PSIBLAST alignment of GI: 254780598 and protein with PDB id: 2k0l

>gi|218766516|pdb|2K0L|A Chain A, Nmr Structure Of The Transmembrane Domain Of The Outer Membrane Protein A From Klebsiella Pneumoniae In Dhpc Micelles Length = 216
 Score = 62.9 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 30/182 (16%), Positives = 54/182 (29%), Gaps = 15/182 (8%)

Query: 38  VPTIATNRYVPIRHDFNGPYAGLSALYNG--SFGEEAHHNAGGSIFAGYNVEDSCIMYGV 95
                   Y   +  ++  +           + G   +   G   F GY V         
Sbjct: 12  AAPKDNTWYAGGKLGWSQYHDTGFYGNGFQNNNGPTRNDQLGAGAFGGYQVNPYLGFEMG 71

Query: 96  EGDVRYTVPVLADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAG--- 152
              +       + +  +    G  L  + GY ++D L +Y  +G  V +    G      
Sbjct: 72  YDWLGRMAYKGSVDNGAFKAQGVQLTAKLGYPITDDLDIYTRLGGMVWRADSKGNYASTG 131

Query: 153 ---EITPIAIGGTAGVGVEVGGLSESLVARLEYRAS----KYSKVEGFYNT--ISLGVGM 203
                    +      GVE   ++  +  RLEY+          V    +   +SLGV  
Sbjct: 132 VSRSEHDTGVSPVFAGGVE-WAVTRDIATRLEYQWVNNIGDAGTVGTRPDNGMLSLGVSY 190

Query: 204 KF 205
           +F
Sbjct: 191 RF 192