Novosphingobium aromaticivorans DSM
           12444]
          Length = 185

 Score = 56.6 bits (135), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 41/143 (28%), Positives = 67/143 (46%), Gaps = 12/143 (8%)

Query: 54  NGPYAGLSALYN--GSFGEEAH---HNAGGSIFAGYNVEDSCIMY-GVEGDVRYTVPVLA 107
            G Y G+   ++   S G++     +  GG++FAGYN + +  +Y GVE +       + 
Sbjct: 24  AGAYVGVGVTHDNLASSGDDEGVGINGVGGTVFAGYNFDLTSSVYAGVEANFDLATAKIG 83

Query: 108 DN---IHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAG 164
           D+   + + +  GGS     G+  SDS  LY  VG    +   T    E +  A G   G
Sbjct: 84  DDTDSLEADYAFGGS--ALLGFRPSDSTALYGRVGYQRGRGTLTVDGTEYSDSADGLRLG 141

Query: 165 VGVEVGGLSESLVARLEYRASKY 187
           +G++   L+E L  R+EY  + Y
Sbjct: 142 LGLQAD-LTEKLGVRVEYNHTHY 163


>gi|146338464|ref|YP_001203512.1| hypothetical protein BRADO1381 [Bradyrhizobium sp. ORS278]
 gi|146191270|emb|CAL75275.1| hypothetical protein BRADO1381 [Bradyrhizobium sp. ORS278]
          Length = 549

 Score = 56.6 bits (135), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 22/135 (16%), Positives = 44/135 (32%), Gaps = 13/135 (9%)

Query: 70  EEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGG------SLRIR 123
                +  G +  G + +    + G++         ++  +     +        +  +R
Sbjct: 376 SSNGSDVVGGLQLGCDYQLDRFVVGIQAMADLGNINVSGPLAPGLTLNTRTSNLYTATVR 435

Query: 124 GGYEVSDSLLLYATVGPDVAQ---KYETGKAGEITPIAI---GGTAGVGVEVGGLSESLV 177
            GY V+  +L Y   G    +          G+   +A    G T G GVE    + +  
Sbjct: 436 AGYLVTPEILAYVRGGAAWTRTTVGVANTATGQSASVAFNRSGWTVGAGVE-WMFARNWS 494

Query: 178 ARLEYRASKYSKVEG 192
           A  EY  + +    G
Sbjct: 495 AFAEYDYADFGTATG 509


>gi|113968601|ref|YP_732394.1| OmpA domain-containing protein [Shewanella sp. MR-4]
 gi|114049252|ref|YP_739802.1| OmpA domain-containing protein [Shewanella sp. MR-7]
 gi|113883285|gb|ABI37337.1| OmpA domain protein transmembrane region-containing protein
           [Shewanella sp. MR-4]
 gi|113890694|gb|ABI44745.1| OmpA domain protein transmembrane region-containing protein
           [Shewanella sp. MR-7]
          Length = 185

 Score = 56.6 bits (135), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 32/177 (18%), Positives = 58/177 (32%), Gaps = 17/177 (9%)

Query: 41  IATNRYVPIRHDFNGPYAGLSAL-YNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDV 99
                      D  G Y G +         +++    G  ++ GYN       +G+E + 
Sbjct: 14  ALVAGQASAATDNTGFYVGGALNRVTVDAFDDSETGTGFGVYGGYNF---NEWFGLEANF 70

Query: 100 RYTVPVLADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAI 159
             T  +   ++    G   +   +   +++D    YA VG         G   +      
Sbjct: 71  FATADLGDSDVDISAG-ALTFTPKFTLQINDMFSAYAKVGVASMAVNVDGLGFDEDFTGF 129

Query: 160 GGTAGVGVEVGGLSESLVARLEY-----------RASKYSKVEGFYNTISLGVGMKF 205
           G T GVGV    ++E L  RL Y                  ++     +++GV  +F
Sbjct: 130 GWTYGVGVNA-AVTEHLNVRLSYDITTGDLDADHSYLNMKDIDTDMKQLAIGVHYQF 185


>gi|126734487|ref|ZP_01750234.1| outer membrane protein, putative [Roseobacter sp. CCS2]
 gi|126717353|gb|EBA14217.1| outer membrane protein, putative [Roseobacter sp. CCS2]
          Length = 175

 Score = 56.6 bits (135), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 38/163 (23%), Positives = 60/163 (36%), Gaps = 17/163 (10%)

Query: 50  RHDFNGPYAGLSALYNG----SFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPV 105
             D+ GPYAG     +        E         IFAGYNV++  I+YG E D   T   
Sbjct: 21  AQDWTGPYAGFQIGGSDIDVDGAAELTGDGPSYGIFAGYNVQNGAIVYGGEIDYDVTEYE 80

Query: 106 LADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGV 165
           +A            L+ R G E+    L Y T G   A    +   G+      G   GV
Sbjct: 81  IAGGAQ-EVDSTTRLKGRIGTELGGG-LAYGTAGVVWA---TSPGLGDD----NGYLVGV 131

Query: 166 GVEVGGLSESLVARLE---YRASKYSKVEGFYNTISLGVGMKF 205
           G ++  +++++    E   +    Y+  +      +    + F
Sbjct: 132 GYDLP-VTQNMTVGAEILQHEFEDYNDTDLDVGVTTFKARVSF 173


>gi|218532663|ref|YP_002423479.1| porin [Methylobacterium chloromethanicum CM4]
 gi|218524966|gb|ACK85551.1| porin [Methylobacterium chloromethanicum CM4]
          Length = 243

 Score = 56.2 bits (134), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 35/172 (20%), Positives = 52/172 (30%), Gaps = 34/172 (19%)

Query: 50  RHDFNGPYAGLSALYNGSFGEEAHHNAGGSI--------------FAGYNVE---DSCIM 92
              + G Y G +A Y       ++ +A                    GYN +    S  +
Sbjct: 38  VFTWTGFYVGANAGYGFRGSSSSYTDATYGTVIESGGKGGFVGGGQIGYNYQLTSGSGWV 97

Query: 93  YGVEGDV-RYTVPVLAD---------NIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDV 142
            G E D    T     D          +       G++R R GY   D  L+Y T G   
Sbjct: 98  LGAEADFQGMTFGRRGDGTIGTTPYHGVAPSLDWFGTVRGRLGYAF-DRWLVYGTGGFAY 156

Query: 143 AQKYETGKAGE-----ITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSK 189
                +  A            +G   G GVE   L+E +  ++E       K
Sbjct: 157 GGGSASPYATSYPYTLPDTTRLGYAVGGGVEY-ALTEHISVKVEGLYVDLGK 207


>gi|85715495|ref|ZP_01046476.1| putative outer-membrane protein precursor [Nitrobacter sp. Nb-311A]
 gi|85697690|gb|EAQ35566.1| putative outer-membrane protein precursor [Nitrobacter sp. Nb-311A]
          Length = 257

 Score = 56.2 bits (134), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 36/188 (19%), Positives = 55/188 (29%), Gaps = 34/188 (18%)

Query: 38  VPTIATNRYVPIRHDFNGPYAGLSALYNGSF--------------GEEAHHNAGG--SIF 81
             T A    +   +D++G Y G +  +  S                E  H   GG     
Sbjct: 30  TYTKAPPPMMAAIYDWSGFYIGANGGWGSSRNCWNFTTPAGAFVANEGCHDATGGTAGGQ 89

Query: 82  AGYNVEDSCIMYGVEGDVRYTVPVLADN--------IHSLHGIGGSLRIRGGYEVSDSLL 133
            GY  + +  ++G+E    +                  S  G  G    + GY   D+ L
Sbjct: 90  IGYRWQSTNWVFGLEAQGNWADLSGRRASLAFPAFTNDSHLGAFGLFTGQIGYAW-DATL 148

Query: 134 LYATVGPDVAQKYETGKA--------GEITPIAIGGTAGVGVEVGGLSESLVARLEYRAS 185
           LY   G  V        A         ++     G T GVG+E  G + +     EY   
Sbjct: 149 LYVKGGAAVTSNRYRSLATLTGAQVTNDVNNSRWGATVGVGLEY-GFAPNWSLAFEYDHI 207

Query: 186 KYSKVEGF 193
                   
Sbjct: 208 FMGNSRTT 215


>gi|170747711|ref|YP_001753971.1| porin [Methylobacterium radiotolerans JCM 2831]
 gi|170654233|gb|ACB23288.1| porin [Methylobacterium radiotolerans JCM 2831]
          Length = 288

 Score = 56.2 bits (134), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 32/183 (17%), Positives = 48/183 (26%), Gaps = 59/183 (32%)

Query: 53  FNGPYAGLSALYNGS----------------------------FGEEAHHNAGGSIFAGY 84
           + G Y G++A Y                                    +    G    GY
Sbjct: 41  WTGFYVGVNAGYGFDANSRNTTSYALPGGSLINSPGTAGVVSVSNRNNNDGFSGGAQIGY 100

Query: 85  NVED---SCIMYGVEGDVRY------------------------TVPVLADNIHSLHGIG 117
           N +    S ++ G E D +Y                          P       +     
Sbjct: 101 NYQFTPGSGVVIGFEADAQYVDFARRANATQNYSFLGFPGVAFSNPPAFVATSGNGLDYF 160

Query: 118 GSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEI---TPIAIGGTAGVGVEVGGLSE 174
           G++R R GY   D  L+Y T G       +               G  AG GVE    ++
Sbjct: 161 GTVRGRLGYAF-DRTLVYGTGGFAYGSGQDDQNFAGNRFRDSFRTGWAAGGGVEYALPTD 219

Query: 175 SLV 177
           S +
Sbjct: 220 SFL 222


>gi|66934588|gb|AAY58303.1| hemin-binding protein [Bartonella vinsonii subsp. berkhoffii]
          Length = 182

 Score = 55.8 bits (133), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 32/186 (17%), Positives = 54/186 (29%), Gaps = 62/186 (33%)

Query: 11  SSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSAL------- 63
           S +AL S  +AQAAD V         V P ++     P    + G Y G           
Sbjct: 2   SVIALISTSAAQAADIVVPHEVVSPRVTPIVS-----PSTFSWTGFYLGGQVGNFSSKVE 56

Query: 64  ------YNGSFGEEAH---HNAGGSIFAGYNVEDS-CIMYGVEGDVRYTVPVLADNIHS- 112
                  N  FG++         G ++ G N++    ++ GVE D  +        + + 
Sbjct: 57  ITDSGKKNEFFGKDQTPKPSGFMGGVYTGSNIDLGNNLILGVETDAVWADRGDTKTLSTK 116

Query: 113 ---------------------------------------LHGIGGSLRIRGGYEVSDSLL 133
                                                       G+ R R G+  ++ ++
Sbjct: 117 ELEGDDLEDFNNTFTDAGIKLGDDEKFVAGDTGSYSFTYKEKWSGATRARIGFAAANCIM 176

Query: 134 LYATVG 139
            Y   G
Sbjct: 177 PYVAGG 182


>gi|170747433|ref|YP_001753693.1| porin [Methylobacterium radiotolerans JCM 2831]
 gi|170653955|gb|ACB23010.1| porin [Methylobacterium radiotolerans JCM 2831]
          Length = 288

 Score = 55.8 bits (133), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 27/138 (19%), Positives = 41/138 (29%), Gaps = 31/138 (22%)

Query: 70  EEAHHNAGGSIFAGYNVED---SCIMYGVEGDVRYTVPVLADNIHSLHGIGGS------- 119
              +    G    GYN +    S ++ G E D +Y       N    +  GG+       
Sbjct: 86  RSNNDGFSGGAQIGYNYQFTPGSGVVIGFEADAQYVDFARRANATQNYAFGGAPGIAFAA 145

Query: 120 -----------------LRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEI---TPIAI 159
                            +R R GY   D  L+Y T G       +               
Sbjct: 146 PRAFVATSGNGLDYFGTVRGRLGYAF-DRTLVYGTGGFAYGSGQDDQNFAGNRFRDSFRT 204

Query: 160 GGTAGVGVEVGGLSESLV 177
           G  AG G+E    ++S +
Sbjct: 205 GWAAGGGIEYALPTDSFL 222


>gi|70931144|gb|AAZ15807.1| heme-binding protein [Bartonella vinsonii subsp. berkhoffii]
          Length = 182

 Score = 55.8 bits (133), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 35/186 (18%), Positives = 54/186 (29%), Gaps = 62/186 (33%)

Query: 11  SSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSAL------- 63
           S +AL S  +AQAAD V         V P ++     P    + G Y G           
Sbjct: 2   SVIALISTSTAQAADIVVPHEVVSPRVTPIVS-----PSTFSWTGFYLGGQVGNFSSKVE 56

Query: 64  ------YNGSFGEEAH---HNAGGSIFAGYNVEDS-CIMYGVEGDVRYTVPVLADNIHS- 112
                  N  FG++         G I+ G N+E    +M GVE D  +        + + 
Sbjct: 57  IADSGKKNEFFGKDQTPKPSGFMGGIYTGSNIELGNNLMLGVETDAVWADRGDTKTLSTK 116

Query: 113 ---------------------------------------LHGIGGSLRIRGGYEVSDSLL 133
                                                       G+ R R G+  ++ ++
Sbjct: 117 ELEGDDLEDFNNTFTDAGIKLGGDEKFVVGDTGSYSFTYKEKWSGATRARTGFAAANCIM 176

Query: 134 LYATVG 139
            Y   G
Sbjct: 177 PYVAGG 182


>gi|24375951|ref|NP_719994.1| outer membrane protein, putative [Shewanella oneidensis MR-1]
 gi|24350939|gb|AAN57438.1|AE015879_8 outer membrane protein, putative [Shewanella oneidensis MR-1]
          Length = 188

 Score = 55.8 bits (133), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 30/157 (19%), Positives = 57/157 (36%), Gaps = 7/157 (4%)

Query: 43  TNRYVPIRHDFNGPYAGLSAL-YNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRY 101
                    D  G Y G +         ++A    G  ++ GYN       +G+E ++  
Sbjct: 16  VAGQALAATDTTGFYVGGALNRVTVDVLDDAETGTGFGVYGGYNF---NEWFGLEANLFA 72

Query: 102 TVPVLADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGG 161
           T  +   ++    G   +   +   +++D    YA VG         G   +      G 
Sbjct: 73  TGDLGDKDVDISAG-ALTFTPKFTLQINDMFSAYAKVGVASMAMNVDGDGFDEDFTGFGW 131

Query: 162 TAGVGVEVGGLSESLVARLEYRASKYSKVEGFYNTIS 198
           T GVGV    ++E L  RL Y  +    ++  ++ ++
Sbjct: 132 TYGVGVNA-AVTERLNVRLSYDVTS-GDLDADHHYVN 166


>gi|21106560|gb|AAM35363.1| membrane protein [Xanthomonas axonopodis pv. citri str. 306]
          Length = 474

 Score = 55.8 bits (133), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 33/173 (19%), Positives = 59/173 (34%), Gaps = 33/173 (19%)

Query: 55  GPYAGLSALYNGSFGEEAHHNAGGSIFA---GYNVEDSCIMYGVEGDVRYTVPVLADNIH 111
           G   G +A    +       + GG+ +    GY+ +    +YGV  +  YT   + D++ 
Sbjct: 272 GFCGGAAAG--RTPASGCSKDKGGAEYGARLGYDWQAGNWVYGVVAE--YTRNDVRDSVS 327

Query: 112 S------------LHGIGGSLRIRGGYEV--SDSLLLYATVGPDVAQ--------KYETG 149
           +                  +LR R GY        L Y T G    +             
Sbjct: 328 AFSTTPAFYTFTRQLNRTAALRGRIGYAFGTQGDYLAYITAGVARGEFDHSFASSNTANS 387

Query: 150 KAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFYNTISLGVG 202
                   A G  AG+G++   LS+ +   +EY  ++    +     + +G G
Sbjct: 388 FTSSGGDSADGYQAGIGLQ-RRLSDKVSVGVEYLFTRLQDDDT---RVRVGPG 436


>gi|12620578|gb|AAG60854.1|AF322012_159 ID352 [Bradyrhizobium japonicum]
          Length = 620

 Score = 55.8 bits (133), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 38/227 (16%), Positives = 75/227 (33%), Gaps = 55/227 (24%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+   L +G +++A+A+  ++ A        + GR  +P        P   +++G Y G 
Sbjct: 57  MRSRVLFLGAATMAIATTGTSMA--------NLGREALP--------PSVWNWSGGYIGG 100

Query: 61  SALYNGSFGEEAHH-------------NAGGSIFAGYNVEDSCIMYGVEGD--------- 98
                       +              +       GYN +++  +YG+E D         
Sbjct: 101 HVGGGYGRTSFTNPFGPPIYGDVVDIPSFVAGGQIGYNWQNNSWVYGLELDASAAVASGS 160

Query: 99  ---VRYTVPVLADNIHSLHGIGGSLRIRGGYEVS--DSLLLYATVGPD----VAQKYETG 149
              +  +  +++ N ++   +  +   R GY        L Y   G              
Sbjct: 161 NTCLAASDLIVSANCNAAPNLFATGTGRIGYAFGSLGQTLAYLKAGAAWQNNRGDIVNNF 220

Query: 150 KAGE--ITPIA-----IGGTAGVGVEVGGLSESLVARLEYRASKYSK 189
           + G+            +GG  G+GVE   L+ S    +EY    +  
Sbjct: 221 EGGDLPQEKTHFDYGQVGGVIGLGVE-QALTPSWSVNVEYDYLHFGG 266


>gi|170745396|ref|YP_001766853.1| putative outer membrane protein [Methylobacterium radiotolerans JCM
           2831]
 gi|170658997|gb|ACB28051.1| putative outer membrane protein [Methylobacterium radiotolerans JCM
           2831]
          Length = 577

 Score = 55.4 bits (132), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 42/222 (18%), Positives = 61/222 (27%), Gaps = 63/222 (28%)

Query: 39  PTIATNRYVPIRHDFNGPYAGLSALYNGSFGEEAHH------------------------ 74
           P    N  VP    + G YAGL   Y GS                               
Sbjct: 25  PIARLNYPVPPIFSWTGAYAGLFTGY-GSLDSNTKFICTAPGRQAGAPECPILPSRRASD 83

Query: 75  -NAGGSIFAGYNVEDSC-IMYGVEGDVRYTVPVLADNIHSLHG-IGGSL----------- 120
            +  G    GYN +    ++ G   D ++T              + GS+           
Sbjct: 84  ASFIGGGEVGYNWQTPSGLVAGAAADYQFTRLWGYGRQEGDFKTVDGSVFFDSVAHSGQR 143

Query: 121 -------RIRGGYEVSDSLLLYATVGPDVAQKYETG---------------KAGEITPIA 158
                  R + G+ V D   +Y T G  V                        G    + 
Sbjct: 144 LDDLATFRGKIGFSV-DQTFIYVTGGLAVGHVRIDNNLNLSIKPDAAPAAAFDGRGGAVR 202

Query: 159 IGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFYNTISLG 200
           +G  AG+G+E    SE L A++E             +  S G
Sbjct: 203 LGYVAGMGIE-HAFSERLSAKVEGLYYNLGSRAVVPDQTSGG 243


>gi|46251216|gb|AAS84579.1| truncated Omp25b [Brucella pinnipedialis]
          Length = 102

 Score = 55.4 bits (132), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 16/72 (22%), Positives = 25/72 (34%), Gaps = 10/72 (13%)

Query: 42  ATNRYVPIRHDFNGPYAGLSALYNGSFGEEAHHNAG---------GSIFAGYNVEDS-CI 91
                V     +NG Y G    Y       +  +           G ++AGYN +     
Sbjct: 31  PAPVVVAPTFTWNGAYLGGQIGYGWGRSTLSDEDTSIRVKPDGFLGGLYAGYNFDMGNNF 90

Query: 92  MYGVEGDVRYTV 103
           + GV+GD+ Y  
Sbjct: 91  VLGVDGDITYND 102


>gi|149184388|ref|ZP_01862706.1| outer membrane protein-like protein [Erythrobacter sp. SD-21]
 gi|148831708|gb|EDL50141.1| outer membrane protein-like protein [Erythrobacter sp. SD-21]
          Length = 200

 Score = 55.4 bits (132), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 32/165 (19%), Positives = 61/165 (36%), Gaps = 30/165 (18%)

Query: 70  EEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNI---------HSLHGIGGSL 120
           +++       + AGY+ +   ++ G+E +   +      ++         +   G    L
Sbjct: 37  DQSIDGLAYGVGAGYDFDAGGVVLGLEAEYVGSTAETEYDMGDFEDIGVGNVETGRDLYL 96

Query: 121 RIRGGYEVSDSLLLYATVGPD-VAQKYETGKAGEITPIAI---GGTAGVGVEVGGLSESL 176
             R G + +D LL+YA  G       +          + +   G   G G+E   LS + 
Sbjct: 97  GARVGVKANDDLLVYAKGGYTNATYNFRNNDGTNEYEVDLDTDGFRVGGGLEY-ALSGNT 155

Query: 177 VARLEYRASKYS----------------KVEGFYNTISLGVGMKF 205
            A++EYR S YS                 ++   + +  G GM+F
Sbjct: 156 FAKVEYRYSNYSDAELDFEGDAPDVAVPDIDLDRHQVMAGFGMRF 200


>gi|100913602|gb|ABF69692.1| Pap31 hemin-binding protein [Bartonella henselae]
          Length = 181

 Score = 55.4 bits (132), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 33/189 (17%), Positives = 52/189 (27%), Gaps = 69/189 (36%)

Query: 11  SSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSFGE 70
           S +AL S  +AQAAD +         V   +A          + G Y G       S  E
Sbjct: 2   SVIALISASAAQAADVI---------VPHEVAPTVISAPAFSWTGFYIGGQVGNFSSKVE 52

Query: 71  EAH----------------HNAGGSIFAGYNVEDS-CIMYGVEGDVRYTV---------- 103
                                  G I+AG N++    ++ GVE D  +            
Sbjct: 53  ITDPNKKDKLFSKDDTPKPSGFMGGIYAGSNMDLGNNMILGVETDAVWADREDAKTSSAE 112

Query: 104 ---------------------------------PVLADNIHSLHGIGGSLRIRGGYEVSD 130
                                                D++       G+ R+R G+  +D
Sbjct: 113 AIGQDELETFRDSLKKANAAFAQGKTSDNVAAVDKHTDSLALKEKWSGATRVRIGFTAAD 172

Query: 131 SLLLYATVG 139
            ++ Y   G
Sbjct: 173 RIMPYVAGG 181


>gi|146341078|ref|YP_001206126.1| putative outer-membrane protein [Bradyrhizobium sp. ORS278]
 gi|146193884|emb|CAL77901.1| putative outer-membrane protein [Bradyrhizobium sp. ORS278]
          Length = 259

 Score = 55.4 bits (132), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 41/226 (18%), Positives = 67/226 (29%), Gaps = 44/226 (19%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAG- 59
           M+ LF A        A+  +  AAD         +    T A    +   +D+ G Y G 
Sbjct: 2   MKTLFGAAAGLGAMAAATST-FAADLP------VKKGPYTKAPPAVMATVYDWGGFYVGF 54

Query: 60  -LSALYNGSFGEEAHH------------------NAGGSIFAGYNVEDSCIMYGVEGDVR 100
                 +        +                   A      GY  + +  ++GVE    
Sbjct: 55  NAGGGSSRDCWNLVSNAGVAVNPAANREGCSGGGGAAVGGQIGYRYQMANWVFGVEAQGD 114

Query: 101 YTVPVLADNIHSLHGIGGSLR--------IRGGYEVSDSLLLYATVGPD-VAQKYETGKA 151
           +      +    L  +    R         + GY   D++L+Y   G   V  +Y+T   
Sbjct: 115 WANFKGTNRNLILPNVSDRSRTNGFGLFTGQVGYAF-DNILVYFKGGAAVVGDRYDTFTT 173

Query: 152 GEI------TPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVE 191
           G             GGT G G+E  G + +    +EY         
Sbjct: 174 GTNVMLDRANTTRWGGTVGAGLEY-GFAPNWSVGIEYDHIFLGNKN 218


>gi|212633149|ref|YP_002309674.1| outer membrane protein [Shewanella piezotolerans WP3]
 gi|212554633|gb|ACJ27087.1| Outer membrane protein, putative [Shewanella piezotolerans WP3]
          Length = 184

 Score = 55.4 bits (132), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 30/173 (17%), Positives = 63/173 (36%), Gaps = 14/173 (8%)

Query: 43  TNRYVPIRHDFNGPYAGLSAL-YNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRY 101
            + Y     D  G Y G     ++     ++        + GYN       +G+EG +  
Sbjct: 16  ASAYASAETDRVGAYVGGQIGAFSADVEGDSESGQSYGAYGGYNF---NEWFGLEGTIYL 72

Query: 102 TVPVLADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGG 161
           T   + +   S++    S+  +    ++D+  LY  +G             ++     G 
Sbjct: 73  TNDFVDNEYASVNAASFSVAPKFTLVLNDTFSLYGKIGLASVAVVTDTFIRDVDYQGFGL 132

Query: 162 TAGVGVEVGGLSESLVARLEYRAS-------KYS--KVEGFYNTISLGVGMKF 205
           T G GV    +++ L  RL Y  +        +    ++   + ++LG+  +F
Sbjct: 133 TVGAGVNA-AVTDKLNIRLGYDFTSAELDSDDFGAQDIDMDLSNVTLGMHYQF 184


>gi|294141706|ref|YP_003557684.1| OmpA family protein [Shewanella violacea DSS12]
 gi|293328175|dbj|BAJ02906.1| OmpA family protein [Shewanella violacea DSS12]
          Length = 335

 Score = 55.4 bits (132), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 33/179 (18%), Positives = 62/179 (34%), Gaps = 24/179 (13%)

Query: 46  YVPIRHDFNGPYAGLSALYNGSFG-------EEAHHNAGGSIFAGYNVEDSCIMYGVEGD 98
                 D +  Y G    +            +   +++    FAGY    +  +     D
Sbjct: 11  EASKVQDDSFFYLGAKGGWINYQNACEAQAVDCDANDSAWGGFAGYQFHRNWAVETGYND 70

Query: 99  VRYTVPV------LADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAG 152
                 V      L + I ++ G   SL+      ++++L L+   G        +G   
Sbjct: 71  FGQAGAVYPESGLLNEYIGTMKGWEFSLKGNL--PLTENLDLFGKAGTLRWDGENSGPFS 128

Query: 153 EITPIAIGGT--AGVGVEVGGLSESLVARLEYRASKYSKVE----GFYNTISLGVGMKF 205
             +    G +   G+G+E   L+ S VAR+EY+       +       +  SLG+  +F
Sbjct: 129 YDSD--DGWSPMVGIGLEY-KLTPSWVARVEYQYFDSVGSDKLGGSNMHFTSLGLSYRF 184


>gi|170745394|ref|YP_001766851.1| porin [Methylobacterium radiotolerans JCM 2831]
 gi|170658995|gb|ACB28049.1| porin [Methylobacterium radiotolerans JCM 2831]
          Length = 288

 Score = 55.0 bits (131), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 31/183 (16%), Positives = 49/183 (26%), Gaps = 59/183 (32%)

Query: 53  FNGPYAGLSALYNGSFG----------------------------EEAHHNAGGSIFAGY 84
           + G Y G++A Y                                   +++   G    GY
Sbjct: 41  WTGFYVGVNAGYGFDANSRNTTNYALRGGTLANSPDTNAVVSVNNRSSNNGFSGGAQIGY 100

Query: 85  NVE---DSCIMYGVEGDVRYTVPVLADN------------------------IHSLHGIG 117
           N +    S I+ G E D +Y       N                          +     
Sbjct: 101 NWQLTPGSGIVVGFEADAQYVDFARRANGTLNYGLAGTPGFAFSAPRAYVATSGNGLDYF 160

Query: 118 GSLRIRGGYEVSDSLLLYATVGPDVAQKYET---GKAGEITPIAIGGTAGVGVEVGGLSE 174
           G+ R R GY   D  L+Y T G       +          +    G   G G+E    ++
Sbjct: 161 GTARGRLGYAF-DRTLVYGTGGYAYGSGQDDQNFAGRNFRSSFRNGYAVGGGIEYALPTD 219

Query: 175 SLV 177
           S +
Sbjct: 220 SFL 222


>gi|27376983|ref|NP_768512.1| hypothetical protein bll1872 [Bradyrhizobium japonicum USDA 110]
 gi|27350125|dbj|BAC47137.1| bll1872 [Bradyrhizobium japonicum USDA 110]
          Length = 602

 Score = 55.0 bits (131), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 38/227 (16%), Positives = 75/227 (33%), Gaps = 55/227 (24%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+   L +G +++A+A+  ++ A        + GR  +P        P   +++G Y G 
Sbjct: 39  MRSRVLFLGAATMAIATTGTSMA--------NLGREALP--------PSVWNWSGGYIGG 82

Query: 61  SALYNGSFGEEAHH-------------NAGGSIFAGYNVEDSCIMYGVEGD--------- 98
                       +              +       GYN +++  +YG+E D         
Sbjct: 83  HVGGGYGRTSFTNPFGPPIYGDVVDIPSFVAGGQIGYNWQNNSWVYGLELDASAAVASGS 142

Query: 99  ---VRYTVPVLADNIHSLHGIGGSLRIRGGYEVS--DSLLLYATVGPD----VAQKYETG 149
              +  +  +++ N ++   +  +   R GY        L Y   G              
Sbjct: 143 NTCLAASDLIVSANCNAAPNLFATGTGRIGYAFGSLGQTLAYLKAGAAWQNNRGDIVNNF 202

Query: 150 KAGE--ITPIA-----IGGTAGVGVEVGGLSESLVARLEYRASKYSK 189
           + G+            +GG  G+GVE   L+ S    +EY    +  
Sbjct: 203 EGGDLPQEKTHFDYGQVGGVIGLGVE-QALTPSWSVNVEYDYLHFGG 248


>gi|94495792|ref|ZP_01302371.1| outer membrane protein-like [Sphingomonas sp. SKA58]
 gi|94424484|gb|EAT09506.1| outer membrane protein-like [Sphingomonas sp. SKA58]
          Length = 169

 Score = 55.0 bits (131), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 38/154 (24%), Positives = 64/154 (41%), Gaps = 12/154 (7%)

Query: 53  FNGPYAGLSALYNGSFGEEAHHNAGGSIFAGYNVE-DSCIMYGVEGDVRYTVPVLADNIH 111
           F GP AG++  Y+   GE+        + AGY++     I+ GVE  +     V    + 
Sbjct: 27  FTGPRAGVTMGYDKIGGED---GFAYGVTAGYDLALAPRIVGGVEVSLG-DTTVDDSGLD 82

Query: 112 SLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGG 171
               I  SLR   GY V+  +L +  VG    +    G    +  +  G     G+E   
Sbjct: 83  VSRDIAASLRA--GYVVTPRVLAFGKVGYASTRFEFDGDGAGLEGVRYG----GGLEFAA 136

Query: 172 LSESLVARLEYRASKYSKVEGFYNTISLGVGMKF 205
            + +     EY+ ++Y +  G  +   +GVG +F
Sbjct: 137 -TPNTYISAEYQRTEYEQNVGGRDAAMVGVGFRF 169


>gi|294677984|ref|YP_003578599.1| hypothetical protein RCAP_rcc02462 [Rhodobacter capsulatus SB 1003]
 gi|294476804|gb|ADE86192.1| membrane protein, putative [Rhodobacter capsulatus SB 1003]
          Length = 209

 Score = 55.0 bits (131), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 47/222 (21%), Positives = 78/222 (35%), Gaps = 30/222 (13%)

Query: 1   MQKLFLA-VGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAG 59
           M+KL +A V ++SLA  +         V           PT+A          ++G YAG
Sbjct: 1   MKKLSVAIVAMASLAAPALAGGLTPPVVESE--------PTVAATPAPAPVQAWDGFYAG 52

Query: 60  LSALYNGSFGEEAHHNAGG--------SIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIH 111
           ++       G                  +F GYN++   ++YG E   + T   L D   
Sbjct: 53  ITGGSVTGGGASYAPGGAAFGMGRGSYGVFGGYNLQSGALVYGGEIAAQATDFNL-DGAP 111

Query: 112 SLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGG 171
                   L+ R G       L YA VG            G+    A G   G+GV+   
Sbjct: 112 GKFDNMIDLKARAGMAY-GKALPYAFVGYSRGDWK--NGDGQTNGAADGMNYGLGVDY-A 167

Query: 172 LSESLVARLEYR----ASKYS----KVEGFYNTISLGVGMKF 205
           +++      E      ++ +      V+  +NT+ +  G +F
Sbjct: 168 VNDKWSVGAELMRRELSTDFDGSARSVDTNFNTVQVRAGFRF 209


>gi|85704834|ref|ZP_01035935.1| possible outer membrane protein [Roseovarius sp. 217]
 gi|85670652|gb|EAQ25512.1| possible outer membrane protein [Roseovarius sp. 217]
          Length = 209

 Score = 55.0 bits (131), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 29/179 (16%), Positives = 58/179 (32%), Gaps = 20/179 (11%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRH--------D 52
           M+ L   +  ++LA+A+  +A+      +         P       +  +         +
Sbjct: 1   MRPLLPLLATTTLAVAAPATAETPPTAFQQPVLITFDAPNDTPTASLSTQSRPTLSSSAN 60

Query: 53  FNGPYAGLSALYNGSFGEEAHHN--AGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNI 110
           + G Y G          + + ++    G +  GY+ +    + G   D  +         
Sbjct: 61  WTGFYIGGQLGVGVVDSDISSNDEDFIGGVTFGYDHDFGRWVLGGALDYDFADINAGPGT 120

Query: 111 HSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEV 169
                    +++RGG ++ +  LLY   G       +T  AG       G   G G E 
Sbjct: 121 SIEEIFR--VKLRGGPKIGNG-LLYGAAGWA---NADTDTAGRDD----GWFIGAGYEY 169


>gi|209885401|ref|YP_002289258.1| outer membrane protein Omp31 [Oligotropha carboxidovorans OM5]
 gi|209873597|gb|ACI93393.1| outer membrane protein Omp31 [Oligotropha carboxidovorans OM5]
          Length = 225

 Score = 55.0 bits (131), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 31/165 (18%), Positives = 53/165 (32%), Gaps = 46/165 (27%)

Query: 68  FGEEAHHNAGGSIFAGYNVE-DSCIMYGVEGDVRYTVPVLADNIHS-----------LHG 115
           +    H  A G    GYN +     + G+EGD +      + +                 
Sbjct: 23  WPTGTHSGALGGFQIGYNYQVRPDWVIGLEGDFQLADIGGSGSTSHIVPGVATSASQTVR 82

Query: 116 IGGSLRIRGGYEVSDSLLLYATVGPD-----------------VAQKYETGK-------- 150
             G++R R G+  +++LL+YAT G                    +  ++           
Sbjct: 83  SFGTIRARLGHVAAENLLVYATGGFAFAKINSSARFDVEPGTSGSGIFDINGVRYTSLCG 142

Query: 151 --------AGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKY 187
                   AG    +A G T G G E   L      + EY  +++
Sbjct: 143 GPNPNVCYAGSSRGMAPGWTIGGGFEY-ALGPRWSLKGEYLYARF 186


>gi|332701600|ref|ZP_08421688.1| putative outer-membrane protein [Desulfovibrio africanus str.
           Walvis Bay]
 gi|332551749|gb|EGJ48793.1| putative outer-membrane protein [Desulfovibrio africanus str.
           Walvis Bay]
          Length = 217

 Score = 55.0 bits (131), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 38/173 (21%), Positives = 57/173 (32%), Gaps = 28/173 (16%)

Query: 38  VPTIATNRYVPIRHDFNGPYAGLSAL---------YNG---SFGEEAHH-NAGGSIFAGY 84
           +P +A     P    F+G Y G             Y+G    F ++A        ++ G 
Sbjct: 16  LPVMAHAGSTP----FDGFYIGAKVGNESYQIDVEYDGPSNDFEDDADDSGFVAGVYLGN 71

Query: 85  NVEDSCIMY-GVEGDV---RYTVPVLADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGP 140
                 + Y G E D             N          L+ R G  ++D  LLY   G 
Sbjct: 72  GRAIKDVFYLGWEVDAMTHNMEGSFSGGNESLDMNWSLGLKARLGGVIADRNLLYGLAGV 131

Query: 141 DVAQKYETGKAG------EITPIAIGGTAGVGVEVGGLSESLVARLEYRASKY 187
             A        G      +  P+  G T G G E   +++ L+AR E   + Y
Sbjct: 132 RFASFDYRNDTGYILDDEDENPVLPGFTLGGGYEF-AITDHLIARAEVTYTAY 183


>gi|329905096|ref|ZP_08274021.1| hypothetical protein IMCC9480_2393 [Oxalobacteraceae bacterium
           IMCC9480]
 gi|327547723|gb|EGF32502.1| hypothetical protein IMCC9480_2393 [Oxalobacteraceae bacterium
           IMCC9480]
          Length = 199

 Score = 55.0 bits (131), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 32/185 (17%), Positives = 60/185 (32%), Gaps = 20/185 (10%)

Query: 40  TIATNRYVPIRHDFNGPYAGLSALYNGS---------FGEEAHHNAGGSIFAGYNVE-DS 89
                       +F G  AG++A Y  +         +G     +  GS+   Y    + 
Sbjct: 16  APQAFAQTAQSRNFEGFSAGINANYAKTRATARFGNQYGSTDDTSTNGSVQGAYGFALND 75

Query: 90  CIMYGVEGDVRYTVPVLA--DNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYE 147
             + GV     +        + +        S+ +  GY ++++ L+Y  +     +   
Sbjct: 76  KFVMGVGATAGFGDLDAGSFNGVSVKAKDMYSIYVEPGYRMTNTTLVYGKLSYQRMKGEL 135

Query: 148 TGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSK-------VEGFYNTISLG 200
           +G     +    G   GVGV    +S     + E     Y         +E      ++G
Sbjct: 136 SGAGTSTSDTFDGYGIGVGV-RSMISNKFYVQAELSELDYGSESVRGIEIEPKQTVGTIG 194

Query: 201 VGMKF 205
           VG KF
Sbjct: 195 VGYKF 199


>gi|159042840|ref|YP_001531634.1| putative outer membrane protein [Dinoroseobacter shibae DFL 12]
 gi|157910600|gb|ABV92033.1| putative outer membrane protein [Dinoroseobacter shibae DFL 12]
          Length = 216

 Score = 54.7 bits (130), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 32/209 (15%), Positives = 61/209 (29%), Gaps = 17/209 (8%)

Query: 9   GVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALY---- 64
              +        A +   +   +     V P +      P    + G Y G    Y    
Sbjct: 13  MFRTATAFGLVLAASTGSLYAGNPEPAPVAPVMVAPVPAPAPF-WAGGYIGAQLGYAYGD 71

Query: 65  ----NGSFGEEAHHNAGGSIFAGYNVEDSC-IMYGVEGDVRYTVPVLADNIHSLHGIGGS 119
                   G++      G + AGY  +       G E    +    + ++          
Sbjct: 72  FDIDAAIDGDDNDDGFIGGLTAGYLFDVGSGWYVGPEVQYDWADLEITEDGGDTASFDEI 131

Query: 120 LRIR--GGYEVSDSLLLYATVGPD-VAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESL 176
            R++   G E+ +  LLY T G    +          I         G+G +   + ++ 
Sbjct: 132 ARLKLIVGREIGNG-LLYGTAGIAYGSLDSAGDVFDGIDGSDTNWLLGLGYDYR-VGDNW 189

Query: 177 VARLEYRASKYSKVEGFYNTISLGVGMKF 205
               EY    +  V+   NT+ +    +F
Sbjct: 190 TVGGEYMYHSFDDVDL--NTLHIKAAYRF 216


>gi|330828258|ref|YP_004391210.1| outer membrane protein A [Aeromonas veronii B565]
 gi|328803394|gb|AEB48593.1| Outer membrane protein A [Aeromonas veronii B565]
          Length = 345

 Score = 54.7 bits (130), Expect = 8e-06,   Method: Composition-based stats.
 Identities = 30/157 (19%), Positives = 53/157 (33%), Gaps = 16/157 (10%)

Query: 46  YVPIRHDFNGPYAGLSALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPV 105
           Y   +  ++  Y G+      + G E +   G  +F GY +  +    G+E    Y    
Sbjct: 28  YGGAKLGWSNFY-GIDESNALTLGNETNDALGAGVFGGYQINKN---LGLELGYDYLGNY 83

Query: 106 LADNIHSLHGIGGSLRI-------RGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIA 158
             D   +       ++        + G+ V+D+L LY  VG             +     
Sbjct: 84  KYDATTAAGAFSDEVKAQLAQLTLKLGFPVTDNLDLYGRVGGGYGWADTKSDVYKDDSRF 143

Query: 159 IGGTAGV-GVEVGGLSESLVARLEYRASK-YSKVEGF 193
           +    G  G E     +   ARLEY+ +  Y   +  
Sbjct: 144 V--MVGALGAEYAFNLD-WAARLEYQYTTPYGSRDDT 177


>gi|323137766|ref|ZP_08072842.1| porin [Methylocystis sp. ATCC 49242]
 gi|322397063|gb|EFX99588.1| porin [Methylocystis sp. ATCC 49242]
          Length = 337

 Score = 54.7 bits (130), Expect = 8e-06,   Method: Composition-based stats.
 Identities = 37/194 (19%), Positives = 56/194 (28%), Gaps = 62/194 (31%)

Query: 56  PYAGLSALYNGSFGEEAHHNAGGSIFAGYNVE-DSCIMYGVEGDV---------RYTV-- 103
            Y GL A  +G+     +   GG    GYN +    I+ GVE D+          YT   
Sbjct: 86  GYGGLMAANSGNASLNQNGFIGGG-QIGYNYQWSPTIVIGVEADMQGSAIRGSGGYTGVG 144

Query: 104 ------------------PVLADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQK 145
                              V    I +     G++R R GY V+ +LL++ T G      
Sbjct: 145 QDLYSMGRMMLMPHGTRNSVGGGTIQAGLDWFGTVRGRVGYLVTPTLLVFGTGGLTYGGA 204

Query: 146 YETG------------------------------KAGEITPIAIGGTAGVGVEVGGLSES 175
           +  G                               +G  +   +G  AG G E      +
Sbjct: 205 WANGNYTSTSAWCGTPTDACYGGMITTPYSQIAVGSGRTSSTLVGWNAGGGFE-WMFMPN 263

Query: 176 LVARLEYRASKYSK 189
              + E        
Sbjct: 264 WSLKAEAFYYDLGS 277


>gi|90425585|ref|YP_533955.1| hypothetical protein RPC_4110 [Rhodopseudomonas palustris BisB18]
 gi|90107599|gb|ABD89636.1| conserved hypothetical protein [Rhodopseudomonas palustris BisB18]
          Length = 274

 Score = 54.7 bits (130), Expect = 8e-06,   Method: Composition-based stats.
 Identities = 53/285 (18%), Positives = 81/285 (28%), Gaps = 101/285 (35%)

Query: 8   VGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGS 67
           V V ++ L     A AAD          G    +          ++ G Y G  A Y  S
Sbjct: 4   VVVGAMLLTVAQEAYAADMPFLRGSVLDGPSRVV----------NWEGFYIGGQASYGTS 53

Query: 68  --------------------------------FGEEAHHNAGGSIFAGYNVEDSCIMYGV 95
                                            G+++ H  G   F GYN + + ++ G+
Sbjct: 54  DMNFTDATRGLAEQAMTNTLVNSAMQVSDWPTLGKQSAHGQGYGGFVGYNWQWTDVVLGL 113

Query: 96  EGDVRYTVPVL-----------------ADNIHSLHGIG----------GSLRIRGGYEV 128
           E    Y                      +D+++   G            GS R R G+ V
Sbjct: 114 EA--NYIHGKFDGSDSNVANPMTRCMGLSDSLYHCAGYRSAASIVINDLGSARARAGWSV 171

Query: 129 SDSLLLYATVGPDVAQKYETGKAGEITP---------------------------IAIGG 161
             S L Y   G  + Q      A                                   G 
Sbjct: 172 -GSFLPYMFGGVSLGQADIVRSASIRDTLYTASPALGGTYVGYNQFDRAKVQNGHFIYGY 230

Query: 162 TAGVGVEVGGLSESLVARLEYRASKYSK-VEGFYNTISLGVGMKF 205
             G+GV++      L  R E+   K++  V+   +T+  GVG KF
Sbjct: 231 GGGLGVDMMVF-GGLFVRAEWEYLKFAAPVDTSVSTVRAGVGYKF 274


>gi|209886118|ref|YP_002289974.1| hypothetical protein OCAR_7002 [Oligotropha carboxidovorans OM5]
 gi|209874314|gb|ACI94110.1| conserved hypothetical protein [Oligotropha carboxidovorans OM5]
          Length = 493

 Score = 54.7 bits (130), Expect = 8e-06,   Method: Composition-based stats.
 Identities = 31/184 (16%), Positives = 59/184 (32%), Gaps = 40/184 (21%)

Query: 48  PIRHDFNGPYAGLSALYNGSFGEEAHHNAG-----------------GSIFAGYNVE-DS 89
              +++ G Y      Y     ++   +                   G+I  GY+ + + 
Sbjct: 270 SPAYNWTGFYLAGGGGYGMFSADQRSVDTTTGAITGIDTRNGGRGYFGTIAGGYDWQINP 329

Query: 90  CIMYGVEGDVRYTVPVLADNIHSLHGIGGSLR--------IRGGYEVSDSLLLYATV--- 138
             + GV GD ++   +      +  G+ G L+        +R GY ++ + L Y      
Sbjct: 330 TWVVGVFGDAQF-GDIRGSLSDAGLGVTGRLKNDTNYAAGVRVGYLIAPNALSYVNGGYS 388

Query: 139 -----GPDVAQKYETGKAGEITPIAIGGTAGVGVE-----VGGLSESLVARLEYRASKYS 188
                G  +  +              G   G GVE      G  +     + EYR ++YS
Sbjct: 389 HADFKGVTLTDETGLAVGSTGKSHRDGWFIGGGVENDLNFFGINAPGWFMKTEYRVAEYS 448

Query: 189 KVEG 192
           +   
Sbjct: 449 RKTS 452



 Score = 51.2 bits (121), Expect = 8e-05,   Method: Composition-based stats.
 Identities = 46/234 (19%), Positives = 78/234 (33%), Gaps = 45/234 (19%)

Query: 4   LFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSAL 63
           +   +  S   +A   +A AAD   R                 V    ++ G Y      
Sbjct: 14  MKKILLGSVALIALGSAANAADLSARYTKAPV-----------VAPVSNWTGFYVSGGFG 62

Query: 64  YNGSFGEEAHHNAG---------------GSIFAGYNVE-DSCIMYGVEGDVRYTVPVLA 107
           Y     ++    +G               G++  GY+ +     + GV GD ++   +  
Sbjct: 63  YGIMEADQHATTSGVASVVDTRMGGRGYFGTVGVGYDYQITPSWVVGVFGDAQW-GDIRG 121

Query: 108 DNIHSLHGIGGSLR--------IRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPI-- 157
             +   +GI   L+         R GY V+ ++L Y  VG   A    T     ++ I  
Sbjct: 122 SLMDLNNGITARLKNDAAYAAGARLGYLVAPNVLSYVNVGYSYASFKGTTFDDGVSTIGK 181

Query: 158 --AIGGTAGVGVE-----VGGLSESLVARLEYRASKYSKVEGFYNTISLGVGMK 204
               G   G GVE      G  +     + EYR ++Y++    Y     G+  K
Sbjct: 182 SHRDGWFIGGGVENDLNFFGINAPGWFMKTEYRVAEYNRRNSVYAGDIDGIAFK 235


>gi|114320656|ref|YP_742339.1| putative outer-membrane protein [Alkalilimnicola ehrlichii MLHE-1]
 gi|114227050|gb|ABI56849.1| putative outer-membrane protein [Alkalilimnicola ehrlichii MLHE-1]
          Length = 218

 Score = 54.3 bits (129), Expect = 9e-06,   Method: Composition-based stats.
 Identities = 26/161 (16%), Positives = 49/161 (30%), Gaps = 14/161 (8%)

Query: 44  NRYVPIRHDFNGPYAGLSALYNGSFGEEAHHN----------AGGSIFAGYNVEDSCIMY 93
                  + F+G Y G    + G   +                   +  G    +    +
Sbjct: 34  PATALANNAFHGVYLGGQIGWAGYDTDIETDGDSIKGLAASGVSSGVLLGTGTVNDGWYF 93

Query: 94  GVEGDVRYTVPVLADNIHSLHGIGGS--LRIRGGYEVSDSLLLYATVGPDVAQKYET-GK 150
           G +G+        +    +   +  S  +  R G  +SD +LLY   G        +   
Sbjct: 94  GFQGNFLLNNADASLGTDADLDVEESYGIDARLGRVISDRVLLYGLAGWQRTNAELSVAG 153

Query: 151 AGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVE 191
             +      G   G GVE     +++  R+EY  + Y   +
Sbjct: 154 VDKDDKDFDGFRFGAGVE-MATQDNVFFRIEYTQTVYGSED 193


>gi|163749836|ref|ZP_02157081.1| outer membrane protein, putative [Shewanella benthica KT99]
 gi|161330350|gb|EDQ01329.1| outer membrane protein, putative [Shewanella benthica KT99]
          Length = 183

 Score = 54.3 bits (129), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 34/165 (20%), Positives = 61/165 (36%), Gaps = 22/165 (13%)

Query: 55  GPYAGLSALYNG---SFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIH 111
           G Y G          + G       G  ++ GYN  DS   +G+E  +  T   + +   
Sbjct: 27  GFYLGGQVNNTAIEDNIGTFDESAIGFGVYGGYNFNDS---FGIEASIFATDSFVDEMDF 83

Query: 112 SLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGG 171
            +  +  S  +R  +  +DS+  Y   G  V + Y      + +    G   G GV+V  
Sbjct: 84  RMAAMTISPVVR--HAFTDSVTAYLKAGLVVNRTYSDDDDVDESYQGTGWLFGAGVDVT- 140

Query: 172 LSESLVARLEY-----------RASKYSKVEGFYNTISLGVGMKF 205
           L++SL  R+ Y           R   ++ +      +  G+  +F
Sbjct: 141 LTQSLALRVFYEISETAPESDERDDDFADISLVQYGV--GLHYRF 183


>gi|296446617|ref|ZP_06888558.1| porin [Methylosinus trichosporium OB3b]
 gi|296255845|gb|EFH02931.1| porin [Methylosinus trichosporium OB3b]
          Length = 723

 Score = 54.3 bits (129), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 33/162 (20%), Positives = 47/162 (29%), Gaps = 43/162 (26%)

Query: 65  NGSFGEEAHHNAGGSIFAGYNVED---SCIMYGVEGD---------------VRYTVPVL 106
           NGS          G +  GYN        I+ G E D               V   +   
Sbjct: 84  NGSIDGNDGGAFLGGVQIGYNFRFDHLGGIIAGFEADLQGVAQGREMRGVSSVSRNILTR 143

Query: 107 ADNIHSLHG------IGGSLRIRGGYEVSDSLLLYATVGPDVAQ---------------- 144
            D++ +           G++R R G  V  ++L+Y T G                     
Sbjct: 144 GDSLINTVDGGGALQFLGTVRARLGLLVDPTVLVYGTGGLAFGGVSYKFGLNSLYANAAG 203

Query: 145 --KYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRA 184
                   A +      G TAG GVE    + S   + EY  
Sbjct: 204 APAQNASAALDNLTTRSGWTAGAGVE-WMFAPSWSLKGEYLY 244


>gi|220924420|ref|YP_002499722.1| porin [Methylobacterium nodulans ORS 2060]
 gi|219949027|gb|ACL59419.1| porin [Methylobacterium nodulans ORS 2060]
          Length = 285

 Score = 54.3 bits (129), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 41/294 (13%), Positives = 74/294 (25%), Gaps = 115/294 (39%)

Query: 17  SFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSFG------- 69
               A+AAD       GG    P            +++G Y G    +  +         
Sbjct: 2   GVTPARAADLDFGTLRGGSYDTPA--------PVGNWDGFYVGGHGGWTSTSFGFGNVFQ 53

Query: 70  -------------------------EEAHHNAGGSIFAGYNVEDSCIMYGVEGDVR---- 100
                                    +          +AG N +    + G E D      
Sbjct: 54  APVANYFRLTTYEANLSASTLLRAQDARRDGTSFGAYAGVNFQFDEFVAGAELDYTHLGV 113

Query: 101 -----------------YTVPVLADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVA 143
                            +    L     +      ++R R GY+ + + + Y T G  + 
Sbjct: 114 TGSTTDAIARQKVTDGYWQALSLVGEAKTRLDDYATIRARFGYD-AGNFMPYVTGGFAIG 172

Query: 144 QKYET-----------------------------GKAGEITPIAI--------------- 159
           +   T                                    P  +               
Sbjct: 173 RAQITDTVTIQARGYDQATYNSNQATGATAYVNRDGYRSFDPTNVSRSVVADPDVVQRTR 232

Query: 160 -----GGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFY---NTISLGVGMKF 205
                G  AG G+E   L+ +++ R EY+  +++  +G     NT+  G  +KF
Sbjct: 233 EKIVGGIAAGAGMEF-ALTANILLRAEYQFVQFNDFDGHKANINTVRGGASVKF 285


>gi|144898146|emb|CAM75010.1| outer membrane protein Omp31 [Magnetospirillum gryphiswaldense
           MSR-1]
          Length = 256

 Score = 54.3 bits (129), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 34/206 (16%), Positives = 53/206 (25%), Gaps = 54/206 (26%)

Query: 45  RYVPIRHDFNGPYAGL-------------SALYNGSF--GEEAHHNAGG----------- 78
                  D++G Y G              +  Y       +       G           
Sbjct: 23  AQSAPTVDWSGFYIGGLVGATNSQTQAKTTVGYQKYLNATDARQMAQAGDSDLSQWQPSV 82

Query: 79  SIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLH----------------GIGGSLRI 122
            +  GY  +   ++ G+E             +   +                    +LR 
Sbjct: 83  GLVGGYGKQFGHVLLGLEASANSIYLNDERTVSENYVSTPASRFILRQSVRADWMATLRP 142

Query: 123 RGGYEVSDSLLLYATVGPDVAQKYETG----------KAGEITPIAIGGTAGVGVEVGGL 172
           R G+   D+ L Y T G  V Q                    T I  G + G G E   L
Sbjct: 143 RLGWA-EDNWLGYVTGGLSVTQLQLDTLFVDNAFSGYSKSSDTKIRTGWSLGFGGEY-AL 200

Query: 173 SESLVARLEYRASKYSKVEGFYNTIS 198
           S     R EY  + +  ++    T S
Sbjct: 201 SGGWALRGEYLYTNFGALKSMSETTS 226


>gi|148555704|ref|YP_001263286.1| opacity protein and related surface antigens-like protein
           [Sphingomonas wittichii RW1]
 gi|148500894|gb|ABQ69148.1| Opacity protein and related surface antigens-like protein
           [Sphingomonas wittichii RW1]
          Length = 188

 Score = 54.3 bits (129), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 36/167 (21%), Positives = 54/167 (32%), Gaps = 18/167 (10%)

Query: 53  FNGPYAGLSALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHS 112
           F GP       ++              + AGY+ +    + GVE +   +       I S
Sbjct: 26  FTGPRVEGIVGWDRVSNNGHDDAVTYGLGAGYDFQMGGAVLGVEAEA--SDSSAKSCIGS 83

Query: 113 LHGIGGSLRIRGGYEV----------SDSLLLYATVGPDVAQKYETGKAGE----ITPIA 158
                  L  + G ++              LLYA  G   A+   T   G      +   
Sbjct: 84  ATAADPRLCAKAGRDLYVGGRVGTVVGGKALLYAKAGYTNARAKATLDDGTTVLRDSGNY 143

Query: 159 IGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFYNTISLGVGMKF 205
            G   G GVE   L  +   + EYR S Y +     N +  G G +F
Sbjct: 144 DGVRVGAGVEY-ALGTNAYVKAEYRYSNYEQ-GFSRNQVVGGFGFRF 188


>gi|300021628|ref|YP_003754239.1| hypothetical protein Hden_0091 [Hyphomicrobium denitrificans ATCC
           51888]
 gi|299523449|gb|ADJ21918.1| hypothetical protein Hden_0091 [Hyphomicrobium denitrificans ATCC
           51888]
          Length = 500

 Score = 53.9 bits (128), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 39/223 (17%), Positives = 76/223 (34%), Gaps = 46/223 (20%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+ +  ++  ++L  +   +A A         G  G +   A     P    ++G Y G 
Sbjct: 1   MKLVLGSLSAAALLCSMASAAYA--------DGPFGSLKDTAPVIEQP---TWSGVYFGA 49

Query: 61  SALYNGSFGEE---------------AHHNAGG--SIFAGYNVEDSC-IMYGVEGDVRYT 102
              Y  +  +                  H  GG  S+  G + +     + G+ GD+  +
Sbjct: 50  GWGYGHNRSKNNYRDSSGDADSSSSRTEHADGGLVSLLYGADRQIGDRFVVGIFGDIDLS 109

Query: 103 VPVLADNIHSLH---GIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAI 159
                +             ++  R G+ ++   L++AT G   A  ++     +I P + 
Sbjct: 110 DITRGNRDEHNALEIDRAWAIGARAGFLLNSRTLIFATAGYTQAH-FDNDGWWDIDPPSS 168

Query: 160 GGTA--GVGVEVGG-----------LSESLVARLEYRASKYSK 189
            GT   G G    G           L+++   R E R S ++ 
Sbjct: 169 PGTTLRGRGSRTFGGYFVGGGVETRLTDNFFLRGEVRYSDFAG 211


>gi|294010892|ref|YP_003544352.1| putative outer membrane protein [Sphingobium japonicum UT26S]
 gi|292674222|dbj|BAI95740.1| putative outer membrane protein [Sphingobium japonicum UT26S]
          Length = 171

 Score = 53.9 bits (128), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 30/154 (19%), Positives = 60/154 (38%), Gaps = 9/154 (5%)

Query: 53  FNGPYAGLSALYNGSFGEEAHHNAGGSIFAGYNVE-DSCIMYGVEGDVRYTVPVLADNIH 111
           F GP AG++  Y+     + +         GY++     + +G E     +   L   + 
Sbjct: 26  FTGPRAGVTLGYDKF---DGNDGFAYGASTGYDIAITPNVTFGPEVAFSDSTTSLGAGVE 82

Query: 112 SLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGG 171
               +  S+R   GY ++  +L +  VG    +   +      +    G   G G+E   
Sbjct: 83  VSRDLSASVR--LGYILNPKVLAFGKVGYANTRVEASNSNSGGS--FEGVRYGGGLEF-A 137

Query: 172 LSESLVARLEYRASKYSKVEGFYNTISLGVGMKF 205
           ++ +     EY+ S+Y    G  +   +G+G +F
Sbjct: 138 VTGNTYISAEYQRSEYEDGIGGRDAGVVGIGFRF 171


>gi|209886273|ref|YP_002290130.1| hypothetical protein OCAR_7161 [Oligotropha carboxidovorans OM5]
 gi|209874469|gb|ACI94265.1| conserved hypothetical protein [Oligotropha carboxidovorans OM5]
          Length = 277

 Score = 53.9 bits (128), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 51/275 (18%), Positives = 76/275 (27%), Gaps = 100/275 (36%)

Query: 19  CSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGS----------- 67
            +A AAD        G           Y     ++ G Y G  A Y  +           
Sbjct: 15  QAAHAADMPDYYALRG--------PVGYGTGVVNWQGFYVGGQAAYGSADMNFANSTGSL 66

Query: 68  ---------------------FGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVL 106
                                 G E+ H  G   F GYN +   ++ GVE    YT    
Sbjct: 67  ISRQLQYASIEQSAQVSQWPILGRESQHGHGFGGFVGYNSQWDDVVLGVEA--SYTHGNF 124

Query: 107 ADNIHSLHGI-----------------------------GGSLRIRGGYEVSDSLLLYAT 137
             +                                     GSLR+R GY   ++ L Y  
Sbjct: 125 NGSASGSLNYVFADIITTPAPGYTDDITYSGTSRFKITDTGSLRVRAGYAW-NNFLPYVF 183

Query: 138 VGPDVAQKYETGKA--------------------------GEITPIAIGGTAGVGVEVGG 171
            G  + +      A                           +      G  AG+GV++  
Sbjct: 184 GGVSLGRADVARTAVISGTQTNPGAAPPNDVLNVYLAKSEAQGGRFIYGYAAGLGVDMML 243

Query: 172 LSESLVARLEYRASKY-SKVEGFYNTISLGVGMKF 205
              +L  R+E+   KY   ++   NT  +G+G KF
Sbjct: 244 F-GNLFGRVEWEYLKYAGPIDTSINTGRVGLGYKF 277


>gi|46205164|ref|ZP_00048920.2| COG3637: Opacity protein and related surface antigens
           [Magnetospirillum magnetotacticum MS-1]
          Length = 313

 Score = 53.9 bits (128), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 30/138 (21%), Positives = 45/138 (32%), Gaps = 35/138 (25%)

Query: 92  MYGVEGDVRYTVPVLADN-----------------IHSLHGIGGSLRIRGGYEVSDSLLL 134
           MYG+E D+  +                        I     + GS R R GY   ++ L+
Sbjct: 1   MYGLEADLAGSNLKRGVRSDVQGFGYEAIDPPFALIREKTDLFGSARARLGYAFGNN-LI 59

Query: 135 YATVGPDVAQKYETGKAGE----------ITPIAIGGTAGVGVEVGGLSESLVARLEYRA 184
           YAT+G   A         +               +G T G GV+   +   L   L+YR 
Sbjct: 60  YATLGLSGANGRVLATYPDLAGGATATAARDVSYLGFTLGAGVQF-AVDPHLSLGLDYRY 118

Query: 185 SKYSKVEGFYNTISLGVG 202
           S   +          G+G
Sbjct: 119 SDLGESR------RFGLG 130


>gi|254513426|ref|ZP_05125491.1| conserved hypothetical protein [Rhodobacteraceae bacterium KLH11]
 gi|221532430|gb|EEE35426.1| conserved hypothetical protein [Rhodobacteraceae bacterium KLH11]
          Length = 185

 Score = 53.9 bits (128), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 38/148 (25%), Positives = 55/148 (37%), Gaps = 19/148 (12%)

Query: 46  YVPIRHDFNGPYAGLSALYNGS--------FGEEAHHNAGGSIFAGYNVEDSCIMYGVEG 97
                 D+NG Y G S   N +           EA  +    +F GY V++   ++G E 
Sbjct: 17  PTHALADWNGAYVGFSLGTNTTNELSSNVTGSFEADSSTALGVFGGYTVQNDDFVFGGEV 76

Query: 98  DVRYTVPV--LADNIHSLHGIG-GSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEI 154
               T  +    D        G   L+ R GY V +++L Y   G     + ETG     
Sbjct: 77  AFLRTPDLEFEVDGREVTFDFGIFDLKGRAGY-VVNNILFYGVAGFSRISEQETGDH--- 132

Query: 155 TPIAIGGTAGVGVEVGGLSESLVARLEY 182
              A G   GVG +   L  + V  +EY
Sbjct: 133 ---ANGFNFGVGADYN-LGNNFVIGIEY 156


>gi|302381465|ref|YP_003817288.1| porin [Brevundimonas subvibrioides ATCC 15264]
 gi|302192093|gb|ADK99664.1| porin [Brevundimonas subvibrioides ATCC 15264]
          Length = 277

 Score = 53.9 bits (128), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 34/155 (21%), Positives = 52/155 (33%), Gaps = 28/155 (18%)

Query: 70  EEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIG------------ 117
           +E  +   G    GY+ +    + G  G+  Y+     D++ S                 
Sbjct: 92  DEDSNGVEGGGRIGYDFQFGNFVVGAVGE--YSGVDAEDSVTSYSTTPAYYVSERNLNNL 149

Query: 118 GSLRIRGGYEVSDSLLLYATVGPDVA---------QKYETGKAGEITPIAIGGTAGVGVE 168
            +LR R GY      L+YAT G                 T  A      A G  AG G+E
Sbjct: 150 AALRARVGYAY-GPALVYATGGVATGEMTNRFYSSNGQNTFTATTDDDQADGYQAGGGIE 208

Query: 169 VGGLSESLVARLEYRASKYSKVEGFYNTISLGVGM 203
              L+  L    EY  +    +E     + +G G+
Sbjct: 209 Y-ALAPHLSVTGEYIYT---SLEASDFNVRVGRGI 239


>gi|85704833|ref|ZP_01035934.1| possible outer membrane protein [Roseovarius sp. 217]
 gi|85670651|gb|EAQ25511.1| possible outer membrane protein [Roseovarius sp. 217]
          Length = 197

 Score = 53.9 bits (128), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 28/154 (18%), Positives = 46/154 (29%), Gaps = 15/154 (9%)

Query: 40  TIATNRYVPIRHDFNGPYAGLSALY---NGSFGEEAHHNAGGSIFAGYNVEDS-CIMYGV 95
                   P   ++ G Y G    Y   + S          G + AGY+ +     + G 
Sbjct: 34  ATPVAPPAPTSPNWTGFYGGGQIGYGDVDTSAAGVEGDGLIGGVIAGYDYDFGNNWVVGA 93

Query: 96  EGDVRYTVPVLADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEIT 155
             D  +    L              + R GY++ +  LLY T G   A     G      
Sbjct: 94  GLDYDFADIDLGGAASLEEVFR--AKARAGYKIGNG-LLYGTGGYAWADTDTFGDDDG-- 148

Query: 156 PIAIGGTAGVGVEVGGLSESLVARLEYRASKYSK 189
                   G G E   ++E++    E    ++  
Sbjct: 149 -----YFVGAGYE-HMVTENVSLGGEVLYHQFDD 176


>gi|325915202|ref|ZP_08177525.1| opacity protein [Xanthomonas vesicatoria ATCC 35937]
 gi|325538562|gb|EGD10235.1| opacity protein [Xanthomonas vesicatoria ATCC 35937]
          Length = 279

 Score = 53.5 bits (127), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 31/166 (18%), Positives = 55/166 (33%), Gaps = 27/166 (16%)

Query: 60  LSALYNGSFGEEAHHNAGGSIFA---GYNVEDSCIMYGVEGDVRYTVPVLADNIHS---- 112
             A    +       + GG+ +    GY+ +    +YGV  +        + +  S    
Sbjct: 80  GGAAAGRTPASGCSKDKGGAEYGARLGYDWQAGNWVYGVVAEYTRNDIRDSVSAFSTTPA 139

Query: 113 ------LHGIGGSLRIRGGYEV--SDSLLLYATVGPDVAQ--------KYETGKAGEITP 156
                       +LR R GY      + L Y T G    +               G    
Sbjct: 140 LYTFTRQLNRTAALRGRIGYAFGQQGNYLAYFTAGVARGEFDHSFASSNTANSFTGSGGD 199

Query: 157 IAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFYNTISLGVG 202
            A G  AGVG++   LS+ +   +EY  ++    +     + +G+G
Sbjct: 200 SADGYQAGVGLQ-RRLSDHVSVGVEYLFTRLQDEDT---RVRVGLG 241


>gi|148255878|ref|YP_001240463.1| putative outer-membrane protein [Bradyrhizobium sp. BTAi1]
 gi|146408051|gb|ABQ36557.1| putative outer-membrane protein [Bradyrhizobium sp. BTAi1]
          Length = 257

 Score = 53.5 bits (127), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 40/226 (17%), Positives = 61/226 (26%), Gaps = 44/226 (19%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+ LF A            +  AA     A    +    T A    V   +D++G Y G 
Sbjct: 2   MKTLFGAT-------VGLGAIAAATSALAADLQMKKGPYTKAPPAVVATVYDWSGFYVGF 54

Query: 61  SAL--------------------YNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVR 100
           +A                          G      A      GY  + +  ++GVE    
Sbjct: 55  NAGGGSSRDCWNLVQNANVVVNPALNREGCSGGGGAAVGGQVGYRYQMANWVFGVEAQGD 114

Query: 101 YTVPVLADNIHSLHGIGGSLR--------IRGGYEVSDSLLLYATVGPDVAQKYETGKA- 151
           +      +    L  +    R         + GY   D++L Y   G  V          
Sbjct: 115 WANFKGTNRNLILPNVSDRSRTNGFGLFTGQVGYAF-DNILGYIKGGAAVVGDRYDTFTT 173

Query: 152 ------GEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVE 191
                         GGT G G+E  G + +    +EY         
Sbjct: 174 NTNVMLDRANTTRWGGTIGAGLEY-GFAPNWSVGVEYDHIFLGNKN 218


>gi|168243859|ref|ZP_02668791.1| outer membrane protein A [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL486]
 gi|198244081|ref|YP_002215003.1| outer membrane protein A [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
 gi|197938597|gb|ACH75930.1| outer membrane protein A [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
 gi|205337186|gb|EDZ23950.1| outer membrane protein A [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL486]
 gi|312912061|dbj|BAJ36035.1| outer membrane protein A [Salmonella enterica subsp. enterica
           serovar Typhimurium str. T000240]
 gi|323129338|gb|ADX16768.1| outer membrane protein A [Salmonella enterica subsp. enterica
           serovar Typhimurium str. 4/74]
 gi|326627270|gb|EGE33613.1| outer membrane protein A [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 9]
          Length = 369

 Score = 53.5 bits (127), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 47/229 (20%), Positives = 79/229 (34%), Gaps = 57/229 (24%)

Query: 2   QKLFLAVGVSSLALASFCS-AQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           QK+       ++ALA F + AQAA                       P  + +   YAG 
Sbjct: 18  QKMKKTAIAIAVALAGFATVAQAA-----------------------PKDNTW---YAGA 51

Query: 61  SALYN--------GSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTV----PVLAD 108
              ++         + G    +  G   F GY V       G E  + Y      P   D
Sbjct: 52  KLGWSQYHDTGFIHNDGPTHENQLGAGAFGGYQV---NPYVGFE--MGYDWLGRMPYKGD 106

Query: 109 NIHSLHGIGG-SLRIRGGYEVSDSLLLYATVG--PDVAQKYETGKAG---EITPIAIGGT 162
           NI+  +   G  L  + GY ++D L +Y  +G     A        G   +     +   
Sbjct: 107 NINGAYKAQGVQLTAKLGYPITDDLDVYTRLGGMVWRADTKSNVPGGPSTKDHDTGVSPV 166

Query: 163 AGVGVEVGGLSESLVARLEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
              G+E   ++  +  RLEY+ +      + +    +   +S+GV  +F
Sbjct: 167 FAGGIEY-AITPEIATRLEYQWTNNIGDANTIGTRPDNGLLSVGVSYRF 214


>gi|56552387|ref|YP_163226.1| hypothetical protein ZMO1491 [Zymomonas mobilis subsp. mobilis ZM4]
 gi|260753934|ref|YP_003226827.1| hypothetical protein Za10_1709 [Zymomonas mobilis subsp. mobilis
           NCIMB 11163]
 gi|56543961|gb|AAV90115.1| hypothetical protein ZMO1491 [Zymomonas mobilis subsp. mobilis ZM4]
 gi|258553297|gb|ACV76243.1| hypothetical protein Za10_1709 [Zymomonas mobilis subsp. mobilis
           NCIMB 11163]
          Length = 267

 Score = 53.5 bits (127), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 40/228 (17%), Positives = 76/228 (33%), Gaps = 36/228 (15%)

Query: 12  SLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSFGEE 71
           + A       Q A  V +       V P   T     + +     + GL    +  +   
Sbjct: 41  TSASDGSAPVQDAPVVAQDTVAQPAVQPVPLTPDPNEVANHSGIKFRGLRVEGDIGWTRA 100

Query: 72  AHHNAGGSIFAGYN-------VEDSCIMYGVEG-----------DVRYTVPVLADNIHSL 113
             ++  G    GY        V D+  ++GVEG           +    + + +   +  
Sbjct: 101 QANHTTGRNNMGYGGTLGVDAVVDNFFVFGVEGSYWNPSKMWEKNAGNNIAIGSQGNNIG 160

Query: 114 HGIGG-SLR---------IRGGYEVSDSLLLYATVGPDVA--QKYETGKAGEITPIAIGG 161
               G S R         +R G+  +  LL+Y   G      +      AG  T   +G 
Sbjct: 161 QVGNGYSARKMFQEWDATLRMGFLPTKDLLIYMAGGYASGKQRNLYMNGAGAPTSKYVGW 220

Query: 162 T----AGVGVEVGGLSESLVARLEYRASKYSKVEGFYNTISLGVGMKF 205
           +     G G+E   ++++     +YR +++       +  +LG G +F
Sbjct: 221 SNGYSVGGGIEYS-ITKNFFMNAQYRWTQFGNHTS-RSRATLGFGFRF 266


>gi|77747747|ref|NP_635849.2| membrane protein [Xanthomonas campestris pv. campestris str. ATCC
           33913]
 gi|77761086|ref|YP_241570.2| membrane protein [Xanthomonas campestris pv. campestris str. 8004]
 gi|188989886|ref|YP_001901896.1| putative outer membrane protein [Xanthomonas campestris pv.
           campestris str. B100]
 gi|167731646|emb|CAP49824.1| putative outer membrane protein [Xanthomonas campestris pv.
           campestris]
          Length = 279

 Score = 53.5 bits (127), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 33/169 (19%), Positives = 56/169 (33%), Gaps = 25/169 (14%)

Query: 55  GPYAGLSALYNGSFG-EEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHS- 112
           G   G +A    + G  +    A   + AGY+ +    +YGV  +        + +  S 
Sbjct: 77  GFCGGAAAGRTPASGCSKDKGGAEYGVRAGYDWQVGDWVYGVVAEYTRNDLRDSVSAFST 136

Query: 113 ---------LHGIGGSLRIRGGYEV--SDSLLLYATVGPDVAQ--------KYETGKAGE 153
                          +LR R GY        L Y T G    +               G 
Sbjct: 137 TPALYTFTRQLNRTAALRGRVGYAFGAQGDYLAYVTAGVARGEFDHSFASSNTANSFTGS 196

Query: 154 ITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFYNTISLGVG 202
               A G  AG+G++   LS+ +   +EY  ++    +     + +G G
Sbjct: 197 GGDSANGYQAGIGLQ-RRLSDHVSVGVEYLFTRLQDEDT---RVRVGPG 241


>gi|323135881|ref|ZP_08070964.1| putative outer-membrane immunogenic protein precursor
           [Methylocystis sp. ATCC 49242]
 gi|322398972|gb|EFY01491.1| putative outer-membrane immunogenic protein precursor
           [Methylocystis sp. ATCC 49242]
          Length = 283

 Score = 53.5 bits (127), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 31/194 (15%), Positives = 57/194 (29%), Gaps = 56/194 (28%)

Query: 51  HDFNGPYAGLSALYNGSFG--------------------EEAHHNAGGSIFAGYNVE-DS 89
             + G Y G++  Y+ + G                      +     G    GYN +   
Sbjct: 40  FTWTGLYGGVNIGYSFNAGGAGWGYFADPLLLSGATWTANPSAQGVIGGGQIGYNYQYSP 99

Query: 90  CIMYGVEGDV---------------RYTVPVLADNIHSLHGIGGSLRIRGGYEVS--DSL 132
            ++ G E D+                +   + A N +      G++R R G  +    +L
Sbjct: 100 WLVIGAEADIQAADINSQQNNWMPSNWFGGLAALNTNKYVDWFGTVRGRLGLVMPSYPNL 159

Query: 133 LLYATVGPDVAQK-----------------YETGKAGEITPIAIGGTAGVGVEVGGLS-E 174
           ++Y T G                       +             G TAG GVE   ++  
Sbjct: 160 MVYGTAGFAYGYVSNTVSVANYPFAAFPVPFAQTGQTTSGNTNTGWTAGGGVEWTPMAFP 219

Query: 175 SLVARLEYRASKYS 188
           +   ++EY  +   
Sbjct: 220 AWSLKVEYLYTDLG 233


>gi|332187217|ref|ZP_08388956.1| hypothetical protein SUS17_2335 [Sphingomonas sp. S17]
 gi|332012638|gb|EGI54704.1| hypothetical protein SUS17_2335 [Sphingomonas sp. S17]
          Length = 200

 Score = 53.5 bits (127), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 37/175 (21%), Positives = 63/175 (36%), Gaps = 23/175 (13%)

Query: 53  FNGPYAGLSALYNGSFGEEAHHNA--GGSIFA---GYNVEDSCIMYGVEGDV-------- 99
           F G        Y+     +   N+   G ++    GY++    ++ G EG++        
Sbjct: 27  FTGFRVEGLIGYDSLNDRQGKDNSSSDGVLYGAGIGYDIPAGPVILGAEGEITGSSSDTR 86

Query: 100 RYTVPVLADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVA----QKYETGKAGEIT 155
              V V  D      G       R GY +S   L Y   G   A    +    G     +
Sbjct: 87  SNNVTVPGDQFRLGAGRDLYAGARVGYMISPVALGYVKAGYTNAKFDARYTNAGVTNVNS 146

Query: 156 PIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGF-----YNTISLGVGMKF 205
               G   G G+E   +S +   + EYR S Y +++G       + +  G+G++F
Sbjct: 147 QEVGGYRLGAGLEY-AISPNTFVKGEYRYSHYDELDGVGINPNRHQLLAGLGLRF 200


>gi|46203394|ref|ZP_00051591.2| hypothetical protein Magn03005785 [Magnetospirillum magnetotacticum
           MS-1]
          Length = 299

 Score = 53.5 bits (127), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 29/136 (21%), Positives = 42/136 (30%), Gaps = 29/136 (21%)

Query: 70  EEAHHNAGGSIFAGYNVED---SCIMYGVEGDVRYTVPVLADNIH--------------- 111
             ++    G    GYN +    S  + GVE D +Y       N +               
Sbjct: 91  RNSNEGFVGGGQIGYNYQFTPGSGFVIGVEADAQYADFGRNRNRYAFATTTGTGGIIPGT 150

Query: 112 --------SLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYET--GKAGEITPIAIGG 161
                   S     G++R R GY   D  L+Y T G           G          G 
Sbjct: 151 LVYNPSGLSGLDYFGTVRGRLGYAF-DRTLVYGTGGFAYGSGGGREFGTGVSSNDFQTGW 209

Query: 162 TAGVGVEVGGLSESLV 177
            AG G+E    ++S +
Sbjct: 210 AAGGGIEYALPTDSFL 225


>gi|148253080|ref|YP_001237665.1| putative outer-membrane protein [Bradyrhizobium sp. BTAi1]
 gi|146405253|gb|ABQ33759.1| putative outer-membrane protein [Bradyrhizobium sp. BTAi1]
          Length = 258

 Score = 53.5 bits (127), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 32/201 (15%), Positives = 62/201 (30%), Gaps = 42/201 (20%)

Query: 18  FCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSAL-------YNGSF-- 68
              +  AD   R ++      P           +D++G Y G++         ++ +F  
Sbjct: 14  ASPSFGADQTERVYYNYSRPKPVFE------PNYDWSGFYVGVNVGGGKAHACWDDAFSF 67

Query: 69  ----------GEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLAD--------NI 110
                     G  +   A     AGY  + +  + GVE    +     ++          
Sbjct: 68  GVLNSPAISEGCHSTSGAIAGGQAGYRWQSAFAVLGVEAQGDWANLRGSNISQLDPTLTN 127

Query: 111 HSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETG-------KAGEITPIAIGGTA 163
            ++    G    + G    + +L Y   G  +      G            +    GGT 
Sbjct: 128 RTITDAIGLFTGQAGAAWQN-VLWYIKGGAAITNDKYDGLITGTSVLNDRASGTRWGGTI 186

Query: 164 GVGVEVGGLSESLVARLEYRA 184
           G G+E+ G + +    +EY  
Sbjct: 187 GTGIEI-GFAPNWSVGIEYDH 206


>gi|163743239|ref|ZP_02150620.1| outer membrane protein, putative [Phaeobacter gallaeciensis 2.10]
 gi|161383427|gb|EDQ07815.1| outer membrane protein, putative [Phaeobacter gallaeciensis 2.10]
          Length = 194

 Score = 53.1 bits (126), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 33/174 (18%), Positives = 55/174 (31%), Gaps = 18/174 (10%)

Query: 4   LFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSAL 63
           +   V ++++A A    A A +             P +  N       D+ G Y G    
Sbjct: 1   MTRIVSMAAIAAALSTPAFAGNLEEPVVAPAPAAPPVVVAND----GGDWTGAYIGGQIG 56

Query: 64  YNGSFGEE--AHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGSLR 121
              +      +  +    + AGYN +    + G E D   T   L     +   +   +R
Sbjct: 57  QLDADTSNGLSGDDVSYGVHAGYNYDFGRFVLGGEIDYDATDVDLGGGAAT---VDSVMR 113

Query: 122 IRG--GYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIG------GTAGVGV 167
            +   GY+    +L Y T G          + GE   I +        T G  V
Sbjct: 114 GKVKAGYDF-GPVLAYVTGGVAQVDTSVGDETGEFYGIGVAYRVTDQWTVGGEV 166


>gi|260431608|ref|ZP_05785579.1| conserved hypothetical protein [Silicibacter lacuscaerulensis
           ITI-1157]
 gi|260415436|gb|EEX08695.1| conserved hypothetical protein [Silicibacter lacuscaerulensis
           ITI-1157]
          Length = 179

 Score = 53.1 bits (126), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 28/145 (19%), Positives = 46/145 (31%), Gaps = 13/145 (8%)

Query: 52  DFNGPYAGLSALY---NGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLAD 108
           D+ G Y G    Y   + +          G I  GY+ +    + G   D  ++   L+ 
Sbjct: 28  DWTGFYGGAQIGYADIDTNLSGVDGDGVIGGIILGYDYDLGDWVVGGGFDYDWSDIDLSG 87

Query: 109 NIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVE 168
                      L+ R GY+V+   LLY   G   A        G       G   G G E
Sbjct: 88  AATVEDVWR--LKARAGYKVNPQGLLYGVAGYAEAGT---DTLGSDD----GWFVGAGYE 138

Query: 169 VGGLSESLVARLEYRASKYSKVEGF 193
              ++ ++    E    ++      
Sbjct: 139 -QIVAPNVSIAGEVLYHEFDDFNST 162


>gi|170749700|ref|YP_001755960.1| porin [Methylobacterium radiotolerans JCM 2831]
 gi|170656222|gb|ACB25277.1| porin [Methylobacterium radiotolerans JCM 2831]
          Length = 287

 Score = 53.1 bits (126), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 32/183 (17%), Positives = 48/183 (26%), Gaps = 59/183 (32%)

Query: 53  FNGPYAGLSALY----------------------------NGSFGEEAHHNAGGSIFAGY 84
           + G Y G++A Y                                    ++   G    GY
Sbjct: 40  WTGFYVGVNAGYGFDANSRNTTNYALRGGTLANSPDTNAVVSVNNRSNNNGFSGGAQIGY 99

Query: 85  NVE---DSCIMYGVEGDVRYTVPVLADN------------------------IHSLHGIG 117
           N +    S I+ G E D +Y       N                          +     
Sbjct: 100 NWQLTPGSGIVVGFEADAQYVDFARRANGTLNYGLTGTPGFAFSAPRAYVATSGNGLDYF 159

Query: 118 GSLRIRGGYEVSDSLLLYATVGPDVAQKYET---GKAGEITPIAIGGTAGVGVEVGGLSE 174
           G+ R R GY   D  L+Y T G       +          +    G   G GVE    ++
Sbjct: 160 GTARGRLGYAF-DRTLVYGTGGYAYGSGQDDQTFAGRNFRSSFRNGYAVGGGVEYALPTD 218

Query: 175 SLV 177
           S +
Sbjct: 219 SFL 221


>gi|254437354|ref|ZP_05050848.1| hypothetical protein OA307_2224 [Octadecabacter antarcticus 307]
 gi|198252800|gb|EDY77114.1| hypothetical protein OA307_2224 [Octadecabacter antarcticus 307]
          Length = 197

 Score = 53.1 bits (126), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 33/194 (17%), Positives = 65/194 (33%), Gaps = 18/194 (9%)

Query: 4   LFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSAL 63
           +F A   ++L ++   ++ A +            +     +       D+ G Y G S  
Sbjct: 1   MFFAATTTALTMSVASASFAGNLSEPIIAPSPAAMAAPVYSTGT----DWTGFYVGGSLG 56

Query: 64  YNGSFGEEA----HHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGS 119
           Y     +++       A   I AGY+ +    + G E ++     V              
Sbjct: 57  YAEGSEDDSTVFEDDGATYGIHAGYDYDFGNFVLGAELELS-GFDVSDGGNDIDSVSRAK 115

Query: 120 LRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVAR 179
           LR   GY+ + + L Y TVG       + G   +          GVG++   L++ +   
Sbjct: 116 LRA--GYD-AGAFLPYLTVGVA---SLDIGGGLDANDTGSFY--GVGMDY-MLNDRIRLG 166

Query: 180 LEYRASKYSKVEGF 193
            E    ++   +  
Sbjct: 167 GEVLQHEFGNFDNT 180


>gi|254475346|ref|ZP_05088732.1| putative outer membrane protein [Ruegeria sp. R11]
 gi|214029589|gb|EEB70424.1| putative outer membrane protein [Ruegeria sp. R11]
          Length = 190

 Score = 53.1 bits (126), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 34/181 (18%), Positives = 54/181 (29%), Gaps = 22/181 (12%)

Query: 4   LFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSAL 63
           +   V ++++A A    A A +            V  + T        D+ G Y G    
Sbjct: 1   MTRIVSMAAIAAALSTPAFAGNLEEPVVEPVPAPVTVVQTGT------DWTGAYIGGQIG 54

Query: 64  YNGSFGEE--AHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGSLR 121
              +      +  +    I AGYN +    + G E D   T   L         +    R
Sbjct: 55  QLDADTSNGLSGDDVSYGIHAGYNYDFGQFVLGGELDYDATDTDLGGAT-----VDSVAR 109

Query: 122 IRG--GYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIG------GTAGVGVEVGGLS 173
            +   GYE    +L Y T G          + GE   I +        T G  +      
Sbjct: 110 AKVKAGYEF-GPVLAYVTGGVAQVDTSVGDETGEFYGIGMAYRVNEQWTVGGEILEHDFD 168

Query: 174 E 174
           +
Sbjct: 169 D 169


>gi|39936343|ref|NP_948619.1| heme receptor [Rhodopseudomonas palustris CGA009]
 gi|39650198|emb|CAE28721.1| possible heme receptor [Rhodopseudomonas palustris CGA009]
          Length = 1191

 Score = 53.1 bits (126), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 29/149 (19%), Positives = 53/149 (35%), Gaps = 45/149 (30%)

Query: 45   RYVPIRHDFNGPYAGLSALYN----------------GSFGEEAHHNAGG----SIFAGY 84
                   +++G +AG++  YN                G    EA +   G     + AGY
Sbjct: 935  APSAAVANWSGFHAGVNTAYNSAKFGGAMTALDGSADGHAANEAPNQQVGALSFGLHAGY 994

Query: 85   NVEDSC-IMYGVEGDVRYTVPVLADNIHSLHG------------------------IGGS 119
            + + +   + G+E DV  T    +    +  G                           +
Sbjct: 995  DYQFASRFIVGIEADVAKTDIGASQVTFASEGVACNCANNLARMRQLEAVQQSEIKWLST 1054

Query: 120  LRIRGGYEVSDSLLLYATVGPDVAQKYET 148
            +R R GY V+D L+L+A+ G    ++ E+
Sbjct: 1055 VRGRLGYAVNDRLMLFASGGVAFMRQDES 1083


>gi|161503852|ref|YP_001570964.1| outer membrane protein A [Salmonella enterica subsp. arizonae
           serovar 62:z4,z23:-- str. RSK2980]
 gi|160865199|gb|ABX21822.1| hypothetical protein SARI_01940 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 358

 Score = 53.1 bits (126), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 42/204 (20%), Positives = 67/204 (32%), Gaps = 51/204 (25%)

Query: 2   QKLFLAVGVSSLALASFCS-AQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           QK+       ++ALA F + AQAA                       P  + +   Y G 
Sbjct: 7   QKMKKTAIAIAVALAGFATVAQAA-----------------------PKDNTW---YTGA 40

Query: 61  SALYNGSF--------GEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTV----PVLAD 108
              ++           G    +  G   F GY V       G E  + Y      P   D
Sbjct: 41  KLGWSQYHDTGFIPNNGPTHENQLGAGAFGGYQV---NPYVGFE--MGYDWLGRMPYKGD 95

Query: 109 NIHSLHGIGG-SLRIRGGYEVSDSLLLYATVG--PDVAQKYETGKAG---EITPIAIGGT 162
           NI+  +   G  L  + GY ++D L +Y  +G     A        G   +     +   
Sbjct: 96  NINGAYKAQGVQLTAKLGYPITDDLDVYTRLGGMVWRADTKSNTPGGASYKDHDTGVSPV 155

Query: 163 AGVGVEVGGLSESLVARLEYRASK 186
              G+E   ++  +  RLEY+ + 
Sbjct: 156 FAGGIEY-AITPEIATRLEYQWTN 178


>gi|194450606|ref|YP_002045072.1| outer membrane protein A [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL476]
 gi|197265555|ref|ZP_03165629.1| outer membrane protein A [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA23]
 gi|194408910|gb|ACF69129.1| outer membrane protein A [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL476]
 gi|197243810|gb|EDY26430.1| outer membrane protein A [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA23]
 gi|321223685|gb|EFX48748.1| Outer membrane protein A precursor [Salmonella enterica subsp.
           enterica serovar Typhimurium str. TN061786]
 gi|326622756|gb|EGE29101.1| outer membrane protein A [Salmonella enterica subsp. enterica
           serovar Dublin str. 3246]
          Length = 358

 Score = 52.7 bits (125), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 47/229 (20%), Positives = 79/229 (34%), Gaps = 57/229 (24%)

Query: 2   QKLFLAVGVSSLALASFCS-AQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           QK+       ++ALA F + AQAA                       P  + +   YAG 
Sbjct: 7   QKMKKTAIAIAVALAGFATVAQAA-----------------------PKDNTW---YAGA 40

Query: 61  SALYN--------GSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTV----PVLAD 108
              ++         + G    +  G   F GY V       G E  + Y      P   D
Sbjct: 41  KLGWSQYHDTGFIHNDGPTHENQLGAGAFGGYQV---NPYVGFE--MGYDWLGRMPYKGD 95

Query: 109 NIHSLHGIGG-SLRIRGGYEVSDSLLLYATVG--PDVAQKYETGKAG---EITPIAIGGT 162
           NI+  +   G  L  + GY ++D L +Y  +G     A        G   +     +   
Sbjct: 96  NINGAYKAQGVQLTAKLGYPITDDLDVYTRLGGMVWRADTKSNVPGGPSTKDHDTGVSPV 155

Query: 163 AGVGVEVGGLSESLVARLEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
              G+E   ++  +  RLEY+ +      + +    +   +S+GV  +F
Sbjct: 156 FAGGIEY-AITPEIATRLEYQWTNNIGDANTIGTRPDNGLLSVGVSYRF 203


>gi|192359273|ref|YP_001981784.1| outer membrane protein A [Cellvibrio japonicus Ueda107]
 gi|190685438|gb|ACE83116.1| outer membrane protein A [Cellvibrio japonicus Ueda107]
          Length = 344

 Score = 52.7 bits (125), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 34/193 (17%), Positives = 66/193 (34%), Gaps = 32/193 (16%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M++LF  +     A+++  S  AA   R                            Y G+
Sbjct: 1   MKRLFTVLLC---AISTITSYYAAANSREEVETSI---------------------YVGI 36

Query: 61  SALYNGSFGEEAHH-------NAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSL 113
            A Y+ + G  + +       + G  +F GY++     +     D+  T    ++     
Sbjct: 37  RAGYSYNEGSCSSNHLKCDKSDTGYGLFIGYDINPRWAIETSFNDIGDTTATYSNAHLDG 96

Query: 114 HGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLS 173
                 + ++  Y +  +L LY  VG         G+    +   +    G G+E+  +S
Sbjct: 97  DLSQIDISVKYAYPIYQNLSLYGKVGAAYWDAKAKGQNVSFSDTGVSPLLGAGLELI-IS 155

Query: 174 ESLVARLEYRASK 186
           E    R+EY+   
Sbjct: 156 EHWKGRIEYQYID 168


>gi|213161917|ref|ZP_03347627.1| outer membrane protein A [Salmonella enterica subsp. enterica
           serovar Typhi str. E00-7866]
 gi|213425902|ref|ZP_03358652.1| outer membrane protein A [Salmonella enterica subsp. enterica
           serovar Typhi str. E02-1180]
 gi|213622699|ref|ZP_03375482.1| outer membrane protein A [Salmonella enterica subsp. enterica
           serovar Typhi str. E98-2068]
 gi|289826790|ref|ZP_06545725.1| outer membrane protein A [Salmonella enterica subsp. enterica
           serovar Typhi str. E98-3139]
          Length = 369

 Score = 52.7 bits (125), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 43/204 (21%), Positives = 68/204 (33%), Gaps = 51/204 (25%)

Query: 2   QKLFLAVGVSSLALASFCS-AQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           QK+       ++ALA F + AQAA                       P  + +   YAG 
Sbjct: 18  QKMKKTAIAIAVALAGFATVAQAA-----------------------PKDNTW---YAGA 51

Query: 61  SALYN--------GSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTV----PVLAD 108
              ++         + G    +  G   F GY V       G E  + Y      P   D
Sbjct: 52  KLGWSQYHDTGFIHNDGPTHENQLGAGAFGGYQV---NPYVGFE--MGYDWLGRMPYKGD 106

Query: 109 NIHSLHGIGG-SLRIRGGYEVSDSLLLYATVG--PDVAQKYETGKAGEITP---IAIGGT 162
           N +  +   G  L  + GY ++D L +Y  +G     A        G  T      +   
Sbjct: 107 NTNGAYKAQGVQLTAKLGYPITDDLDVYTRLGGMVWRADTKSNVPGGASTKDHDTGVSPV 166

Query: 163 AGVGVEVGGLSESLVARLEYRASK 186
              G+E   ++  +  RLEY+ + 
Sbjct: 167 FAGGIEY-AITPEIATRLEYQWTN 189


>gi|148253343|ref|YP_001237928.1| hypothetical protein BBta_1819 [Bradyrhizobium sp. BTAi1]
 gi|146405516|gb|ABQ34022.1| putative exported protein of unknown function [Bradyrhizobium sp.
           BTAi1]
          Length = 302

 Score = 52.7 bits (125), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 53/305 (17%), Positives = 81/305 (26%), Gaps = 112/305 (36%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+ L +AV V         +AQAAD        G        T      R +++G Y G 
Sbjct: 10  MRSLVMAVSV----FGMVSAAQAADMPDLPVLRGGL------TEGLNGARANWDGYYVGG 59

Query: 61  SALYNGSFGEEAHH------------------------------NAGGSIFAGYNVEDSC 90
              Y  S  + +                                 +   ++ G N +   
Sbjct: 60  QFGYGTSDMDFSRSAASLTNFIFRNSVLQTPTSTWSVLNKNHVQGSSFGVYVGRNFQWED 119

Query: 91  IMYGVEGDVRY-TVPVLADNIHSLHGI---GG---------------------------S 119
            ++G+E +  Y    V +        I    G                           +
Sbjct: 120 TVWGIEVNYNYMNRMVSSSGSSMALNIVNPSGETVAANETRTYSTSVQAAAALQIKDVVT 179

Query: 120 LRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEI------------------------- 154
           LR R G+  +D+ L Y   G  V +   +  A                            
Sbjct: 180 LRGRVGWA-ADNFLPYVFGGLAVGRMETSRVATTNVYLTDTFVNQTTGAIISQTGPSYLP 238

Query: 155 -----------TPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEG---FYNTISLG 200
                           G T G+G E       L AR E+   K+  V+      N+   G
Sbjct: 239 SVSRTYGESRTNSFVGGWTGGLGFEYMMW-GGLFARGEWEYVKFMTVKDTAVTLNSFRAG 297

Query: 201 VGMKF 205
           VG KF
Sbjct: 298 VGYKF 302


>gi|323138214|ref|ZP_08073286.1| porin [Methylocystis sp. ATCC 49242]
 gi|322396466|gb|EFX98995.1| porin [Methylocystis sp. ATCC 49242]
          Length = 259

 Score = 52.7 bits (125), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 29/183 (15%), Positives = 53/183 (28%), Gaps = 46/183 (25%)

Query: 51  HDFNGPYAGLSAL---------------YNGSFG---------EEAHHNAGGSIFAGYNV 86
             + G Y G++                 + G              ++    G + AGYN 
Sbjct: 39  FSWTGFYGGVNIGGSWLDRYNYDAWGPAWTGFGWINATQIAATNFSNAGVSGGVQAGYNY 98

Query: 87  EDSCI-MYGVEGDVRYTVPVLADNIHSLHGIG------------------GSLRIRGGYE 127
           +     + GVE D + T  + A  +++  G+G                  G++R R G  
Sbjct: 99  QLWSWLVAGVEADFQGT-SIGASGVNNGWGLGFAGLPVLWGGASRGVDYFGTVRGRLGVT 157

Query: 128 VSD--SLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRAS 185
           +      L+Y T G    +                G    G        +   ++EY  +
Sbjct: 158 LPGWQQFLVYGTGGFAYGEIRINNGWLGNLRAVGTGWTVGGGVEWAFMPNWSTKVEYLYT 217

Query: 186 KYS 188
              
Sbjct: 218 SIG 220


>gi|161614736|ref|YP_001588701.1| outer membrane protein A [Salmonella enterica subsp. enterica
           serovar Paratyphi B str. SPB7]
 gi|168821824|ref|ZP_02833824.1| outer membrane protein A [Salmonella enterica subsp. enterica
           serovar Weltevreden str. HI_N05-537]
 gi|238911107|ref|ZP_04654944.1| outer membrane protein A [Salmonella enterica subsp. enterica
           serovar Tennessee str. CDC07-0191]
 gi|161364100|gb|ABX67868.1| hypothetical protein SPAB_02488 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|205341689|gb|EDZ28453.1| outer membrane protein A [Salmonella enterica subsp. enterica
           serovar Weltevreden str. HI_N05-537]
 gi|320085284|emb|CBY95068.1| Outer membrane protein A Flags: Precursor [Salmonella enterica
           subsp. en