PSIBLAST alignment of GI: 254780598 and protein with PDB id: 1qj8

>gi|6435772|pdb|1QJ8|A Chain A, Crystal Structure Of The Outer Membrane Protein Ompx From Escherichia Coli Length = 148
>gi|6435815|pdb|1QJ9|A Chain A, Crystal Structure Of The Outer Membrane Protein Ompx From Escherichia Coli Length = 148
 Score = 47.1 bits (110), Expect = 0.001,   Method: Composition-based stats.
 Identities = 28/149 (18%), Positives = 49/149 (32%), Gaps = 6/149 (4%)

Query: 59  GLSALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNI-HSLHGIG 117
            ++  Y  S  +   +   G     Y  E+     GV G   YT      +         
Sbjct: 4   TVTGGYAQSDAQGQMN-KMGGFNLKYRYEEDNSPLGVIGSFTYTEKSRTASSGDYNKNQY 62

Query: 118 GSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIA-IGGTAGVGVEVGGLSESL 176
             +     Y ++D   +Y  VG    +   T         +  G + G G++   + E++
Sbjct: 63  YGITAGPAYRINDWASIYGVVGVGYGKFQTTEYPTYKNDTSDYGFSYGAGLQFNPM-ENV 121

Query: 177 VARLEYRASKYSKVEGFYNTISLGVGMKF 205
                Y  S+   V+    T   GVG +F
Sbjct: 122 ALDFSYEQSRIRSVDVG--TWIAGVGYRF 148