BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780598|ref|YP_003065011.1| outer membrane protein
[Candidatus Liberibacter asiaticus str. psy62]
         (205 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|294852064|ref|ZP_06792737.1| outer-membrane immunogenic protein [Brucella sp. NVSL 07-0026]
 gi|294820653|gb|EFG37652.1| outer-membrane immunogenic protein [Brucella sp. NVSL 07-0026]
          Length = 305

 Score =  146 bits (369), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 60/223 (26%), Positives = 97/223 (43%), Gaps = 28/223 (12%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+ L   V VS+  L    +A AAD ++          P +     V  ++ + G Y GL
Sbjct: 93  MRTLKSLVIVSAALLPFSATAFAADAIQEQ--------PPVPAPVEVAPQYSWAGGYTGL 144

Query: 61  SALYNGSF------GEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLA-DNIHSL 113
              Y  +       G     +     FAG+N +   I+YGVEGD  Y+    + D +   
Sbjct: 145 YLGYGWNKAKTSTVGSIKPDDWKAGAFAGWNFQQDQIVYGVEGDAGYSWAKKSKDGLEVK 204

Query: 114 HGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLS 173
            G  GSLR R GY+++  ++ Y T G   +Q        + +   +G TAG G+E   L+
Sbjct: 205 QGFEGSLRARVGYDLNP-VMPYLTAGIAGSQIKLNNGLDDESKFRVGWTAGAGLE-AKLT 262

Query: 174 ESLVARLEYRASKYSKVEGFY-----------NTISLGVGMKF 205
           ++++ R+EYR ++Y                    I +G+G KF
Sbjct: 263 DNILGRVEYRYTQYGNKNYDLAGTTVRNKLDTQDIRVGIGYKF 305


>gi|189023912|ref|YP_001934680.1| OmpA-like transmembrane domain protein [Brucella abortus S19]
 gi|225627199|ref|ZP_03785237.1| Porin subfamily protein [Brucella ceti str. Cudo]
 gi|237815152|ref|ZP_04594150.1| Porin subfamily protein [Brucella abortus str. 2308 A]
 gi|260566721|ref|ZP_05837191.1| outer membrane protein [Brucella suis bv. 4 str. 40]
 gi|189019484|gb|ACD72206.1| OmpA-like transmembrane domain protein [Brucella abortus S19]
 gi|225618034|gb|EEH15078.1| Porin subfamily protein [Brucella ceti str. Cudo]
 gi|237789989|gb|EEP64199.1| Porin subfamily protein [Brucella abortus str. 2308 A]
 gi|260156239|gb|EEW91319.1| outer membrane protein [Brucella suis bv. 4 str. 40]
          Length = 305

 Score =  146 bits (367), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 60/223 (26%), Positives = 97/223 (43%), Gaps = 28/223 (12%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+ L   V VS+  L    +A AAD ++          P +     V  ++ + G Y GL
Sbjct: 93  MRTLKSLVIVSAALLPFSATAFAADAIQEQ--------PPVPAPVEVAPQYSWAGGYTGL 144

Query: 61  SALYNGSF------GEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLA-DNIHSL 113
              Y  +       G     +     FAG+N +   I+YGVEGD  Y+    + D +   
Sbjct: 145 YLGYGWNKAKTSTVGSIKPDDWKAGAFAGWNFQQDQIVYGVEGDAGYSWAKKSKDGLEVK 204

Query: 114 HGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLS 173
            G  GSLR R GY+++  ++ Y T G   +Q        + +   +G TAG G+E   L+
Sbjct: 205 QGFEGSLRARVGYDLNP-VMPYLTAGIAGSQIKLNNGLDDESKFRVGWTAGAGLE-AKLT 262

Query: 174 ESLVARLEYRASKYSKVEGFY-----------NTISLGVGMKF 205
           ++++ R+EYR ++Y                    I +G+G KF
Sbjct: 263 DNILGRVEYRYTQYGNKNYDLAGTTVRNKLDTQDIRVGIGYKF 305


>gi|297248070|ref|ZP_06931788.1| 25 kDa outer-membrane immunogenic protein [Brucella abortus bv. 5
           str. B3196]
 gi|297175239|gb|EFH34586.1| 25 kDa outer-membrane immunogenic protein [Brucella abortus bv. 5
           str. B3196]
          Length = 305

 Score =  146 bits (367), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 60/223 (26%), Positives = 97/223 (43%), Gaps = 28/223 (12%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+ L   V VS+  L    +A AAD ++          P +     V  ++ + G Y GL
Sbjct: 93  MRTLKSLVIVSAALLPFSATAFAADAIQEQ--------PPVPAPVEVAPQYSWAGGYTGL 144

Query: 61  SALYNGSF------GEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLA-DNIHSL 113
              Y  +       G     +     FAG+N +   I+YGVEGD  Y+    + D +   
Sbjct: 145 YLGYGWNKAKTSTVGSIKPDDWKAGAFAGWNFQQDQIVYGVEGDAGYSWAKKSKDGLEVK 204

Query: 114 HGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLS 173
            G  GSLR R GY+++  ++ Y T G   +Q        + +   +G TAG G+E   L+
Sbjct: 205 QGFEGSLRARVGYDLNP-VMPYLTAGIAGSQIKLNNGLDDESKFRVGWTAGAGLE-AKLT 262

Query: 174 ESLVARLEYRASKYSKVEGFY-----------NTISLGVGMKF 205
           ++++ R+EYR ++Y                    I +G+G KF
Sbjct: 263 DNILGRVEYRYTQYGNKNYDLAGTTVRNKLDTQDIRVGIGYKF 305


>gi|254780598|ref|YP_003065011.1| outer membrane protein [Candidatus Liberibacter asiaticus str.
           psy62]
 gi|254040275|gb|ACT57071.1| outer membrane protein [Candidatus Liberibacter asiaticus str.
           psy62]
          Length = 205

 Score =  139 bits (351), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 205/205 (100%), Positives = 205/205 (100%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL
Sbjct: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGSL 120
           SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGSL
Sbjct: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGSL 120

Query: 121 RIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARL 180
           RIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARL
Sbjct: 121 RIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARL 180

Query: 181 EYRASKYSKVEGFYNTISLGVGMKF 205
           EYRASKYSKVEGFYNTISLGVGMKF
Sbjct: 181 EYRASKYSKVEGFYNTISLGVGMKF 205


>gi|239831535|ref|ZP_04679864.1| Porin subfamily protein [Ochrobactrum intermedium LMG 3301]
 gi|239823802|gb|EEQ95370.1| Porin subfamily protein [Ochrobactrum intermedium LMG 3301]
          Length = 266

 Score =  139 bits (351), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 54/223 (24%), Positives = 95/223 (42%), Gaps = 28/223 (12%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+ L   V  S+  L    +A AAD ++          P +     +  ++ + G Y GL
Sbjct: 54  MRTLKSLVIASAALLPFSATAFAADAIQEQ--------PPVPAPVEMAPQYSWAGGYTGL 105

Query: 61  SALYNGSFGEEAHHNAG------GSIFAGYNVEDSCIMYGVEGDVRYTVPVLA-DNIHSL 113
              Y  +  +     +          +AG+N +    +YGVEGD  Y+    + + +   
Sbjct: 106 YLGYGWNKVKTNTDGSIKPDDMKAGAYAGWNFQQDQFVYGVEGDAGYSWAKKSKNGLEVK 165

Query: 114 HGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLS 173
            G  GSLR R GY+++  ++ Y T G    Q        + +   +G TAG G+E   L+
Sbjct: 166 EGFEGSLRGRLGYDLNP-VMPYITAGVAGKQVKLDNGFDDESKFRVGWTAGAGLE-AKLT 223

Query: 174 ESLVARLEYRASKYSKVEGFY-----------NTISLGVGMKF 205
           ++++ R+EYR +++                  + I +GVG KF
Sbjct: 224 DNILGRVEYRYTQFGNKTYDLGTESVRNKLDTHDIRVGVGYKF 266


>gi|148560659|ref|YP_001258682.1| outer-membrane protein Omp25 [Brucella ovis ATCC 25840]
 gi|3914204|sp|Q45335|OM25_BRUO2 RecName: Full=25 kDa outer-membrane immunogenic protein; Flags:
           Precursor
 gi|1457929|gb|AAB06702.1| 25 kDa outer membrane protein [Brucella ovis]
 gi|148371916|gb|ABQ61895.1| outer-membrane protein Omp25 [Brucella ovis ATCC 25840]
          Length = 201

 Score =  129 bits (325), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 59/212 (27%), Positives = 98/212 (46%), Gaps = 18/212 (8%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+ L   V VS+  L    +A AAD ++          P +     V  ++ + G Y GL
Sbjct: 1   MRTLKSLVIVSAALLPFSATAFAADAIQEQ--------PPVPAPVEVAPQYSWAGGYTGL 52

Query: 61  SALYNGSF------GEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLA-DNIHSL 113
              Y  +       G     +     FAG+N +   I+YGVEG+  Y+    + D +   
Sbjct: 53  YLGYGWNKAKTSTVGSIKPDDWKAGAFAGWNFQQDQIVYGVEGNAGYSWAKKSKDGLEVK 112

Query: 114 HGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLS 173
            G  GSLR R GY+++  ++ Y T G   +Q        + +   +G TAG G+E   L+
Sbjct: 113 QGFEGSLRARVGYDLNP-VMPYLTAGIAGSQIKLNNGLDDESKFRVGWTAGAGLE-AKLT 170

Query: 174 ESLVARLEYRASKYSKVEGFYNTISLGVGMKF 205
           ++++ R+EYR ++Y   +     I +G+G KF
Sbjct: 171 DNILGRVEYRYTQYGN-KLDTQDIRVGIGYKF 201


>gi|153009914|ref|YP_001371129.1| porin [Ochrobactrum anthropi ATCC 49188]
 gi|151561802|gb|ABS15300.1| porin [Ochrobactrum anthropi ATCC 49188]
          Length = 213

 Score =  128 bits (321), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 55/223 (24%), Positives = 94/223 (42%), Gaps = 28/223 (12%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+ L   V  S+  L    +A AAD ++          P +     +  ++ + G Y GL
Sbjct: 1   MRTLKSLVIASAALLPFSATAFAADAIQEQ--------PPVPAPVEMAPQYSWAGGYTGL 52

Query: 61  SALYNGSFGEEAHHNAG------GSIFAGYNVEDSCIMYGVEGDVRYTVPVLA-DNIHSL 113
              Y  +  +                +AG+N +    +YGVEGD  Y+      D +   
Sbjct: 53  YLGYGWNKAKTDTVGTVKPDDMKAGAYAGWNFQQDQFVYGVEGDAGYSWAKKTKDGLEVK 112

Query: 114 HGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLS 173
            G  GSLR R GY+++  ++ Y T G   +Q        + +   +G TAG G+E   L+
Sbjct: 113 QGFEGSLRARLGYDLNP-VMPYITAGVAGSQVKLDNGFDDESKFRVGWTAGAGLE-AKLT 170

Query: 174 ESLVARLEYRASKYSKVEGFY-----------NTISLGVGMKF 205
           ++++ R+EYR +++                  + I +GVG KF
Sbjct: 171 DNILGRVEYRYTQFGNKTYDLGNESVRNKLDTHDIRVGVGYKF 213


>gi|254718838|ref|ZP_05180649.1| OmpA-like transmembrane domain protein [Brucella sp. 83/13]
 gi|265983822|ref|ZP_06096557.1| outer-membrane immunogenic protein [Brucella sp. 83/13]
 gi|306838760|ref|ZP_07471594.1| OmpA-like transmembrane domain protein [Brucella sp. NF 2653]
 gi|306843662|ref|ZP_07476262.1| OmpA-like transmembrane domain protein [Brucella sp. BO1]
 gi|206596726|emb|CAQ68393.1| outer membrane protein 25 [Brucella sp. BO1]
 gi|264662414|gb|EEZ32675.1| outer-membrane immunogenic protein [Brucella sp. 83/13]
 gi|306275972|gb|EFM57681.1| OmpA-like transmembrane domain protein [Brucella sp. BO1]
 gi|306406162|gb|EFM62407.1| OmpA-like transmembrane domain protein [Brucella sp. NF 2653]
          Length = 213

 Score =  127 bits (319), Expect = 9e-28,   Method: Composition-based stats.
 Identities = 60/223 (26%), Positives = 97/223 (43%), Gaps = 28/223 (12%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+ L   V VS+  L    +A AAD ++          P +     V  ++ + G Y GL
Sbjct: 1   MRTLKSLVIVSAALLPFSATAFAADAIQEQ--------PPVPAPVEVAPQYSWAGGYTGL 52

Query: 61  SALYNGSF------GEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLA-DNIHSL 113
              Y  +       G     +     FAG+N +   I+YGVEGD  Y+    + D +   
Sbjct: 53  YLGYGWNKAKTSTVGSIKPDDWKAGAFAGWNFQQDQIVYGVEGDAGYSWAKKSKDGLEVK 112

Query: 114 HGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLS 173
            G  GSLR R GY+++  ++ Y T G   +Q        + +   +G TAG G+E   L+
Sbjct: 113 QGFEGSLRARVGYDLNP-VMPYLTAGIAGSQIKLNNGLDDESKFRVGWTAGAGLE-AKLT 170

Query: 174 ESLVARLEYRASKYSKVEGFY-----------NTISLGVGMKF 205
           ++++ R+EYR ++Y                    I +G+G KF
Sbjct: 171 DNILGRVEYRYTQYGNKNYDLAGTNVRNKLDTQDIRVGIGYKF 213


>gi|161618670|ref|YP_001592557.1| 25 kDa outer-membrane immunogenic protein precursor [Brucella canis
           ATCC 23365]
 gi|161335481|gb|ABX61786.1| 25 kDa outer-membrane immunogenic protein precursor [Brucella canis
           ATCC 23365]
          Length = 213

 Score =  127 bits (318), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 60/223 (26%), Positives = 97/223 (43%), Gaps = 28/223 (12%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+ L   V VS+  L    +A AAD ++          P +     V  ++ + G Y GL
Sbjct: 1   MRTLKSLVIVSAALLPFSATAFAADAIQEQ--------PPVPAPVEVAPQYSWAGGYTGL 52

Query: 61  SALYNGSF------GEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLA-DNIHSL 113
              Y  +       G     +     FAG+N +   I+YGVEGD  Y+    + D +   
Sbjct: 53  YLGYGWNKAKTSTVGSIKPDDWKAGAFAGWNFQKDQIVYGVEGDAGYSWAKKSKDGLEVK 112

Query: 114 HGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLS 173
            G  GSLR R GY+++  ++ Y T G   +Q        + +   +G TAG G+E   L+
Sbjct: 113 QGFEGSLRARVGYDLNP-VMPYLTAGIAGSQIKLNNGLDDESKFRVGWTAGAGLE-AKLT 170

Query: 174 ESLVARLEYRASKYSKVEGFY-----------NTISLGVGMKF 205
           ++++ R+EYR ++Y                    I +G+G KF
Sbjct: 171 DNILGRVEYRYTQYGNKNYDLAGTTVRNKLDTQDIRVGIGYKF 213


>gi|23501588|ref|NP_697715.1| outer-membrane protein Omp25 [Brucella suis 1330]
 gi|62289663|ref|YP_221456.1| outer-membrane protein, 25 kDa [Brucella abortus bv. 1 str. 9-941]
 gi|82699590|ref|YP_414164.1| OmpA-like transmembrane domain-containing protein [Brucella
           melitensis biovar Abortus 2308]
 gi|163842972|ref|YP_001627376.1| 25 kDa outer-membrane immunogenic protein precursor [Brucella suis
           ATCC 23445]
 gi|254688973|ref|ZP_05152227.1| OmpA-like transmembrane domain protein [Brucella abortus bv. 6 str.
           870]
 gi|254697107|ref|ZP_05158935.1| OmpA-like transmembrane domain protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|254701484|ref|ZP_05163312.1| OmpA-like transmembrane domain protein [Brucella suis bv. 5 str.
           513]
 gi|254704031|ref|ZP_05165859.1| OmpA-like transmembrane domain protein [Brucella suis bv. 3 str.
           686]
 gi|254707067|ref|ZP_05168895.1| OmpA-like transmembrane domain protein [Brucella pinnipedialis
           M163/99/10]
 gi|254709823|ref|ZP_05171634.1| OmpA-like transmembrane domain protein [Brucella pinnipedialis
           B2/94]
 gi|254713826|ref|ZP_05175637.1| OmpA-like transmembrane domain protein [Brucella ceti M644/93/1]
 gi|254717116|ref|ZP_05178927.1| OmpA-like transmembrane domain protein [Brucella ceti M13/05/1]
 gi|254730003|ref|ZP_05188581.1| OmpA-like transmembrane domain protein [Brucella abortus bv. 4 str.
           292]
 gi|256031313|ref|ZP_05444927.1| OmpA-like transmembrane domain protein [Brucella pinnipedialis
           M292/94/1]
 gi|256159433|ref|ZP_05457205.1| OmpA-like transmembrane domain protein [Brucella ceti M490/95/1]
 gi|256254721|ref|ZP_05460257.1| OmpA-like transmembrane domain protein [Brucella ceti B1/94]
 gi|256257221|ref|ZP_05462757.1| OmpA-like transmembrane domain protein [Brucella abortus bv. 9 str.
           C68]
 gi|256369135|ref|YP_003106643.1| outer-membrane protein Omp25 [Brucella microti CCM 4915]
 gi|260168451|ref|ZP_05755262.1| OmpA-like transmembrane domain protein [Brucella sp. F5/99]
 gi|260545586|ref|ZP_05821327.1| outer-membrane immunogenic protein [Brucella abortus NCTC 8038]
 gi|260754463|ref|ZP_05866811.1| outer membrane protein [Brucella abortus bv. 6 str. 870]
 gi|260757682|ref|ZP_05870030.1| outer-membrane protein [Brucella abortus bv. 4 str. 292]
 gi|260761509|ref|ZP_05873852.1| outer-membrane immunogenic protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260883492|ref|ZP_05895106.1| outer-membrane immunogenic protein [Brucella abortus bv. 9 str.
           C68]
 gi|261218931|ref|ZP_05933212.1| outer membrane protein [Brucella ceti M13/05/1]
 gi|261221901|ref|ZP_05936182.1| outer-membrane immunogenic protein [Brucella ceti B1/94]
 gi|261314536|ref|ZP_05953733.1| outer membrane protein [Brucella pinnipedialis M163/99/10]
 gi|261317361|ref|ZP_05956558.1| outer-membrane immunogenic protein [Brucella pinnipedialis B2/94]
 gi|261321570|ref|ZP_05960767.1| outer membrane protein Omp25 [Brucella ceti M644/93/1]
 gi|261752028|ref|ZP_05995737.1| outer-membrane immunogenic protein [Brucella suis bv. 5 str. 513]
 gi|261754686|ref|ZP_05998395.1| outer-membrane immunogenic protein [Brucella suis bv. 3 str. 686]
 gi|261757914|ref|ZP_06001623.1| outer-membrane immunogenic protein [Brucella sp. F5/99]
 gi|265988399|ref|ZP_06100956.1| outer-membrane immunogenic protein [Brucella pinnipedialis
           M292/94/1]
 gi|265997865|ref|ZP_06110422.1| outer-membrane protein [Brucella ceti M490/95/1]
 gi|3914205|sp|Q45689|OM25_BRUSU RecName: Full=25 kDa outer-membrane immunogenic protein; Flags:
           Precursor
 gi|68067868|sp|Q44664|OM25_BRUAB RecName: Full=25 kDa outer-membrane immunogenic protein; Flags:
           Precursor
 gi|1457937|gb|AAB36695.1| 25 kDa outer membrane protein [Brucella suis 1330]
 gi|23347502|gb|AAN29630.1| outer-membrane protein Omp25 [Brucella suis 1330]
 gi|46251178|gb|AAS84560.1| Omp25 [Brucella ceti]
 gi|46251180|gb|AAS84561.1| Omp25 [Brucella ceti]
 gi|46251182|gb|AAS84562.1| Omp25 [Brucella pinnipedialis]
 gi|46251184|gb|AAS84563.1| Omp25 [Brucella ceti]
 gi|62195795|gb|AAX74095.1| outer-membrane protein, 25 kDa [Brucella abortus bv. 1 str. 9-941]
 gi|82615691|emb|CAJ10678.1| OmpA-like transmembrane domain [Brucella melitensis biovar Abortus
           2308]
 gi|157310307|emb|CAN43865.1| outer membrane protein 25 [Brucella microti CCM 4915]
 gi|157310309|emb|CAN43866.1| outer membrane protein 25 [Brucella microti]
 gi|163673695|gb|ABY37806.1| 25 kDa outer-membrane immunogenic protein precursor [Brucella suis
           ATCC 23445]
 gi|255999295|gb|ACU47694.1| outer-membrane protein Omp25 [Brucella microti CCM 4915]
 gi|260096993|gb|EEW80868.1| outer-membrane immunogenic protein [Brucella abortus NCTC 8038]
 gi|260668000|gb|EEX54940.1| outer-membrane protein [Brucella abortus bv. 4 str. 292]
 gi|260671941|gb|EEX58762.1| outer-membrane immunogenic protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260674571|gb|EEX61392.1| outer membrane protein [Brucella abortus bv. 6 str. 870]
 gi|260873020|gb|EEX80089.1| outer-membrane immunogenic protein [Brucella abortus bv. 9 str.
           C68]
 gi|260920485|gb|EEX87138.1| outer-membrane immunogenic protein [Brucella ceti B1/94]
 gi|260924020|gb|EEX90588.1| outer membrane protein [Brucella ceti M13/05/1]
 gi|261294260|gb|EEX97756.1| outer membrane protein Omp25 [Brucella ceti M644/93/1]
 gi|261296584|gb|EEY00081.1| outer-membrane immunogenic protein [Brucella pinnipedialis B2/94]
 gi|261303562|gb|EEY07059.1| outer membrane protein [Brucella pinnipedialis M163/99/10]
 gi|261737898|gb|EEY25894.1| outer-membrane immunogenic protein [Brucella sp. F5/99]
 gi|261741781|gb|EEY29707.1| outer-membrane immunogenic protein [Brucella suis bv. 5 str. 513]
 gi|261744439|gb|EEY32365.1| outer-membrane immunogenic protein [Brucella suis bv. 3 str. 686]
 gi|262552333|gb|EEZ08323.1| outer-membrane protein [Brucella ceti M490/95/1]
 gi|264660596|gb|EEZ30857.1| outer-membrane immunogenic protein [Brucella pinnipedialis
           M292/94/1]
          Length = 213

 Score =  127 bits (318), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 60/223 (26%), Positives = 97/223 (43%), Gaps = 28/223 (12%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+ L   V VS+  L    +A AAD ++          P +     V  ++ + G Y GL
Sbjct: 1   MRTLKSLVIVSAALLPFSATAFAADAIQEQ--------PPVPAPVEVAPQYSWAGGYTGL 52

Query: 61  SALYNGSF------GEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLA-DNIHSL 113
              Y  +       G     +     FAG+N +   I+YGVEGD  Y+    + D +   
Sbjct: 53  YLGYGWNKAKTSTVGSIKPDDWKAGAFAGWNFQQDQIVYGVEGDAGYSWAKKSKDGLEVK 112

Query: 114 HGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLS 173
            G  GSLR R GY+++  ++ Y T G   +Q        + +   +G TAG G+E   L+
Sbjct: 113 QGFEGSLRARVGYDLNP-VMPYLTAGIAGSQIKLNNGLDDESKFRVGWTAGAGLE-AKLT 170

Query: 174 ESLVARLEYRASKYSKVEGFY-----------NTISLGVGMKF 205
           ++++ R+EYR ++Y                    I +G+G KF
Sbjct: 171 DNILGRVEYRYTQYGNKNYDLAGTTVRNKLDTQDIRVGIGYKF 213


>gi|254693454|ref|ZP_05155282.1| OmpA-like transmembrane domain protein [Brucella abortus bv. 3 str.
           Tulya]
 gi|261213709|ref|ZP_05927990.1| outer membrane protein [Brucella abortus bv. 3 str. Tulya]
 gi|260915316|gb|EEX82177.1| outer membrane protein [Brucella abortus bv. 3 str. Tulya]
          Length = 213

 Score =  127 bits (318), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 60/223 (26%), Positives = 97/223 (43%), Gaps = 28/223 (12%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+ L   V VS+  L    +A AAD ++          P +     V  ++ + G Y GL
Sbjct: 1   MRTLKSLVIVSAALLPFSATAFAADAIQEQ--------PPVPAPVEVAPQYSWAGGYTGL 52

Query: 61  SALYNGSF------GEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLA-DNIHSL 113
              Y  +       G     +     FAG+N +   I+YGVEGD  Y+    + D +   
Sbjct: 53  YLGYGWNKAKTSTVGSIKPDDWKAGAFAGWNFQQDQIVYGVEGDAGYSWAKKSKDGLEVK 112

Query: 114 HGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLS 173
            G  GSLR R GY+++  ++ Y T G   +Q        + +   +G TAG G+E   L+
Sbjct: 113 QGFEGSLRARVGYDLNP-VMPYLTAGIAGSQIKLNNGLDDESKFRVGWTAGAGLE-AKLT 170

Query: 174 ESLVARLEYRASKYSKVEGFY-----------NTISLGVGMKF 205
           ++++ R+EYR ++Y                    I +G+G KF
Sbjct: 171 DNILGRVEYRYTQYGNKNYDLAGTTVRTKLDTQDIRVGIGYKF 213


>gi|306842032|ref|ZP_07474705.1| OmpA-like transmembrane domain protein [Brucella sp. BO2]
 gi|306287873|gb|EFM59293.1| OmpA-like transmembrane domain protein [Brucella sp. BO2]
          Length = 213

 Score =  127 bits (318), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 60/223 (26%), Positives = 97/223 (43%), Gaps = 28/223 (12%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+ L   V VS+  L    +A AAD ++          P +     V  ++ + G Y GL
Sbjct: 1   MRTLKSLVIVSAALLPFSATAFAADAIQEQ--------PPVPAPVEVAPQYSWAGGYTGL 52

Query: 61  SALYNGSF------GEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLA-DNIHSL 113
              Y  +       G     +     FAG+N +   I+YGVEGD  Y+    + D +   
Sbjct: 53  YLGYGWNKAKTSTVGSIKPDDWKAGAFAGWNFQQDQIVYGVEGDAGYSWAKKSKDGLEVK 112

Query: 114 HGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLS 173
            G  GSLR R GY+++  ++ Y T G   +Q        + +   +G TAG G+E   L+
Sbjct: 113 QGFEGSLRARVGYDLNP-VMPYLTAGIAGSQIKLNNGLDDESKFRVGWTAGAGLE-AKLT 170

Query: 174 ESLVARLEYRASKYSKVEGFY-----------NTISLGVGMKF 205
           ++++ R+EYR ++Y                    I +G+G KF
Sbjct: 171 DNILGRVEYRYTQYGNKNYDLAGTTVRNKLDTQDIRVGLGYKF 213


>gi|17987532|ref|NP_540166.1| 25 kDa outer-membrane immunogenic protein precursor [Brucella
           melitensis bv. 1 str. 16M]
 gi|225852222|ref|YP_002732455.1| OmpA-like transmembrane domain-containing protein [Brucella
           melitensis ATCC 23457]
 gi|256044394|ref|ZP_05447298.1| OmpA-like transmembrane domain protein [Brucella melitensis bv. 1
           str. Rev.1]
 gi|256264270|ref|ZP_05466802.1| outer-membrane protein Omp25 [Brucella melitensis bv. 2 str. 63/9]
 gi|260563745|ref|ZP_05834231.1| outer-membrane immunogenic protein [Brucella melitensis bv. 1 str.
           16M]
 gi|265990813|ref|ZP_06103370.1| outer-membrane immunogenic protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|3914202|sp|Q45321|OM25_BRUME RecName: Full=25 kDa outer-membrane immunogenic protein; Flags:
           Precursor
 gi|1457927|gb|AAB06701.1| 25 kDa outer membrane protein [Brucella melitensis]
 gi|17983234|gb|AAL52430.1| 25 kDa outer-membrane immunogenic protein precursor [Brucella
           melitensis bv. 1 str. 16M]
 gi|225640587|gb|ACO00501.1| OmpA-like transmembrane domain protein [Brucella melitensis ATCC
           23457]
 gi|260153761|gb|EEW88853.1| outer-membrane immunogenic protein [Brucella melitensis bv. 1 str.
           16M]
 gi|263001597|gb|EEZ14172.1| outer-membrane immunogenic protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|263094531|gb|EEZ18340.1| outer-membrane protein Omp25 [Brucella melitensis bv. 2 str. 63/9]
 gi|326408721|gb|ADZ65786.1| OmpA-like transmembrane domain protein [Brucella melitensis M28]
 gi|326538444|gb|ADZ86659.1| OmpA-like transmembrane domain protein [Brucella melitensis M5-90]
          Length = 213

 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 59/223 (26%), Positives = 96/223 (43%), Gaps = 28/223 (12%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+ L   V VS+  L    +A AAD ++          P +     V  ++ + G Y GL
Sbjct: 1   MRTLKSLVIVSAALLPFSATAFAADAIQEQ--------PPVPAPVEVAPQYSWAGGYTGL 52

Query: 61  SALYNGSF------GEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLA-DNIHSL 113
              Y  +       G     +     FAG+N +   I+YGVEGD  Y+    + D +   
Sbjct: 53  YLGYGWNKAKTSTVGSIKPDDWKAGAFAGWNFQQDQIVYGVEGDAGYSWAKKSKDGLEVK 112

Query: 114 HGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLS 173
            G  GSLR R GY+++  ++ Y T G   +Q        + +   +G TAG G+E   L+
Sbjct: 113 QGFEGSLRARVGYDLNP-VMPYLTAGIAGSQIKLNNGLDDESKFRVGWTAGAGLE-AKLT 170

Query: 174 ESLVARLEYRASKYSKVEGFY-----------NTISLGVGMKF 205
           ++++ R+EYR ++Y                      +G+G KF
Sbjct: 171 DNILGRVEYRYTQYGNKNYDLAGTTVRNKLDTQDFRVGIGYKF 213


>gi|256113236|ref|ZP_05454104.1| OmpA-like transmembrane domain protein [Brucella melitensis bv. 3
           str. Ether]
 gi|265994648|ref|ZP_06107205.1| outer-membrane immunogenic protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|262765761|gb|EEZ11550.1| outer-membrane immunogenic protein [Brucella melitensis bv. 3 str.
           Ether]
          Length = 213

 Score =  126 bits (315), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 59/223 (26%), Positives = 96/223 (43%), Gaps = 28/223 (12%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+ L   V VS+  L    +A AAD ++          P +     V  ++ + G Y GL
Sbjct: 1   MRTLKSLVIVSAALLPFSATAFAADAIQEQ--------PPVPAPVEVAPQYSWAGGYTGL 52

Query: 61  SALYNGSF------GEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLA-DNIHSL 113
              Y  +       G     +     FAG+N +   I+YGVEGD  Y+    + D +   
Sbjct: 53  YLGYGWNKAKTSTVGSIKPDDWKAGAFAGWNFQQDQIVYGVEGDAGYSWAKKSKDGLEVK 112

Query: 114 HGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLS 173
            G  GSLR R GY+++  ++ Y T G   +Q        + +   +G TAG G+E   L+
Sbjct: 113 QGFEGSLRARVGYDLNP-VMPYLTAGIVGSQIKLNNGLDDESKFRVGWTAGAGLE-AKLT 170

Query: 174 ESLVARLEYRASKYSKVEGFY-----------NTISLGVGMKF 205
           ++++ R+EYR ++Y                      +G+G KF
Sbjct: 171 DNILGRVEYRYTQYGNKNYDLAGTTVRNKLDTQDFRVGIGYKF 213


>gi|3914201|sp|Q45110|OM25_BRUCA RecName: Full=25 kDa outer-membrane immunogenic protein; Flags:
           Precursor
 gi|1457931|gb|AAB36692.1| 25 kDa outer membrane protein [Brucella canis]
          Length = 213

 Score =  126 bits (315), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 61/223 (27%), Positives = 97/223 (43%), Gaps = 28/223 (12%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+ L   V VS+  L    +A AAD ++          P +     V  ++ + G Y GL
Sbjct: 1   MRTLKSLVIVSAALLPFSATAFAADAIQEQ--------PPVPAPVEVAPQYSWAGGYTGL 52

Query: 61  SALYNGSF------GEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLA-DNIHSL 113
              Y  +       G     +     FAG+N +   I+YGVEGD  Y+    + D +   
Sbjct: 53  YLGYGWNKAKTSTVGSIKPDDWKAGAFAGWNFQKDQIVYGVEGDAGYSWAKKSKDGLEVK 112

Query: 114 HGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLS 173
            G  GSLR R GY+++  ++ Y T G   +Q          +   +G TAG G+E   L+
Sbjct: 113 QGFEGSLRARVGYDLNP-VMPYLTAGIAGSQIKLNNGLDGESKFRVGWTAGAGLE-AKLT 170

Query: 174 ESLVARLEYRASKYSKVEGFY-----------NTISLGVGMKF 205
           ++++ R+EYR ++YS                   I +G+G KF
Sbjct: 171 DNILGRVEYRYTQYSNKNYDLAGTTVRNKLDTQDIRVGIGYKF 213


>gi|256060827|ref|ZP_05450987.1| OmpA-like transmembrane domain protein [Brucella neotomae 5K33]
 gi|261324818|ref|ZP_05964015.1| outer-membrane protein Omp25 [Brucella neotomae 5K33]
 gi|3914203|sp|Q45326|OM25_BRUNE RecName: Full=25 kDa outer-membrane immunogenic protein; Flags:
           Precursor
 gi|1457935|gb|AAB36694.1| 25 kDa outer membrane protein [Brucella neotomae]
 gi|261300798|gb|EEY04295.1| outer-membrane protein Omp25 [Brucella neotomae 5K33]
          Length = 213

 Score =  125 bits (313), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 60/223 (26%), Positives = 97/223 (43%), Gaps = 28/223 (12%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+ L   V VS+  L    +A AAD ++          P +     V  ++ + G Y GL
Sbjct: 1   MRTLKSLVIVSAALLPFSATAFAADAIQEQ--------PPVPAPVEVAPQYSWAGGYTGL 52

Query: 61  SALYNGSF------GEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLA-DNIHSL 113
              Y  +       G     +     FAG+N +   I+YGVEGD  Y+    + D +   
Sbjct: 53  YLGYGWNKAKTSTVGSIKPDDWKAGAFAGWNFQQDQIVYGVEGDAGYSWAKKSKDGLEVK 112

Query: 114 HGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLS 173
            G  GSLR R GY+++  ++ Y T G   +Q        + +   +G TAG G+E   L+
Sbjct: 113 QGFEGSLRARVGYDLN-LVMPYLTAGIAGSQIKLNNGLDDESKFRVGWTAGAGLE-AKLT 170

Query: 174 ESLVARLEYRASKYSKVEGFY-----------NTISLGVGMKF 205
           ++++ R+EYR ++Y                    I +G+G KF
Sbjct: 171 DNILGRVEYRYTQYGNKNYDLAGTTVRNKLDTQDIRVGIGYKF 213


>gi|769745|emb|CAA55872.1| immunogenic protein [Brucella abortus]
 gi|89741444|gb|ABD77595.1| 25 kDa outer membrane protein [Brucella abortus]
          Length = 213

 Score =  123 bits (309), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 59/223 (26%), Positives = 96/223 (43%), Gaps = 28/223 (12%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+ L   V VS+  L    +A AAD ++          P +     V  ++ + G Y GL
Sbjct: 1   MRTLKSLVIVSAALLPFSATAFAADAIQEQ--------PPVPAPVEVAPQYSWAGGYTGL 52

Query: 61  SALYNGSF------GEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLA-DNIHSL 113
              Y  +       G     +     FAG+N +   I+YGVEGD  Y+    + D +   
Sbjct: 53  YLGYGWNKAKTSTVGSIKPDDWKAGAFAGWNFQQDQIVYGVEGDAGYSWAKKSKDGLEVK 112

Query: 114 HGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLS 173
            G  GSL  R GY+++  ++ Y T G   +Q        + +   +G TAG G+E   L+
Sbjct: 113 QGFEGSLGARVGYDLNP-VMPYLTAGIAGSQIKLNNGLDDESKFRVGWTAGAGLE-AKLT 170

Query: 174 ESLVARLEYRASKYSKVEGFY-----------NTISLGVGMKF 205
           ++++ R+EYR ++Y                    I +G+G KF
Sbjct: 171 DNILGRVEYRYTQYGNKNYDLAGTTVRNKLDTQDIRVGIGYKF 213


>gi|222085476|ref|YP_002544006.1| outer membrane protein [Agrobacterium radiobacter K84]
 gi|221722924|gb|ACM26080.1| outer membrane protein [Agrobacterium radiobacter K84]
          Length = 210

 Score =  121 bits (302), Expect = 8e-26,   Method: Composition-based stats.
 Identities = 58/219 (26%), Positives = 98/219 (44%), Gaps = 23/219 (10%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+ L   + VS+ A+  F +A AAD V +                  P  ++++G Y G 
Sbjct: 1   MRTLIKTLMVSAFAIGGFNAAYAADAVEQIPQPPVAQE-------AAPAINNWSGFYIGG 53

Query: 61  SALYNGSFGEEAHHNAGGSI--FAGYNVEDSCIMYGVEGDVRYTVPVLA-DNIHSLHGIG 117
           +  +N        +  G     F GYN +   I+YGVE D+ Y       + + + +G+ 
Sbjct: 54  AGDWNKGHFSRNGNGYGFGGEAFTGYNWQQGQIVYGVEADLGYAGIDSTRNGLTAKNGVN 113

Query: 118 GSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLV 177
           GS+R R GY+ +   +LY T G  + Q   +      +  A+G T G G E   ++ ++ 
Sbjct: 114 GSVRGRLGYDFNP-FMLYGTAGLAIGQNKLSDDTSSDSKTAVGYTVGAGAET-FITNNVT 171

Query: 178 ARLEYRASKYSKVEGFYN-----------TISLGVGMKF 205
           ARLEYR + Y K     +           ++ +G+G+KF
Sbjct: 172 ARLEYRYTDYGKKNFDLDSGNFSRGYDEQSVKVGIGVKF 210


>gi|3914820|sp|Q52866|ROPB_RHILV RecName: Full=22 kDa outer membrane protein; Flags: Precursor
 gi|525267|emb|CAA56751.1| outer membrane protein [Rhizobium leguminosarum bv. viciae 248]
          Length = 211

 Score =  117 bits (292), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 56/206 (27%), Positives = 89/206 (43%), Gaps = 11/206 (5%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+ L   +  S  A+A   +AQAAD V +           +           + G Y G 
Sbjct: 1   MRVLIAGLMASVFAIAGVSAAQAADRVDQVPEAPVAQEAPVKPAG------SWEGFYLGG 54

Query: 61  SALYNGSFGEEAHH--NAGGSIFAGYNVEDSCIMYGVEGDVRYTVPV-LADNIHSLHGIG 117
           +  YN        H    GG +F GYN +   I+YGVE D+ Y+     +  + + +G  
Sbjct: 55  AGTYNMGDFGSDRHTYGFGGQVFTGYNWQQGQIVYGVESDLGYSGDDVSSGGVENKYGWN 114

Query: 118 GSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLV 177
           GS+R R GY+++   LLY T G  +     +    + +    G T G GVE   ++ ++ 
Sbjct: 115 GSVRGRVGYDMNP-FLLYGTAGLAIGDVKVSDDTSDESKTNFGYTVGAGVE-AFVTNNIT 172

Query: 178 ARLEYRASKYSKVEGFYNTISLGVGM 203
            RLEYR + Y   +   ++ S   G 
Sbjct: 173 TRLEYRYTDYQSKDYDLDSGSFSRGY 198


>gi|260469600|ref|ZP_05813765.1| OmpA domain protein transmembrane region-containing protein
           [Mesorhizobium opportunistum WSM2075]
 gi|259028626|gb|EEW29937.1| OmpA domain protein transmembrane region-containing protein
           [Mesorhizobium opportunistum WSM2075]
          Length = 217

 Score =  115 bits (287), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 59/213 (27%), Positives = 87/213 (40%), Gaps = 11/213 (5%)

Query: 3   KLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSA 62
           K    + V+    A   +A AAD V+        V      +   P      G       
Sbjct: 6   KFARPLAVALGLFALGGTAYAADVVQEEPPAPAPVAELPVASWAGPYAGINLGYGFSGRT 65

Query: 63  LYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADN-IHSLHGIGGSLR 121
                  E       GS+F GY  +    +YG E ++ Y      DN +HS  G  GSLR
Sbjct: 66  KEKDLGFETDTKGFVGSVFGGYQWQQENFVYGGEAELGYNGVKGDDNGVHSKGGFEGSLR 125

Query: 122 IRGGYEVSDSLLLYATVGPDVAQKYE-TGKAGEITPIAIGGTAGVGVEVGGLSESLVARL 180
            R GY V+  +LLY T G             G  T   +G TAG+G ++  L++++  R+
Sbjct: 126 ARLGYAVTPEILLYGTGGLAGRSLKVEDDTFGSDTATMLGWTAGLGTDI-KLTDNVFGRV 184

Query: 181 EYRASKY--------SKVEGFYNTISLGVGMKF 205
           EYR + +         KV+   N ++ G+GMKF
Sbjct: 185 EYRYTDFGSKSFDNIGKVKATDNRVTFGLGMKF 217


>gi|13476553|ref|NP_108123.1| outer membrane protein [Mesorhizobium loti MAFF303099]
 gi|14027314|dbj|BAB54268.1| outer membrane protein [Mesorhizobium loti MAFF303099]
          Length = 218

 Score =  114 bits (286), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 58/214 (27%), Positives = 86/214 (40%), Gaps = 12/214 (5%)

Query: 3   KLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSA 62
           K    + V+    A   +A AAD V+        V      +   P      G       
Sbjct: 6   KFARPLAVALGLFALGGTAYAADVVQEEPPAPAPVAELPVASWAGPYAGLNVGYGFSGRT 65

Query: 63  LYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADN-IHSLHGIGGSLR 121
                          GS+F GY  +    +YG E ++ Y      DN I+S  G  GSLR
Sbjct: 66  KEKDFDVSTDTKGFVGSVFGGYQWQQENFVYGGEAELGYNGVKGDDNGINSKAGFEGSLR 125

Query: 122 IRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITP--IAIGGTAGVGVEVGGLSESLVAR 179
            R GY V+  +LLY T G              ++     +G TAGVG ++  L++++  R
Sbjct: 126 ARLGYAVTPEILLYGTGGLAGRSLKVEDTVLGVSDRATMLGWTAGVGTDI-KLTDNVFGR 184

Query: 180 LEYRASKY--------SKVEGFYNTISLGVGMKF 205
           +EYR + +         KV+   N ++ GVGMKF
Sbjct: 185 VEYRYTDFGSKSFDGIGKVKATDNRVTFGVGMKF 218


>gi|307944219|ref|ZP_07659560.1| 22 kDa outer membrane protein [Roseibium sp. TrichSKD4]
 gi|307772565|gb|EFO31785.1| 22 kDa outer membrane protein [Roseibium sp. TrichSKD4]
          Length = 242

 Score =  114 bits (285), Expect = 8e-24,   Method: Composition-based stats.
 Identities = 58/232 (25%), Positives = 90/232 (38%), Gaps = 35/232 (15%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M++L  A   +++++A    + AAD  + A        P          R D++G YAG 
Sbjct: 19  MKRLACAAIAATVSVAGLAPSYAADLPQAAPTYDTTYEPAP------SGRFDWSGAYAGG 72

Query: 61  SALYNGSF----------GEEAHHNAGGSIFAGYNVED-SCIMYGVEGDVRYTVPVLAD- 108
           S  +  S            +   +   G +  GYN      I+ GVE D + T       
Sbjct: 73  SLGWVWSGFDTTSSPTGSFDHDTNGFSGGVHGGYNFAITPNIVAGVELDFQMTDLYENTV 132

Query: 109 ----NIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAG 164
               N+ +      S R R GY + D  L+Y T G  +A              A+G TAG
Sbjct: 133 RNGVNVKTSSAWNSSARARLGYAM-DRFLVYGTAGLAIADLSINANGASEDTTALGWTAG 191

Query: 165 VGVEVGGLSESLVARLEYRASKYS-----------KVEGFYNTISLGVGMKF 205
            GVE G +S +L AR+EY    +            + +   +T+  G+  KF
Sbjct: 192 AGVE-GAISNNLTARVEYLYQDFGRESFTLGGSKYRADLDTSTVRFGLSYKF 242


>gi|327193361|gb|EGE60264.1| outer membrane protein [Rhizobium etli CNPAF512]
          Length = 211

 Score =  114 bits (285), Expect = 8e-24,   Method: Composition-based stats.
 Identities = 56/206 (27%), Positives = 90/206 (43%), Gaps = 11/206 (5%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+ L   +  S+ A+A    AQAAD V +           +          ++ G Y G 
Sbjct: 1   MRVLIAGLMASAFAIAGVSVAQAADAVDQVPEAPVAQDAPVKPAG------NWEGFYLGG 54

Query: 61  SALYNGSFGEEAHH--NAGGSIFAGYNVEDSCIMYGVEGDVRYTVPV-LADNIHSLHGIG 117
           +  YN        H    GG +F GYN +   I+YGVE D+ Y+     +  + + +G  
Sbjct: 55  AGTYNMGDFGSDRHTYGFGGQVFTGYNWQQGQIVYGVESDLGYSGDDVSSGGVKNKYGWN 114

Query: 118 GSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLV 177
           GS+R R GY+++   LLY T G  +     +    + +    G T G GVE   ++ ++ 
Sbjct: 115 GSVRGRVGYDMNP-FLLYGTAGLALGNIKVSDGTSDESKTNYGYTVGAGVE-AFVTNNIT 172

Query: 178 ARLEYRASKYSKVEGFYNTISLGVGM 203
            RLEYR + Y   +   ++ S   G 
Sbjct: 173 TRLEYRYTDYQSKDYDLDSGSFSRGY 198


>gi|190891163|ref|YP_001977705.1| outer membrane protein [Rhizobium etli CIAT 652]
 gi|190696442|gb|ACE90527.1| outer membrane protein [Rhizobium etli CIAT 652]
          Length = 211

 Score =  113 bits (283), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 57/206 (27%), Positives = 91/206 (44%), Gaps = 11/206 (5%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+ L   +  S+ A+A    AQAAD V +           +          ++ G Y G 
Sbjct: 1   MRVLIAGLMASAFAIAGVSVAQAADAVDQVPEAPVAQDAPVKPAG------NWEGFYLGG 54

Query: 61  SALYNGSFGEEAHH--NAGGSIFAGYNVEDSCIMYGVEGDVRYTVPV-LADNIHSLHGIG 117
           +  YN        H    GG +F GYN +   I+YGVE D+ Y+     +  + + +G  
Sbjct: 55  AGTYNMGDFGSDRHTYGFGGQVFTGYNWQQGQIVYGVESDLGYSGDDVSSGGVKNKYGWN 114

Query: 118 GSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLV 177
           GS+R R GY+++   LLY T G  +     +    + +  A G T G GVE   ++ ++ 
Sbjct: 115 GSVRGRVGYDMNP-FLLYGTAGLALGNIKVSDGTSDESKTAYGYTVGAGVE-AFVTNNIT 172

Query: 178 ARLEYRASKYSKVEGFYNTISLGVGM 203
            RLEYR + Y   +   ++ S   G 
Sbjct: 173 TRLEYRYTDYQSKDYDLDSGSFSRGY 198


>gi|209548422|ref|YP_002280339.1| porin [Rhizobium leguminosarum bv. trifolii WSM2304]
 gi|209534178|gb|ACI54113.1| porin [Rhizobium leguminosarum bv. trifolii WSM2304]
          Length = 204

 Score =  111 bits (278), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 50/213 (23%), Positives = 80/213 (37%), Gaps = 27/213 (12%)

Query: 7   AVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNG 66
            +  + LAL++   A AAD                     +   ++++G Y G    Y+ 
Sbjct: 5   LIACAVLALSAAVPAVAADLTYETP---------APAAEQISSAYNWSGFYLGGQGGYSW 55

Query: 67  S-----FGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGSLR 121
           S       +E        + AGYN +   I+YG+E D  Y       N  +      S R
Sbjct: 56  SQTKILGSDENIDGGTAGLHAGYNFQSGNIVYGIENDFNYN---FKKNDDANLEWDASGR 112

Query: 122 IRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLE 181
            R GY ++ +L            K +   AG+   I IG TAG G+E   +++ ++ R E
Sbjct: 113 ARVGYALNRTLFFATAGVAAGGGKVDIPTAGKKDGILIGWTAGGGIE-HAVTDHILVRGE 171

Query: 182 YRASKY---------SKVEGFYNTISLGVGMKF 205
           YR S +           V    + +  G   KF
Sbjct: 172 YRHSDFSNKDFGSAIGDVGAKQDKVLFGTSYKF 204


>gi|319784400|ref|YP_004143876.1| porin [Mesorhizobium ciceri biovar biserrulae WSM1271]
 gi|317170288|gb|ADV13826.1| porin [Mesorhizobium ciceri biovar biserrulae WSM1271]
          Length = 220

 Score =  111 bits (278), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 55/216 (25%), Positives = 84/216 (38%), Gaps = 14/216 (6%)

Query: 3   KLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSA 62
           K    + V+    A   +A AAD V         +      +   P      G       
Sbjct: 6   KFARPLAVALGLFALSGTAYAADVVSEEPPAPAPIAELPVASWAGPYAGLNVGYGFSGHT 65

Query: 63  ---LYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLAD-NIHSLHGIGG 118
                     +       GS+F GY  +    +YG E ++ Y      D  ++S  G  G
Sbjct: 66  KEKDLGVDNVDVGTKGFVGSVFGGYQWQQENFVYGAEAELGYNGVKGDDSGVNSKAGFEG 125

Query: 119 SLRIRGGYEVSDSLLLYATVGPDVAQKYE-TGKAGEITPIAIGGTAGVGVEVGGLSESLV 177
           SLR R GY V+  +LLY T G             G      +G TAG+G ++  L++++ 
Sbjct: 126 SLRARLGYAVTPEILLYGTGGLAGRSLKVEDDVYGSDRATLLGWTAGLGTDI-KLTDNVF 184

Query: 178 ARLEYRASKY--------SKVEGFYNTISLGVGMKF 205
            R+EYR + +         KV+   N ++ GVGMKF
Sbjct: 185 GRVEYRYTDFGSKSFDGIGKVKATDNRVTFGVGMKF 220


>gi|116251075|ref|YP_766913.1| outer membrane protein [Rhizobium leguminosarum bv. viciae 3841]
 gi|115255723|emb|CAK06804.1| putative outer membrane protein [Rhizobium leguminosarum bv. viciae
           3841]
 gi|220979415|gb|ACL97989.1| outer membrane protein B2 [Rhizobium leguminosarum bv. viciae]
          Length = 205

 Score =  111 bits (277), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 51/213 (23%), Positives = 82/213 (38%), Gaps = 26/213 (12%)

Query: 7   AVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNG 66
            V  ++L L+    A AAD             P   +   V   +D++G Y G    Y+ 
Sbjct: 5   LVACAALTLSVAVPAVAADLTYE--------TPPAPSAGQVSSAYDWSGFYLGAQGGYSW 56

Query: 67  S-----FGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGSLR 121
           S       ++   +    + AGYN +   I+YG+E D  Y       N ++      S R
Sbjct: 57  SQATILGSDQDIDSGTSGLHAGYNFQSGNIVYGIENDFNYN---FEKNDNANLEWDASGR 113

Query: 122 IRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLE 181
            R GY    +L            K +   AG+   I IG TAG G+E   ++++++ R E
Sbjct: 114 ARVGYAWDRTLFFATAGVAAGGGKVDIPAAGKKDGILIGWTAGGGIE-HAVTDNILVRAE 172

Query: 182 YRASKYSKVEGF---------YNTISLGVGMKF 205
           YR S +   +            + +  G   KF
Sbjct: 173 YRHSDFGNKDFGSTIGEVGATQDKVLFGTSYKF 205


>gi|306841014|ref|ZP_07473744.1| outer membrane protein Omp31 [Brucella sp. BO2]
 gi|306846349|ref|ZP_07478900.1| outer membrane protein Omp31 [Brucella sp. BO1]
 gi|306273192|gb|EFM55083.1| outer membrane protein Omp31 [Brucella sp. BO1]
 gi|306288964|gb|EFM60252.1| outer membrane protein Omp31 [Brucella sp. BO2]
          Length = 239

 Score =  110 bits (275), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 43/239 (17%), Positives = 76/239 (31%), Gaps = 42/239 (17%)

Query: 7   AVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGP---------- 56
           +V ++S A+    SA AAD +               T  Y+ I   + G           
Sbjct: 3   SVLLASFAMLFASSAMAADAIVAEPAPVAVDT-FSWTGGYIGINAGYAGGKFKHPFSVAG 61

Query: 57  ----YAGLSALYNGSFGEEAHHNAGGSIFAGYNVEDSC-IMYGVEGDVRYTVPVLA---- 107
                            +       G + AGYN +     + G E D + +         
Sbjct: 62  LPTAGMNEEGGALSGSLDVTSSGFVGGVQAGYNWQLDNGFVLGAEADFQGSTVKGDISAH 121

Query: 108 -----DNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYET----GKAGEITPIA 158
                 N  +     G++R R GY  ++ LL+Y T G    +   +          +   
Sbjct: 122 LDDLDGNAETKVEWFGTVRARLGYTATERLLVYGTGGLAYGKVKSSLGIEDWGVSSSKTK 181

Query: 159 IGGTAGVGVEVGGLSESLVARLEYRASKYSKV------------EGFYNTISLGVGMKF 205
            G T G G E   ++ +   + EY  +   K             +  ++T+ +G+  KF
Sbjct: 182 AGWTVGAGAEY-AINNNWTLKSEYLYTDLGKHDLINVNELSLKNDVKFHTVRVGLNYKF 239


>gi|241203671|ref|YP_002974767.1| hypothetical protein Rleg_0932 [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240857561|gb|ACS55228.1| conserved hypothetical protein [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 205

 Score =  110 bits (275), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 52/213 (24%), Positives = 82/213 (38%), Gaps = 26/213 (12%)

Query: 7   AVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNG 66
            V  + LAL+    A AAD             P   +   V   +D++G Y G    Y+ 
Sbjct: 5   LVACAVLALSVAVPAVAADLTYE--------TPPAPSAGEVSSAYDWSGFYLGAQGGYSW 56

Query: 67  S-----FGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGSLR 121
           S       ++   +    + AGYN +   I+YG+E D  Y       N ++      S R
Sbjct: 57  SQAKILGSDQDIDSGTSGLHAGYNFQSGNIVYGIENDFNYN---FEKNDNANLEWDASGR 113

Query: 122 IRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLE 181
            R GY    +L            K +   AG+   I IG TAG G+E   ++++++ R E
Sbjct: 114 ARVGYAWDRTLFFATAGVAAGGGKVDISAAGKKDGILIGWTAGGGIE-HAVTDNILVRGE 172

Query: 182 YRASKYSKVEGF---------YNTISLGVGMKF 205
           YR S +   +            + +  G   KF
Sbjct: 173 YRHSDFGNKDFGSTIGDVGATQDKVLFGTSYKF 205


>gi|15964926|ref|NP_385279.1| outer membrane protein [Sinorhizobium meliloti 1021]
 gi|307300997|ref|ZP_07580766.1| porin [Sinorhizobium meliloti BL225C]
 gi|15074105|emb|CAC45752.1| Probable outer membrane protein [Sinorhizobium meliloti 1021]
 gi|306903952|gb|EFN34538.1| porin [Sinorhizobium meliloti BL225C]
          Length = 212

 Score =  109 bits (271), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 58/217 (26%), Positives = 95/217 (43%), Gaps = 17/217 (7%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+ L   +  S++AL +F +A AAD V              A   +      + G     
Sbjct: 1   MRTLTTTLMASAMALVAFQAAHAADVVDEVPAAPAAEYTEPAVRNWSGA---YVGGTIDW 57

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTV-PVLADNIHSLHGIGGS 119
                 + G       GG ++ GYNV+D  ++YG E DV YT     +       G+ GS
Sbjct: 58  HHGEADATGNNKSVGFGGGLYGGYNVQDGQMVYGGEADVNYTGNDSRSSGRRVKQGVNGS 117

Query: 120 LRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVAR 179
           +R R G +++  +L+Y T G  +     +  AG      +G TAGVG E   +++++ AR
Sbjct: 118 VRGRVGVDLNP-VLVYGTAGVALGNAKLSTPAGSDDKTLVGWTAGVGAET-FVTDNITAR 175

Query: 180 LEYRASKYSKVEG-----------FYNTISLGVGMKF 205
            EYR + Y   +              +++ LG+G+KF
Sbjct: 176 AEYRYTDYGSKDFRAGGSTISSGYDEHSVKLGMGVKF 212


>gi|153011627|ref|YP_001372841.1| porin [Ochrobactrum anthropi ATCC 49188]
 gi|151563515|gb|ABS17012.1| porin [Ochrobactrum anthropi ATCC 49188]
          Length = 228

 Score =  108 bits (270), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 53/239 (22%), Positives = 84/239 (35%), Gaps = 48/239 (20%)

Query: 3   KLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSA 62
           K+   +  S++AL +   A+AAD +           P             + G Y G   
Sbjct: 2   KIKSLLLASTVALIATTGAKAADAIVEEPAPVIVAEP----------IFSWTGAYIGGQI 51

Query: 63  LYNGSFGEEAH------HNAGGSIFAGYNVEDS-CIMYGVEGDVRYTVPVLA-------- 107
            Y     E             G ++AGYN +     + GV+GD+ Y              
Sbjct: 52  GYGWGKSEFEDAFRVKPDGFLGGLYAGYNFDVGNNFILGVDGDITYNNLKDNYSATDGDI 111

Query: 108 -DNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGE--------ITPIA 158
             ++ S     G++R R G    D  + Y   G        T  A +         +   
Sbjct: 112 AGDLESKLRWSGAVRARAGVAF-DRFMPYIAGGVAFGSVKNTLSATDGVDEISVSQSKTY 170

Query: 159 IGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFY------------NTISLGVGMKF 205
            G TAG GV+    +++L+ RLEYR + Y K +  +            + + LGV  KF
Sbjct: 171 TGWTAGAGVDYAA-TDNLILRLEYRYTDYGKKDFDFGTDVSVEDKFKTHDVRLGVAYKF 228


>gi|307317731|ref|ZP_07597169.1| porin [Sinorhizobium meliloti AK83]
 gi|306896493|gb|EFN27241.1| porin [Sinorhizobium meliloti AK83]
          Length = 212

 Score =  108 bits (269), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 57/217 (26%), Positives = 95/217 (43%), Gaps = 17/217 (7%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+ L   +  S++AL +F +A AAD V              A   +      + G     
Sbjct: 1   MRTLTTTLMASAMALVAFQAAHAADVVDEVPAAPAAEYTEPAVRNWSGA---YVGGTIDW 57

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTV-PVLADNIHSLHGIGGS 119
                 + G       GG ++ GY+V+D  ++YG E DV YT     +       G+ GS
Sbjct: 58  HHGEADATGNNKSVGFGGGLYGGYDVQDGQMVYGGEADVNYTGNDSRSSGRRVKQGVNGS 117

Query: 120 LRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVAR 179
           +R R G +++  +L+Y T G  +     +  AG      +G TAGVG E   +++++ AR
Sbjct: 118 VRGRVGVDLNP-VLVYGTAGVALGNAKLSTPAGSDDKTLVGWTAGVGAET-FVTDNITAR 175

Query: 180 LEYRASKYSKVEG-----------FYNTISLGVGMKF 205
            EYR + Y   +              +++ LG+G+KF
Sbjct: 176 AEYRYTDYGSKDFRAGGSTISSGYDEHSVKLGMGVKF 212


>gi|158425585|ref|YP_001526877.1| outer membrane protein Omp31 precursor [Azorhizobium caulinodans
           ORS 571]
 gi|158332474|dbj|BAF89959.1| outer membrane protein Omp31 precursor [Azorhizobium caulinodans
           ORS 571]
          Length = 212

 Score =  107 bits (268), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 54/215 (25%), Positives = 79/215 (36%), Gaps = 14/215 (6%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+ + +   ++SL  A+   A AAD  R A       V       +       N  YA  
Sbjct: 2   MKSVLVTGALASLLFAA--PAMAADLSRPAPAMPASAVSAPPVFSWTGFYIGANTGYAWG 59

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVED-SCIMYGVEGDVRYTVPVLADN-IHSLHGIGG 118
           S   +            G    GYN +  + ++ G+E DV+       +  + S     G
Sbjct: 60  SGKGSADALGLDPDGWFGGGQVGYNYQFQNNMLVGLEADVQGGGISAGNGPVSSKLESFG 119

Query: 119 SLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVA 178
           ++R R GY V D +L Y T G        T      +    G T G GVE   L+ +  A
Sbjct: 120 TVRARLGYAV-DRVLPYVTGGFAWGNNKITDFGTSQSQTLTGWTVGGGVEY-ALTNNWTA 177

Query: 179 RLEYRASKYSKVE--------GFYNTISLGVGMKF 205
           R EY  +   K +           +T  LGV  KF
Sbjct: 178 RAEYLYTDLGKADYKALGEAGVAASTARLGVNYKF 212


>gi|163844591|ref|YP_001622246.1| hypothetical protein BSUIS_B0425 [Brucella suis ATCC 23445]
 gi|16611654|gb|AAL27287.1|AF366064_1 outer membrane protein Omp31 [Brucella suis ATCC 23445]
 gi|163675314|gb|ABY39424.1| Hypothetical protein, conserved [Brucella suis ATCC 23445]
          Length = 240

 Score =  107 bits (266), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 44/241 (18%), Positives = 81/241 (33%), Gaps = 45/241 (18%)

Query: 7   AVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNG 66
           +V ++S+A     SA AAD V             + T  +       N  YAG    +  
Sbjct: 3   SVILASIAAMFATSAMAADVVVSEPSAPTAA--PVDTFSWTGGYIGINAGYAGGKFKHPF 60

Query: 67  SFGEEAH------------HNAGGSIFAGYNVEDSC-IMYGVEGDVRYTVPVLADNI--- 110
           S  ++                  G + AGYN +    ++ G E D + +    + +    
Sbjct: 61  SSFDKEDIEQVSGSLDVTAGGFVGGVQAGYNWQLDNGVVLGAETDFQGSSVTGSISAGAS 120

Query: 111 ------HSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYE--------TGKAGEITP 156
                  +     G++R R GY  ++ L++Y T G    +           +        
Sbjct: 121 GLEGKAETKVEWFGTVRARLGYTATERLMVYGTGGLAYGKVKSAFNLGDDASALHTWPDK 180

Query: 157 IAIGGTAGVGVEVGGLSESLVARLEYRASKYSK------------VEGFYNTISLGVGMK 204
              G T G G E   ++ +   + EY  +   K             +  ++T+ +G+  K
Sbjct: 181 TKAGWTLGAGAEY-AINNNWTLKSEYLYTDLGKRNLVDVDNSFLESKVNFHTVRVGLNYK 239

Query: 205 F 205
           F
Sbjct: 240 F 240


>gi|150396008|ref|YP_001326475.1| porin [Sinorhizobium medicae WSM419]
 gi|150027523|gb|ABR59640.1| porin [Sinorhizobium medicae WSM419]
          Length = 212

 Score =  107 bits (266), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 58/217 (26%), Positives = 93/217 (42%), Gaps = 17/217 (7%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+ L   +  S++AL +F +A AAD V              A   +      + G     
Sbjct: 1   MRMLTTTLMASAMALVAFQAAHAADVVDEIPAAPAAEYTEPAVRNWSGA---YVGGTIDW 57

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVL-ADNIHSLHGIGGS 119
                 + G       GG ++ GYNV+D  ++YG E D+ YT     +       G+ GS
Sbjct: 58  HHGEADATGNNKSVGTGGGLYGGYNVQDGQMVYGGEADINYTGNDSHSSGRRVQQGLNGS 117

Query: 120 LRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVAR 179
           +R R G +V+  +L+Y T G  +        AG      +G TAGVG E   +++++ AR
Sbjct: 118 VRARVGVDVNP-VLVYGTAGVALGNAELKTPAGSDDKTLVGWTAGVGAET-FVTDNITAR 175

Query: 180 LEYRASKYSKVEG-----------FYNTISLGVGMKF 205
            EYR + Y   +              + + LG+G+KF
Sbjct: 176 AEYRYTDYGSKDFRTGGTTISSGYDEHAVKLGMGVKF 212


>gi|148558438|ref|YP_001257410.1| outer membrane protein Omp31 [Brucella ovis ATCC 25840]
 gi|16611666|gb|AAL27291.1|AF366068_1 outer membrane protein Omp31 [Brucella ovis]
 gi|16611669|gb|AAL27292.1|AF366069_1 outer membrane protein Omp31 [Brucella ovis]
 gi|16611672|gb|AAL27293.1|AF366070_1 outer membrane protein Omp31 [Brucella ovis]
 gi|16611675|gb|AAL27294.1|AF366071_1 outer membrane protein Omp31 [Brucella ovis]
 gi|16611678|gb|AAL27295.1|AF366072_1 outer membrane protein Omp31 [Brucella ovis]
 gi|148369723|gb|ABQ62595.1| outer membrane protein Omp31 [Brucella ovis ATCC 25840]
          Length = 240

 Score =  107 bits (266), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 45/241 (18%), Positives = 79/241 (32%), Gaps = 45/241 (18%)

Query: 7   AVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNG 66
           +V ++S+A     SA AAD V             + T  +       N  YAG    +  
Sbjct: 3   SVILASIAAMFATSAMAADVVVSEPSAPTAA--PVDTFSWTGGYIGINAGYAGGKFKHPF 60

Query: 67  SFGEEAHH------------NAGGSIFAGYNVEDSC-IMYGVEGDVRYTVPVLA------ 107
           S  ++                  G + AGYN +    ++ G E D +      +      
Sbjct: 61  SSFDKEDGEHVSGSPDVTAGGFVGGVQAGYNWQLDNGVVLGAETDFQGLSVTGSISAGAS 120

Query: 108 ---DNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGK--------AGEITP 156
               N  +     G++R R GY  ++ L++Y T G    +                    
Sbjct: 121 SLEGNAETKVEWFGTVRARLGYTATERLMVYGTGGLAYGKVKSAFNLGDDAPALHTWSDK 180

Query: 157 IAIGGTAGVGVEVGGLSESLVARLEYRASKYSK------------VEGFYNTISLGVGMK 204
              G T G G E   ++ +   + EY  +   K             +  ++T+ +G+  K
Sbjct: 181 TKAGWTLGAGAEY-AINNNWTLKSEYLYTDLGKRNLVDVDNSFLESKVNFHTVRVGLNYK 239

Query: 205 F 205
           F
Sbjct: 240 F 240


>gi|256111680|ref|ZP_05452664.1| outer membrane protein Omp31 precursor [Brucella melitensis bv. 3
           str. Ether]
 gi|265993151|ref|ZP_06105708.1| outer membrane protein Omp31 [Brucella melitensis bv. 3 str. Ether]
 gi|16611648|gb|AAL27285.1|AF366062_1 outer membrane protein Omp31 [Brucella melitensis]
 gi|262764021|gb|EEZ10053.1| outer membrane protein Omp31 [Brucella melitensis bv. 3 str. Ether]
          Length = 240

 Score =  107 bits (266), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 45/241 (18%), Positives = 82/241 (34%), Gaps = 45/241 (18%)

Query: 7   AVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNG 66
           +V ++S+A     SA AAD V             + T  +       N  YAG    +  
Sbjct: 3   SVILASIAAMFATSAMAADVVVSEPSAPTAA--PVDTFSWTGGYIGINAGYAGGKFKHPF 60

Query: 67  SFGEEAHH------------NAGGSIFAGYNVEDSC-IMYGVEGDVRYTVPVLADNI--- 110
           S  ++  +               G + AGYN +    ++ G E D + +    + +    
Sbjct: 61  SSFDKEDNEQVSGSLDVTAGGFVGGVQAGYNWQLDNGVVLGAETDFQGSSVTGSISAGAS 120

Query: 111 ------HSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAG--------EITP 156
                  +     G++R R GY  ++ L++Y T G    +       G            
Sbjct: 121 GLEGKAETKVEWFGTVRARLGYTATERLMVYGTGGLAYGKVKSAFNLGDDASALHMWSDK 180

Query: 157 IAIGGTAGVGVEVGGLSESLVARLEYRASKYSK------------VEGFYNTISLGVGMK 204
              G T G G E   ++ +   + EY  +   K             +  ++T+ +G+  K
Sbjct: 181 TKAGWTLGAGAEY-AINNNWTLKSEYLYTDLGKRNLVDVDNSFLESKVNFHTVRVGLNYK 239

Query: 205 F 205
           F
Sbjct: 240 F 240


>gi|306845687|ref|ZP_07478256.1| outer membrane protein Omp31 [Brucella sp. BO1]
 gi|206596728|emb|CAQ68394.1| outer membrane protein 31 [Brucella sp. BO1]
 gi|306274008|gb|EFM55835.1| outer membrane protein Omp31 [Brucella sp. BO1]
          Length = 240

 Score =  107 bits (266), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 44/241 (18%), Positives = 80/241 (33%), Gaps = 45/241 (18%)

Query: 7   AVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNG 66
           +V ++S+A     SA AAD V             + T  +       N  YAG    +  
Sbjct: 3   SVILASIAAMFATSAMAADVVVSEPSAPTAA--PVDTFSWTGGYIGINAGYAGGKFKHPF 60

Query: 67  SFGEEAHH------------NAGGSIFAGYNVEDSC-IMYGVEGDVRYTVPVLADNIH-- 111
           S  +   +               G + AGYN +    ++ G E D + +    + +    
Sbjct: 61  SAFDTDDNERVSGSLNITSGGFVGGVQAGYNWQFDNGVVLGAETDFQGSSVTGSISADAG 120

Query: 112 -------SLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKY--------ETGKAGEITP 156
                  +     G++R R GY  ++ L++Y T G    +           +        
Sbjct: 121 GLEGKAETKVEWFGTVRARLGYTATERLMVYGTGGLAYGKVKSAFNLGDDVSALHTWSDK 180

Query: 157 IAIGGTAGVGVEVGGLSESLVARLEYRASKYSK------------VEGFYNTISLGVGMK 204
              G T G G E   ++     + EY  +   K             +  ++T+ +G+  K
Sbjct: 181 TKAGWTLGAGAEY-AINNHWTLKSEYLYTDLGKRNLINVDDSFLESKVNFHTVRVGLNYK 239

Query: 205 F 205
           F
Sbjct: 240 F 240


>gi|23500173|ref|NP_699613.1| outer membrane protein [Brucella suis 1330]
 gi|225628865|ref|ZP_03786899.1| Porin subfamily protein [Brucella ceti str. Cudo]
 gi|225686232|ref|YP_002734204.1| outer membrane protein Omp31 [Brucella melitensis ATCC 23457]
 gi|254699679|ref|ZP_05161507.1| outer membrane protein Omp31 precursor [Brucella suis bv. 5 str.
           513]
 gi|254702817|ref|ZP_05164645.1| outer membrane protein Omp31 precursor [Brucella suis bv. 3 str.
           686]
 gi|254711636|ref|ZP_05173447.1| outer membrane protein Omp31 precursor [Brucella pinnipedialis
           B2/94]
 gi|254712249|ref|ZP_05174060.1| outer membrane protein Omp31 precursor [Brucella ceti M644/93/1]
 gi|254715320|ref|ZP_05177131.1| outer membrane protein Omp31 precursor [Brucella ceti M13/05/1]
 gi|256015206|ref|YP_003105215.1| outer membrane protein, 31 kDa [Brucella microti CCM 4915]
 gi|256029730|ref|ZP_05443344.1| outer membrane protein Omp31 precursor [Brucella pinnipedialis
           M292/94/1]
 gi|256043319|ref|ZP_05446254.1| outer membrane protein Omp31 precursor [Brucella melitensis bv. 1
           str. Rev.1]
 gi|256059364|ref|ZP_05449566.1| outer membrane protein Omp31 precursor [Brucella neotomae 5K33]
 gi|256157882|ref|ZP_05455800.1| outer membrane protein Omp31 precursor [Brucella ceti M490/95/1]
 gi|256253156|ref|ZP_05458692.1| outer membrane protein Omp31 precursor [Brucella ceti B1/94]
 gi|256262636|ref|ZP_05465168.1| outer membrane protein Omp31 [Brucella melitensis bv. 2 str. 63/9]
 gi|260167181|ref|ZP_05753992.1| outer membrane protein, 31 kDa [Brucella sp. F5/99]
 gi|260564527|ref|ZP_05835012.1| outer membrane protein 31 [Brucella melitensis bv. 1 str. 16M]
 gi|261217050|ref|ZP_05931331.1| outer membrane immunogenic protein [Brucella ceti M13/05/1]
 gi|261220262|ref|ZP_05934543.1| outer-membrane immunogenic protein [Brucella ceti B1/94]
 gi|261319260|ref|ZP_05958457.1| outer-membrane immunogenic protein [Brucella pinnipedialis B2/94]
 gi|261319920|ref|ZP_05959117.1| outer-membrane immunogenic protein [Brucella ceti M644/93/1]
 gi|261323324|ref|ZP_05962521.1| outer-membrane immunogenic protein [Brucella neotomae 5K33]
 gi|261750144|ref|ZP_05993853.1| outer-membrane immunogenic protein [Brucella suis bv. 5 str. 513]
 gi|261753417|ref|ZP_05997126.1| outer-membrane immunogenic protein [Brucella suis bv. 3 str. 686]
 gi|261756585|ref|ZP_06000294.1| outer-membrane immunogenic protein [Brucella sp. F5/99]
 gi|265986741|ref|ZP_06099298.1| outer-membrane immunogenic protein [Brucella pinnipedialis
           M292/94/1]
 gi|265989742|ref|ZP_06102299.1| outer-membrane immunogenic protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|265996391|ref|ZP_06108948.1| outer-membrane immunogenic protein [Brucella ceti M490/95/1]
 gi|61229373|sp|P0A3U4|OM31_BRUME RecName: Full=31 kDa outer-membrane immunogenic protein; Flags:
           Precursor
 gi|61229374|sp|P0A3U5|OM31_BRUSU RecName: Full=31 kDa outer-membrane immunogenic protein; Flags:
           Precursor
 gi|16611645|gb|AAL27284.1|AF366061_1 outer membrane protein Omp31 [Brucella melitensis]
 gi|16611651|gb|AAL27286.1|AF366063_1 outer membrane protein Omp31 [Brucella suis 1330]
 gi|16611657|gb|AAL27288.1|AF366065_1 outer membrane protein Omp31 [Brucella suis]
 gi|16611663|gb|AAL27290.1|AF366067_1 outer membrane protein Omp31 [Brucella suis]
 gi|16611684|gb|AAL27297.1|AF366074_1 outer membrane protein Omp31 [Brucella neotomae]
 gi|1457933|gb|AAB36693.1| outer membrane protein [Brucella melitensis]
 gi|23463773|gb|AAN33618.1| outer membrane protein Omp31 [Brucella suis 1330]
 gi|46251186|gb|AAS84564.1| Omp31 [Brucella ceti]
 gi|46251188|gb|AAS84565.1| Omp31 [Brucella pinnipedialis]
 gi|46251190|gb|AAS84566.1| Omp31 [Brucella ceti]
 gi|46251192|gb|AAS84567.1| Omp31 [Brucella ceti]
 gi|157310315|emb|CAN43870.1| outer membrane protein 31 [Brucella microti CCM 4915]
 gi|157310317|emb|CAN43872.1| outer membrane protein 31 [Brucella microti]
 gi|225616711|gb|EEH13759.1| Porin subfamily protein [Brucella ceti str. Cudo]
 gi|225642337|gb|ACO02250.1| outer membrane protein Omp31 precursor [Brucella melitensis ATCC
           23457]
 gi|226433917|gb|ACO56077.1| Omp31 [Brucella melitensis]
 gi|240265888|gb|ACS50328.1| Omp31 [Brucella melitensis]
 gi|255997866|gb|ACU49553.1| outer membrane protein, 31 kDa [Brucella microti CCM 4915]
 gi|260152170|gb|EEW87263.1| outer membrane protein 31 [Brucella melitensis bv. 1 str. 16M]
 gi|260918846|gb|EEX85499.1| outer-membrane immunogenic protein [Brucella ceti B1/94]
 gi|260922139|gb|EEX88707.1| outer membrane immunogenic protein [Brucella ceti M13/05/1]
 gi|261292610|gb|EEX96106.1| outer-membrane immunogenic protein [Brucella ceti M644/93/1]
 gi|261298483|gb|EEY01980.1| outer-membrane immunogenic protein [Brucella pinnipedialis B2/94]
 gi|261299304|gb|EEY02801.1| outer-membrane immunogenic protein [Brucella neotomae 5K33]
 gi|261736569|gb|EEY24565.1| outer-membrane immunogenic protein [Brucella sp. F5/99]
 gi|261739897|gb|EEY27823.1| outer-membrane immunogenic protein [Brucella suis bv. 5 str. 513]
 gi|261743170|gb|EEY31096.1| outer-membrane immunogenic protein [Brucella suis bv. 3 str. 686]
 gi|262550688|gb|EEZ06849.1| outer-membrane immunogenic protein [Brucella ceti M490/95/1]
 gi|263000411|gb|EEZ13101.1| outer-membrane immunogenic protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|263092421|gb|EEZ16674.1| outer membrane protein Omp31 [Brucella melitensis bv. 2 str. 63/9]
 gi|264658938|gb|EEZ29199.1| outer-membrane immunogenic protein [Brucella pinnipedialis
           M292/94/1]
          Length = 240

 Score =  106 bits (265), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 44/241 (18%), Positives = 82/241 (34%), Gaps = 45/241 (18%)

Query: 7   AVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNG 66
           +V ++S+A     SA AAD V             + T  +       N  YAG    +  
Sbjct: 3   SVILASIAAMFATSAMAADVVVSEPSAPTAA--PVDTFSWTGGYIGINAGYAGGKFKHPF 60

Query: 67  SFGEEAHH------------NAGGSIFAGYNVEDSC-IMYGVEGDVRYTVPVLADNI--- 110
           S  ++  +               G + AGYN +    ++ G E D + +    + +    
Sbjct: 61  SSFDKEDNEQVSGSLDVTAGGFVGGVQAGYNWQLDNGVVLGAETDFQGSSVTGSISAGAS 120

Query: 111 ------HSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYE--------TGKAGEITP 156
                  +     G++R R GY  ++ L++Y T G    +           +        
Sbjct: 121 GLEGKAETKVEWFGTVRARLGYTATERLMVYGTGGLAYGKVKSAFNLGDDASALHTWSDK 180

Query: 157 IAIGGTAGVGVEVGGLSESLVARLEYRASKYSK------------VEGFYNTISLGVGMK 204
              G T G G E   ++ +   + EY  +   K             +  ++T+ +G+  K
Sbjct: 181 TKAGWTLGAGAEY-AINNNWTLKSEYLYTDLGKRNLVDVDNSFLESKVNFHTVRVGLNYK 239

Query: 205 F 205
           F
Sbjct: 240 F 240


>gi|161620493|ref|YP_001594379.1| porin [Brucella canis ATCC 23365]
 gi|16611681|gb|AAL27296.1|AF366073_1 outer membrane protein Omp31 [Brucella canis]
 gi|161337304|gb|ABX63608.1| porin [Brucella canis ATCC 23365]
          Length = 240

 Score =  106 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 44/241 (18%), Positives = 80/241 (33%), Gaps = 45/241 (18%)

Query: 7   AVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNG 66
           +V ++S+A     SA AAD V             + T  +       N  YAG    +  
Sbjct: 3   SVILASIAAMFATSAMAADVVVSEPSAPTAA--PVDTFSWTGGYIGINAGYAGGKFKHPF 60

Query: 67  SFGEEAHH------------NAGGSIFAGYNVEDSC-IMYGVEGDVRYTVPVL------- 106
           S  ++  +               G + AGYN +    ++ G E D + +           
Sbjct: 61  SSFDKEDNEQVSGSLDVTAGGFVGGVQAGYNWQLDNGVVLGAETDFQGSSVTGPISAGAS 120

Query: 107 --ADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYE--------TGKAGEITP 156
                  +     G++R R GY  ++ L++Y T G    +           +        
Sbjct: 121 GLEGKAETKVEWFGTVRARLGYTATERLMVYGTGGLAYGKVKSAFNLGDDASALHTWSDK 180

Query: 157 IAIGGTAGVGVEVGGLSESLVARLEYRASKYSK------------VEGFYNTISLGVGMK 204
              G T G G E   ++ +   + EY  +   K             +  ++T+ +G+  K
Sbjct: 181 TKAGWTLGAGAEY-AINNNWTLKSEYLYTDLGKRNLVDVDNSFLESKVNFHTVRVGLNYK 239

Query: 205 F 205
           F
Sbjct: 240 F 240


>gi|256682107|gb|ACV07678.1| OMP31 [Brucella melitensis]
          Length = 240

 Score =  106 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 43/241 (17%), Positives = 82/241 (34%), Gaps = 45/241 (18%)

Query: 7   AVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNG 66
           +V ++S+A     SA AAD V             + T  +       N  YAG    +  
Sbjct: 3   SVILASIAAMFATSAMAADVVVSEPSAPTAA--PVDTFSWTGGYIGINAGYAGGKFKHPF 60

Query: 67  SFGEEAHH------------NAGGSIFAGYNVEDSC-IMYGVEGDVRYTVPVLADNI--- 110
           S  ++  +               G + AGYN +    ++ G E D + +    + +    
Sbjct: 61  SSFDKEDNEQVSGSLDVTAGGFVGGVQAGYNWQLDNGVVLGAETDFQGSSVTGSISAGAS 120

Query: 111 ------HSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYE--------TGKAGEITP 156
                  +     G++R R GY  ++ +++Y T G    +           +        
Sbjct: 121 GLEGKAETKVEWFGTVRARLGYTATERVMVYGTGGLAYGKVKSAFNLGDDASALHTWSDK 180

Query: 157 IAIGGTAGVGVEVGGLSESLVARLEYRASKYSK------------VEGFYNTISLGVGMK 204
              G T G G E   ++ +   + EY  +   K             +  ++T+ +G+  K
Sbjct: 181 TKAGWTLGAGAEY-AINNNWTLKSEYLYTDLGKRNLVDVDNSFLESKVNFHTVRVGLNYK 239

Query: 205 F 205
           F
Sbjct: 240 F 240


>gi|159185080|ref|NP_355120.2| outer membrane protein [Agrobacterium tumefaciens str. C58]
 gi|159140353|gb|AAK87905.2| outer membrane protein [Agrobacterium tumefaciens str. C58]
          Length = 209

 Score =  106 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 54/209 (25%), Positives = 81/209 (38%), Gaps = 12/209 (5%)

Query: 7   AVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNG-PYAGLSALYN 65
            + V+SL   S  +A AAD V                    P      G  +A       
Sbjct: 3   TLIVTSLLALSASTAMAADAVYETPAPPVAQETLPVFTWSGPYLGIQGGAGWANGDFSAG 62

Query: 66  GSFGEEAHHNAGGSIFAGYNVEDS-CIMYGVEGDVRYTVPVLA-DNIHSLHGIGGSLRIR 123
           G    +  +      FAGYN +    ++ G+EGDV Y         I       GS+R R
Sbjct: 63  GPVVSDDFNGGILGAFAGYNYQFDNNMVLGIEGDVDYNWNDNDYSGIKVGTDWQGSVRGR 122

Query: 124 GGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYR 183
            GY   D  L+YAT G    + +     G+      G T G GV+    ++++  RLEYR
Sbjct: 123 VGYAF-DHALIYATAGWTATRGFIETPVGDDKATFNGYTVGAGVDY-AFTDNVFGRLEYR 180

Query: 184 ASKYSK-------VEGFYNTISLGVGMKF 205
            + Y          +   +T+ +G+G+KF
Sbjct: 181 YNDYGDKDIFGINTDFDQHTVKVGLGVKF 209


>gi|260568272|ref|ZP_05838741.1| outer membrane protein Omp31 [Brucella suis bv. 4 str. 40]
 gi|16611660|gb|AAL27289.1|AF366066_1 outer membrane protein Omp31 [Brucella suis]
 gi|260154937|gb|EEW90018.1| outer membrane protein Omp31 [Brucella suis bv. 4 str. 40]
          Length = 240

 Score =  106 bits (263), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 44/241 (18%), Positives = 82/241 (34%), Gaps = 45/241 (18%)

Query: 7   AVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNG 66
           +V ++S+A     SA AAD V             + T  +       N  YAG    +  
Sbjct: 3   SVILASIAAMFATSAMAADVVVSEPSAPTAA--PVDTFSWTGGYIGINAGYAGGKFKHPF 60

Query: 67  SFGEEAHH------------NAGGSIFAGYNVEDSC-IMYGVEGDVRYTVPVLADNI--- 110
           S  ++  +               G + AGYN +    ++ G E D + +    + +    
Sbjct: 61  SSFDKEDNEQVSGSLDATAGGFVGGVQAGYNWQLDNGVVLGAETDFQGSSVTGSISAGAS 120

Query: 111 ------HSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYE--------TGKAGEITP 156
                  +     G++R R GY  ++ L++Y T G    +           +        
Sbjct: 121 GLEGKAETKVEWFGTVRARLGYTATERLMVYGTGGLAYGKVKSAFNLGDDASALHTWSDK 180

Query: 157 IAIGGTAGVGVEVGGLSESLVARLEYRASKYSK------------VEGFYNTISLGVGMK 204
              G T G G E   ++ +   + EY  +   K             +  ++T+ +G+  K
Sbjct: 181 TKAGWTLGAGAEY-AINNNWTLKSEYLYTDLGKRNLVDVDNSFLESKVNFHTVRVGLNYK 239

Query: 205 F 205
           F
Sbjct: 240 F 240


>gi|254706065|ref|ZP_05167893.1| outer membrane protein Omp31 precursor [Brucella pinnipedialis
           M163/99/10]
 gi|261313502|ref|ZP_05952699.1| outer-membrane immunogenic protein [Brucella pinnipedialis
           M163/99/10]
 gi|261302528|gb|EEY06025.1| outer-membrane immunogenic protein [Brucella pinnipedialis
           M163/99/10]
          Length = 240

 Score =  105 bits (262), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 43/241 (17%), Positives = 81/241 (33%), Gaps = 45/241 (18%)

Query: 7   AVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNG 66
           +V ++S+A     SA AAD V             + T  +       N  YAG    +  
Sbjct: 3   SVILASIAAMFATSAMAADVVVSEPSAPTAA--PVDTFSWTGGYIGINAGYAGGKFKHPF 60

Query: 67  SFGEEAHH------------NAGGSIFAGYNVEDSC-IMYGVEGDVRYTVPVLADNI--- 110
              ++  +               G + AGYN +    ++ G E D + +    + +    
Sbjct: 61  FSFDKEDNEQVSGSLDVTAGGFVGGVQAGYNWQLDNGVVLGAETDFQGSSVTGSISAGAS 120

Query: 111 ------HSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYE--------TGKAGEITP 156
                  +     G++R R GY  ++ L++Y T G    +           +        
Sbjct: 121 GLEGKAETKVEWFGTVRARLGYTATERLMVYGTGGLAYGKVKSAFNLGDDASALHTWSDK 180

Query: 157 IAIGGTAGVGVEVGGLSESLVARLEYRASKYSK------------VEGFYNTISLGVGMK 204
              G T G G E   ++ +   + EY  +   K             +  ++T+ +G+  K
Sbjct: 181 TKAGWTLGAGAEY-AINNNWTLKSEYLYTDLGKRNLVDVDNSFLESKVNFHTVRVGLNYK 239

Query: 205 F 205
           F
Sbjct: 240 F 240


>gi|254470094|ref|ZP_05083498.1| outer membrane protein [Pseudovibrio sp. JE062]
 gi|211960405|gb|EEA95601.1| outer membrane protein [Pseudovibrio sp. JE062]
          Length = 221

 Score =  105 bits (261), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 48/225 (21%), Positives = 82/225 (36%), Gaps = 28/225 (12%)

Query: 4   LFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSAL 63
           L +A   +        ++ AAD  +        +             +D++G Y G +A 
Sbjct: 2   LRIASCTAIAFGLMAGTSLAADLPQPVQPSQPEIS---YETPATFSAYDWSGAYIGANAG 58

Query: 64  YNG----------SFGEEAHHNAGGSIFAGYNVED-SCIMYGVEGDVRYTVP-VLADNIH 111
           +               ++  +     + AGYN      ++ G E D++Y      +  + 
Sbjct: 59  WGFLSADGKSGASGALDDDQNGVTAGVHAGYNFMVAPSVVLGAEADIQYNDLEEKSAGVE 118

Query: 112 SLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGG 171
                  ++R R GY + D  L+Y T G           AG+    AIG   G GVE   
Sbjct: 119 LQSDWNATVRARAGYAL-DRTLVYGTGGAAFKDLTAKSSAGKDEKTAIGYVVGAGVE-HA 176

Query: 172 LSESLVARLEYRASKYSKVEGFY-----------NTISLGVGMKF 205
           ++++L ARLEY    +   +  +           N +  GV MKF
Sbjct: 177 VTDTLTARLEYLYQDFGDQKFDFGGTTEKTKIDENLVRAGVSMKF 221


>gi|222148166|ref|YP_002549123.1| outer membrane protein [Agrobacterium vitis S4]
 gi|221735154|gb|ACM36117.1| outer membrane protein [Agrobacterium vitis S4]
          Length = 212

 Score =  104 bits (260), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 54/218 (24%), Positives = 92/218 (42%), Gaps = 19/218 (8%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+ L + +  SS  L+    A AAD V         V      + +        G Y   
Sbjct: 1   MRTLVMILLASSAGLSLVTGAHAADAVMSVPEAPAAVDMPAPVSNWAGAYVGGAGTYTMG 60

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRY--TVPVLADNIHSLHGIGG 118
                    + +    GG ++ GYN+++  I+YG E D+ Y          ++   G+ G
Sbjct: 61  R----SHGSKFSARAFGGQVYGGYNMQNDKIVYGGEADIGYDGNGSRSGAGLNGKQGVNG 116

Query: 119 SLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVA 178
           S+R R GY+++   ++Y T G   A    +G  G  +  A+G T G GVE   ++ ++  
Sbjct: 117 SIRGRVGYDLNP-FMVYGTAGVAAADTKISGAGGSDSKAALGYTVGAGVE-AMVTNNITT 174

Query: 179 RLEYRASKYSKVE-----------GFYNTISLGVGMKF 205
           R+EYR + Y   +               ++ +G+GMKF
Sbjct: 175 RVEYRYTDYQNKDYNIGGSKVSRGFDDQSVKVGIGMKF 212


>gi|153007477|ref|YP_001368692.1| porin [Ochrobactrum anthropi ATCC 49188]
 gi|151559365|gb|ABS12863.1| porin [Ochrobactrum anthropi ATCC 49188]
          Length = 229

 Score =  104 bits (260), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 49/230 (21%), Positives = 79/230 (34%), Gaps = 29/230 (12%)

Query: 3   KLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSA 62
           K  + +G S LA+ +   A AAD +                  Y+     +    A L  
Sbjct: 2   KFRILLGASLLAVVASTGAYAADAIVSQEPAPMAAPAFSWGGAYIGGEIGWGWGRAKLDD 61

Query: 63  LYNGSFGEEAHHNAGGSIFAGYNVEDSCIM-YGVEGDVRYTVPVLA-----------DNI 110
                  E   +   G ++AGYN +    +  GV+G+  Y     +            + 
Sbjct: 62  KSTDQSNEFKPNGFIGGVYAGYNFDMGNNVILGVDGNFDYNDLKKSHDYISNSNAVQTSA 121

Query: 111 HSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAG----EITPIAIGGTAGVG 166
            +     G++R R GY V D  + Y   G        +   G           G T G G
Sbjct: 122 ETKLQWSGAVRARAGYAV-DRFMPYIAGGVAFGGVKNSLNVGGSDYNNDKTLTGWTVGTG 180

Query: 167 VEVGGLSESLVARLEYRASKYSKVEGFY-----------NTISLGVGMKF 205
           V+    +++++ RLEYR + +   +              N I LGV  KF
Sbjct: 181 VDYAA-TDNVLLRLEYRYTDFGNKDFDLGNTATRGSFKTNDIRLGVAYKF 229


>gi|150396648|ref|YP_001327115.1| porin [Sinorhizobium medicae WSM419]
 gi|150028163|gb|ABR60280.1| porin [Sinorhizobium medicae WSM419]
          Length = 215

 Score =  104 bits (260), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 56/218 (25%), Positives = 81/218 (37%), Gaps = 16/218 (7%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M +  L    ++  L     A AAD  +                    +     G +   
Sbjct: 1   MIRNVLVAIFAAFMLGG--KAHAADLAQPPEPTPTVETVHSFVWTGGYLGLQGGGGWLNS 58

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPV-----LADNIHSLHG 115
                G  G +         FAGYN +    + GVEGDV Y            N      
Sbjct: 59  DLSVPGGGGSKRFSGGLLGAFAGYNYQHGDWVVGVEGDVSYNWNDETVTVFGTNTDVGTD 118

Query: 116 IGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGE-ITPIAIGGTAGVGVEVGGLSE 174
           + GS+R R GY V+D  LLYAT G  V + +              G T G GV+ G  ++
Sbjct: 119 VSGSVRARLGYTVNDRTLLYATGGWAVTRGFVDVAGAPKEKETFNGWTIGGGVDYGF-TD 177

Query: 175 SLVARLEYRASKYS-------KVEGFYNTISLGVGMKF 205
           S+  R EYR + +S        V+   +  ++GVG+KF
Sbjct: 178 SVFGRAEYRYNDFSDKDVGGVDVDLDQHQFTIGVGVKF 215


>gi|241203970|ref|YP_002975066.1| porin [Rhizobium leguminosarum bv. trifolii WSM1325]
 gi|240857860|gb|ACS55527.1| porin [Rhizobium leguminosarum bv. trifolii WSM1325]
          Length = 211

 Score =  104 bits (260), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 53/206 (25%), Positives = 89/206 (43%), Gaps = 11/206 (5%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+ L   +  S  A+A   +       + A    +     +A +  V    ++ G Y G 
Sbjct: 1   MRVLIAGLMASVFAIAGLSA------AQAADAVDQIPEAPVAQDAPVKPAGNWEGFYLGG 54

Query: 61  SALYNGSFGEEAHH--NAGGSIFAGYNVEDSCIMYGVEGDVRYTVPV-LADNIHSLHGIG 117
           +  YN        H    GG +F GYN +   I+YGVE D+ Y+     +  + + +G  
Sbjct: 55  AGTYNMGDFGSDRHTYGFGGQVFTGYNWQQGQIVYGVESDLGYSGDDVSSGGVKNKYGWN 114

Query: 118 GSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLV 177
           GS+R R GY+++   LLY T G  +     +    + +    G T G GVE   ++ ++ 
Sbjct: 115 GSVRGRVGYDMNP-FLLYGTAGLAIGDVKVSDDTSDESKTNFGYTVGAGVE-AFVTNNIT 172

Query: 178 ARLEYRASKYSKVEGFYNTISLGVGM 203
            RLEYR + Y   +   ++ S   G 
Sbjct: 173 TRLEYRYTDYQSKDYDLDSGSFSRGY 198


>gi|229620416|gb|ACQ84164.1| Omp31 [Brucella melitensis]
          Length = 240

 Score =  104 bits (260), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 43/241 (17%), Positives = 81/241 (33%), Gaps = 45/241 (18%)

Query: 7   AVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNG 66
           +V ++S+A     SA AAD V             + T  +       N  YAG    +  
Sbjct: 3   SVILASIAAMFATSAMAADVVVSEPSAPTAA--PVDTFSWTGGYIGINAGYAGGKFKHPF 60

Query: 67  SFGEEAHH------------NAGGSIFAGYNVEDSC-IMYGVEGDVRYTVPVLADNI--- 110
           S  ++  +               G + AGYN +    ++ G   D + +    + +    
Sbjct: 61  SSFDKEDNEQVSGSLDVTAGGFVGGVQAGYNWQLDNGVVLGAGTDFQGSSVTGSISAGAS 120

Query: 111 ------HSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYE--------TGKAGEITP 156
                  +     G++R R GY  ++ L++Y T G    +           +        
Sbjct: 121 GLEGKAETKVEWFGTVRARLGYTATERLMVYGTGGLAYGKVKSAFNLGDDASALHTWSDK 180

Query: 157 IAIGGTAGVGVEVGGLSESLVARLEYRASKYSK------------VEGFYNTISLGVGMK 204
              G T G G E   ++ +   + EY  +   K             +  ++T+ +G+  K
Sbjct: 181 TKAGWTLGAGAEY-AINNNWTLKSEYLYTDLGKRNLVDVDNSFLESKVNFHTVRVGLNYK 239

Query: 205 F 205
           F
Sbjct: 240 F 240


>gi|225627449|ref|ZP_03785486.1| Porin subfamily protein [Brucella ceti str. Cudo]
 gi|260563986|ref|ZP_05834472.1| outer membrane protein 25b [Brucella melitensis bv. 1 str. 16M]
 gi|260566481|ref|ZP_05836951.1| outer membrane protein 25b [Brucella suis bv. 4 str. 40]
 gi|261758166|ref|ZP_06001875.1| outer membrane protein 25b [Brucella sp. F5/99]
 gi|265999479|ref|ZP_05466559.2| outer membrane protein 25b [Brucella melitensis bv. 2 str. 63/9]
 gi|294852320|ref|ZP_06792993.1| outer membrane protein [Brucella sp. NVSL 07-0026]
 gi|225617454|gb|EEH14499.1| Porin subfamily protein [Brucella ceti str. Cudo]
 gi|260154002|gb|EEW89094.1| outer membrane protein 25b [Brucella melitensis bv. 1 str. 16M]
 gi|260155999|gb|EEW91079.1| outer membrane protein 25b [Brucella suis bv. 4 str. 40]
 gi|261738150|gb|EEY26146.1| outer membrane protein 25b [Brucella sp. F5/99]
 gi|263094215|gb|EEZ18092.1| outer membrane protein 25b [Brucella melitensis bv. 2 str. 63/9]
 gi|294820909|gb|EFG37908.1| outer membrane protein [Brucella sp. NVSL 07-0026]
          Length = 243

 Score =  104 bits (259), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 41/208 (19%), Positives = 67/208 (32%), Gaps = 46/208 (22%)

Query: 42  ATNRYVPIRHDFNGPYAGLSALYNGSFGEEAH---------HNAGGSIFAGYNVEDS-CI 91
                V     +NG Y G    Y       +              G ++AGYN +     
Sbjct: 38  PAPVVVAPTFTWNGAYLGGQIGYGWGRSTLSDEDTSIRVKPDGFLGGLYAGYNFDMGNNF 97

Query: 92  MYGVEGDVRYTVPVLA-----------DNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGP 140
           + GV+GD+ Y     +             + S     G++R R G  + D  + Y   G 
Sbjct: 98  VLGVDGDITYNDLDASHSDTDPDLDLTTGVDSKLRWSGAVRARMGVAM-DRWMPYIAGGV 156

Query: 141 DVAQKYETGKAGE--------ITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEG 192
                  +    +         +    G  AG GV+    +++++ RLEYR + Y   + 
Sbjct: 157 AFGNVKNSVSLTDGIESIGVSQSKTMTGWAAGAGVDYAA-TDNVIVRLEYRYTDYGHKDF 215

Query: 193 FY---------------NTISLGVGMKF 205
                            + I LGV  KF
Sbjct: 216 SVVDGDLSVEARNKFKTHDIRLGVAYKF 243


>gi|116251355|ref|YP_767193.1| ropB outer membrane protein [Rhizobium leguminosarum bv. viciae
           3841]
 gi|115256003|emb|CAK07084.1| putative ropB outer membrane protein [Rhizobium leguminosarum bv.
           viciae 3841]
 gi|220979413|gb|ACL97988.1| outer membrane protein B [Rhizobium leguminosarum bv. viciae]
          Length = 211

 Score =  104 bits (259), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 53/206 (25%), Positives = 88/206 (42%), Gaps = 11/206 (5%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+ L   +  S  A+A   +       + A    +     +A    V    ++ G Y G 
Sbjct: 1   MRVLIAGLMASVFAIAGVSA------AQAADAVDQVPEAPVAQEAPVKPAGNWEGFYLGG 54

Query: 61  SALYNGSFGEEAHH--NAGGSIFAGYNVEDSCIMYGVEGDVRYTVPV-LADNIHSLHGIG 117
           +  YN        H    GG +F GYN +   I+YGVE D+ Y+     +  + + +G  
Sbjct: 55  AGTYNMGDFGSDRHTYGFGGQVFTGYNWQQGQIVYGVESDLGYSGDDVSSGGVKNKYGWN 114

Query: 118 GSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLV 177
           GS+R R GY+++   LLY T G  +     +    + +    G T G GVE   ++ ++ 
Sbjct: 115 GSVRGRVGYDMNP-FLLYGTAGLAIGDVKVSDDTSDESKTNFGYTVGAGVE-AFVTNNIT 172

Query: 178 ARLEYRASKYSKVEGFYNTISLGVGM 203
            RLEYR + Y   +   ++ S   G 
Sbjct: 173 TRLEYRYTDYQSKDYDLDSGSFSRGY 198


>gi|190891678|ref|YP_001978220.1| outer membrane protein [Rhizobium etli CIAT 652]
 gi|218510868|ref|ZP_03508746.1| outer membrane protein [Rhizobium etli Brasil 5]
 gi|190696957|gb|ACE91042.1| outer membrane protein [Rhizobium etli CIAT 652]
          Length = 207

 Score =  104 bits (259), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 42/204 (20%), Positives = 74/204 (36%), Gaps = 10/204 (4%)

Query: 10  VSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSFG 69
            ++       +A AAD V+          P    +          G +        G+  
Sbjct: 6   ATAFLALVATTAFAADVVQDVPTAPVAAAPVFTWSGPYFGIDGGAG-WLNGDFSAGGASA 64

Query: 70  EEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLAD-NIHSLHGIGGSLRIRGGYEV 128
           +E  +      FAGYN +   I+ G+EG++ +                 G++R R GY  
Sbjct: 65  DEDFNGGVFGAFAGYNFQFDNIVVGIEGNIEHNWNEEDALGADVGTDWAGAVRGRVGYAF 124

Query: 129 SDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYS 188
             +L+  A          +     + T    G T G GV+   ++ ++ AR EYR + Y 
Sbjct: 125 DKALIYGAAGWAATRGYVDAPGFDKETETFNGYTVGAGVDF-AITNNIFARGEYRYNDYG 183

Query: 189 -------KVEGFYNTISLGVGMKF 205
                   V+   + +  G+G+KF
Sbjct: 184 EKDILGVDVDLDQHELKFGIGVKF 207


>gi|254720536|ref|ZP_05182347.1| outer membrane protein Omp31 precursor [Brucella sp. 83/13]
 gi|265985569|ref|ZP_06098304.1| outer-membrane immunogenic protein [Brucella sp. 83/13]
 gi|306838097|ref|ZP_07470954.1| outer membrane protein Omp31 [Brucella sp. NF 2653]
 gi|264664161|gb|EEZ34422.1| outer-membrane immunogenic protein [Brucella sp. 83/13]
 gi|306406834|gb|EFM63056.1| outer membrane protein Omp31 [Brucella sp. NF 2653]
          Length = 240

 Score =  104 bits (258), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 44/241 (18%), Positives = 80/241 (33%), Gaps = 45/241 (18%)

Query: 7   AVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNG 66
           +V ++S+A     SA AAD V             + T  +       N  YAG    +  
Sbjct: 3   SVILASIAAMFATSAMAADVVVSEPSAPTAA--PVDTFSWTGGYIGINAGYAGGKFKHPF 60

Query: 67  SFGEEAHH------------NAGGSIFAGYNVEDSCI-MYGVEGDVRYTVPVLADNI--- 110
           S  +   +               G + AGYN +     + G E D + +    + +    
Sbjct: 61  STFDTEDNEQVSGSLDVTAGGFVGGVQAGYNWQLDNGGVLGAETDFQGSSVTGSISAGAS 120

Query: 111 ------HSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYE--------TGKAGEITP 156
                  +     G++R R GY  ++ L++Y T G    +           +        
Sbjct: 121 GLEGKAETKVEWFGTVRARLGYTATERLMVYGTGGLAYGKVKSAFNLGDDASALHTWSDK 180

Query: 157 IAIGGTAGVGVEVGGLSESLVARLEYRASKYSK------------VEGFYNTISLGVGMK 204
              G T G G E   ++ +   + EY  +   K             +  ++T+ +G+  K
Sbjct: 181 TKAGWTLGAGAEY-AINNNWTLKSEYLYTDLGKRNLVDVDNSFLESKVNFHTVRIGLNYK 239

Query: 205 F 205
           F
Sbjct: 240 F 240


>gi|256060262|ref|ZP_05450437.1| outer membrane protein, putative [Brucella neotomae 5K33]
 gi|261324235|ref|ZP_05963432.1| Omp25d [Brucella neotomae 5K33]
 gi|46251251|gb|AAS84596.1| Omp25d [Brucella neotomae]
 gi|261300215|gb|EEY03712.1| Omp25d [Brucella neotomae 5K33]
          Length = 230

 Score =  104 bits (258), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 50/227 (22%), Positives = 85/227 (37%), Gaps = 30/227 (13%)

Query: 7   AVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNR-YVPIRHDFNGPYAGLSALYN 65
            +G S +A+ +  SA AAD +         + P+ +    Y   +  +    A L    N
Sbjct: 6   LLGASLVAVITSTSAYAADAIVAQEPAPIAIAPSFSWAGAYFGGQVGYGWGRAKLENRTN 65

Query: 66  GSFGEEAHHNAGGSIFAGYNVEDS-CIMYGVEGDVRYTVPVLA-----------DNIHSL 113
           GS  E   +   G ++ GYN +     + G++ +V Y     +               + 
Sbjct: 66  GSTSEFKPNGFIGGLYTGYNFDTGNNFILGLDANVDYNNLKKSRDFITSGNPVQTTGETQ 125

Query: 114 HGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYET----GKAGEITPIAIGGTAGVGVEV 169
               G++R R GY + D  + Y   G        +    G+    +    G T G G++ 
Sbjct: 126 LRWSGAVRARAGYAI-DRFMPYIAGGVAFGGIKNSLRIGGEESSKSKTQTGWTVGAGIDY 184

Query: 170 GGLSESLVARLEYRASKYSKVEGFY-----------NTISLGVGMKF 205
              +++++ RLEYR + Y K                N I LGV  KF
Sbjct: 185 AA-TDNVLLRLEYRYTDYGKKNFGLNDLDTRGSFKTNDIRLGVAYKF 230


>gi|157310311|emb|CAN43867.1| outer membrane protein 25b [Brucella microti CCM 4915]
 gi|157310313|emb|CAN43868.1| outer membrane protein 25b [Brucella microti]
          Length = 245

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 41/208 (19%), Positives = 67/208 (32%), Gaps = 46/208 (22%)

Query: 42  ATNRYVPIRHDFNGPYAGLSALYNGSFGEEAH---------HNAGGSIFAGYNVEDS-CI 91
                V     +NG Y G    Y       +              G ++AGYN +     
Sbjct: 40  PAPVVVAPTFTWNGAYLGGQIGYGWGRSTLSDEDTSIRVKPDGFLGGLYAGYNFDMGNNF 99

Query: 92  MYGVEGDVRYTVPVLA-----------DNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGP 140
           + GV+GD+ Y     +             + S     G++R R G  + D  + Y   G 
Sbjct: 100 VLGVDGDITYNDLDASHSDTDPDLDLTTGVDSKLRWSGAVRARMGVAM-DRWMPYIAGGV 158

Query: 141 DVAQKYETGKAGE--------ITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEG 192
                  +    +         +    G  AG GV+    +++++ RLEYR + Y   + 
Sbjct: 159 AFGNVKNSVSLTDGIESIGVSQSKTMTGWAAGAGVDYAA-TDNVIVRLEYRYTDYGHKDF 217

Query: 193 FY---------------NTISLGVGMKF 205
                            + I LGV  KF
Sbjct: 218 SVVDGDLSVEARNKFKTHDIRLGVAYKF 245


>gi|225851658|ref|YP_002731891.1| porin [Brucella melitensis ATCC 23457]
 gi|256264831|ref|ZP_05467363.1| Omp25d [Brucella melitensis bv. 2 str. 63/9]
 gi|225640023|gb|ACN99936.1| porin [Brucella melitensis ATCC 23457]
 gi|263095287|gb|EEZ18914.1| Omp25d [Brucella melitensis bv. 2 str. 63/9]
 gi|326408138|gb|ADZ65203.1| porin [Brucella melitensis M28]
 gi|326537849|gb|ADZ86064.1| porin [Brucella melitensis M5-90]
          Length = 230

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 49/227 (21%), Positives = 84/227 (37%), Gaps = 30/227 (13%)

Query: 7   AVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNR-YVPIRHDFNGPYAGLSALYN 65
            +G S +A+ +  SA AAD +         + P+ +    Y   +  +    A L    N
Sbjct: 6   LLGASLVAVITSTSAYAADAIVAQEPAPIAIAPSFSWAGAYFGGQVGYGWGRAKLENRTN 65

Query: 66  GSFGEEAHHNAGGSIFAGYNVEDSC-IMYGVEGDVRYTVPVLA-----------DNIHSL 113
           G   E   +   G ++ GYN +     + G++ +V Y     +               + 
Sbjct: 66  GGTSEFKPNGFIGGLYTGYNFDTGNHFILGLDANVDYNNLKKSRDFITSGNPVQTTGETQ 125

Query: 114 HGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYET----GKAGEITPIAIGGTAGVGVEV 169
               G++R R GY + D  + Y   G        +    G+    +    G T G G++ 
Sbjct: 126 LRWSGAVRARAGYAI-DRFMPYIAGGVAFGGIKNSLRIGGEESSKSKTQTGWTVGAGIDY 184

Query: 170 GGLSESLVARLEYRASKYSKVEGFY-----------NTISLGVGMKF 205
              +++++ RLEYR + Y K                N I LGV  KF
Sbjct: 185 AA-TDNVLLRLEYRYTDYGKKNFGLNDLDTRGSFKTNDIRLGVAYKF 230


>gi|239830970|ref|ZP_04679299.1| Porin subfamily protein [Ochrobactrum intermedium LMG 3301]
 gi|239823237|gb|EEQ94805.1| Porin subfamily protein [Ochrobactrum intermedium LMG 3301]
          Length = 240

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 55/230 (23%), Positives = 85/230 (36%), Gaps = 29/230 (12%)

Query: 3   KLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSA 62
           KL   +  S++AL +   A+AAD V         V P+              G       
Sbjct: 13  KLKALLLASTVALVAATGAKAADAVIEQEPAPVVVAPSFTWTGAYIGGQIGYGWGKSNFD 72

Query: 63  LYNGSFGEEAHHNAGGSIFAGYNVEDS-CIMYGVEGDVRYTVPVLA----------DNIH 111
               S+G+       G ++AGYN +    I+ G++GDV Y                 +  
Sbjct: 73  GDVFSYGDVKPDGFLGGVYAGYNFDLGNNIVLGIDGDVTYNDVSKDIDVFDGDLAVGDFE 132

Query: 112 SLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAG-----EITPIAIGGTAGVG 166
           +     G++R R GY V D  + Y   G        +G          +    G TAG G
Sbjct: 133 TKLRWSGAVRARVGYAV-DRFMPYLAGGVAFGNIKNSGSIDGIGSFSESKTLTGWTAGAG 191

Query: 167 VEVGGLSESLVARLEYRASKYSKVEGFY-----------NTISLGVGMKF 205
           V+    +++L+ RLEYR + Y   +  +           N + LGV  KF
Sbjct: 192 VDYAA-TDNLIVRLEYRYTDYGDKDIDFGGLNINQDFKTNEVRLGVAYKF 240


>gi|182677110|ref|YP_001831256.1| porin [Beijerinckia indica subsp. indica ATCC 9039]
 gi|182632993|gb|ACB93767.1| porin [Beijerinckia indica subsp. indica ATCC 9039]
          Length = 244

 Score =  103 bits (256), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 54/239 (22%), Positives = 83/239 (34%), Gaps = 46/239 (19%)

Query: 4   LFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSAL 63
           L   +  S + +AS  +A AAD   RA       +P             + G Y G    
Sbjct: 2   LRTIIHSSIVIMASSVAALAADLPNRAAPPTVPYLPPSPA-------FSWTGVYLGGQIG 54

Query: 64  YNGSFGE----------EAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLA------ 107
           Y                 + +   G    G+N + S  + G EGDV  +    +      
Sbjct: 55  YQFGRDSITAPGLFSVGHSPNGVVGGAHIGFNYQVSQFIVGFEGDVNGSSYSGSVFNPVF 114

Query: 108 -DNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETG-------KAGEITPIAI 159
              + S   + GSLR R G    D +L+YAT G   A              +  +T   +
Sbjct: 115 RTQLTSRIPVDGSLRGRIGAAW-DRVLVYATGGAAFASIKHGYIGSSLVPGSATLTNDRV 173

Query: 160 GGTAGVGVEVGGLSESLVARLEYRASKYSKVEGF-------------YNTISLGVGMKF 205
           G T G GVE   ++++   R++YR + Y  +  F              N +  G   KF
Sbjct: 174 GWTVGGGVEY-AMTDNWSVRVDYRYTDYGNISDFPGTITVPRIHHETNNRVQAGFSYKF 231


>gi|85716040|ref|ZP_01047017.1| putative outer-membrane immunogenic protein precursor [Nitrobacter
           sp. Nb-311A]
 gi|85697238|gb|EAQ35119.1| putative outer-membrane immunogenic protein precursor [Nitrobacter
           sp. Nb-311A]
          Length = 206

 Score =  103 bits (256), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 52/218 (23%), Positives = 82/218 (37%), Gaps = 25/218 (11%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M K  +A   +  + A   +AQAAD   RA            T         + GPY G 
Sbjct: 1   MSKTLIAALATMASTALIGTAQAADFSYRAP----------YTVNQPLNAFSWAGPYLGG 50

Query: 61  SALYNGSFGEEA---HHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLA-DNIHSLHGI 116
           +  Y     + +        G + AGYN +   +++G+EGD++              +  
Sbjct: 51  NLGYAWGSVQNSLTKPDGVFGGVQAGYNWQSGSMVFGLEGDIQANAANDTFAAWKFSNPW 110

Query: 117 GGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESL 176
            G++R R GY  S+ +L+Y T G    +      A   +    G T GVG EVG + ++ 
Sbjct: 111 FGTVRGRLGYAFSN-VLVYGTGGLAFGKLRAETFALSESHTNAGWTVGVGAEVG-IYQNW 168

Query: 177 VARLEYRASKYSKVEGFYNT---------ISLGVGMKF 205
            A++EY     S                 +  GV   F
Sbjct: 169 TAKVEYLYVDLSSSNFTITGAPHSYQSGLVRAGVNYHF 206


>gi|218675314|ref|ZP_03524983.1| outer membrane protein [Rhizobium etli GR56]
          Length = 211

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 55/206 (26%), Positives = 91/206 (44%), Gaps = 11/206 (5%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+ L   +  S+ A+A   +       + A    +     IA +  V    ++ G Y G 
Sbjct: 1   MRVLIAGLMASAFAIAGVSA------AQAADAVDQVPEAPIAQDAPVKPAGNWEGFYLGG 54

Query: 61  SALYNGSFGEEAHH--NAGGSIFAGYNVEDSCIMYGVEGDVRYTVPV-LADNIHSLHGIG 117
           +  YN        H    GG +F GYN +   I+YGVE D+ Y+     +  + + +G  
Sbjct: 55  AGTYNMGDFGSDRHTYGFGGQVFTGYNWQQGQIVYGVESDLGYSGDDVSSGGVKNKYGWN 114

Query: 118 GSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLV 177
           GS+R R GY+++   LLY T G  +     +    + +  A G T G GVE   ++ ++ 
Sbjct: 115 GSVRGRVGYDMNP-FLLYGTAGLALGNIKVSDDTSDESKTAYGYTVGAGVE-AFVTNNIT 172

Query: 178 ARLEYRASKYSKVEGFYNTISLGVGM 203
            RLEYR + Y   +   ++ S   G 
Sbjct: 173 TRLEYRYTDYQSKDYDLDSGSFSRGY 198


>gi|254700931|ref|ZP_05162759.1| outer membrane protein, putative [Brucella suis bv. 5 str. 513]
 gi|261751446|ref|ZP_05995155.1| outer membrane protein [Brucella suis bv. 5 str. 513]
 gi|261741199|gb|EEY29125.1| outer membrane protein [Brucella suis bv. 5 str. 513]
          Length = 232

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 49/229 (21%), Positives = 84/229 (36%), Gaps = 32/229 (13%)

Query: 7   AVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNR-YVPIRHDFNGPYAGLSALYN 65
            +G S +A+ +  SA AAD +         + P+ +    Y   +  +    A L    N
Sbjct: 6   LLGASLVAVITSTSAYAADAIVAQEPAPIAIAPSFSWAGAYFGGQVGYGWGRAKLENRTN 65

Query: 66  GSFGEEAHHNAGGSIFAGYNVEDS-CIMYGVEGDVRYTVPVLA-----------DNIHSL 113
           G   E   +   G ++ GYN +     + G++ +V Y     +               + 
Sbjct: 66  GGTSEFKPNGFIGGLYTGYNFDTGNNFILGLDANVDYNNLKKSRDFITSGNPVQTTGETQ 125

Query: 114 HGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEI------TPIAIGGTAGVGV 167
               G++R R GY + D  + Y   G        + + G        +    G T G G+
Sbjct: 126 LRWSGAVRARAGYAI-DRFMPYIAGGIAFGGIKNSLRIGGEESSKSKSKTQTGWTVGAGI 184

Query: 168 EVGGLSESLVARLEYRASKYSKVEGFY-----------NTISLGVGMKF 205
           +    +++++ RLEYR + Y K                N I LGV  KF
Sbjct: 185 DYAA-TDNVLLRLEYRYTDYGKKNFGLNDLDTRGSFKTNDIRLGVAYKF 232


>gi|17988113|ref|NP_540747.1| 25 kDa outer-membrane immunogenic protein precursor [Brucella
           melitensis bv. 1 str. 16M]
 gi|23501032|ref|NP_697159.1| outer membrane protein [Brucella suis 1330]
 gi|62289099|ref|YP_220892.1| hypothetical protein BruAb1_0115 [Brucella abortus bv. 1 str.
           9-941]
 gi|82699037|ref|YP_413611.1| outer membrane protein [Brucella melitensis biovar Abortus 2308]
 gi|148559864|ref|YP_001258156.1| putative outer membrane protein [Brucella ovis ATCC 25840]
 gi|161618106|ref|YP_001591993.1| 22 kDa outer membrane protein precursor [Brucella canis ATCC 23365]
 gi|163842393|ref|YP_001626797.1| 22 kDa outer membrane protein precursor [Brucella suis ATCC 23445]
 gi|189023374|ref|YP_001934142.1| outer membrane protein [Brucella abortus S19]
 gi|225626661|ref|ZP_03784700.1| Porin subfamily protein [Brucella ceti str. Cudo]
 gi|237814591|ref|ZP_04593589.1| Porin subfamily protein [Brucella abortus str. 2308 A]
 gi|254690428|ref|ZP_05153682.1| outer membrane protein, putative [Brucella abortus bv. 6 str. 870]
 gi|254694916|ref|ZP_05156744.1| outer membrane protein, putative [Brucella abortus bv. 3 str.
           Tulya]
 gi|254707184|ref|ZP_05169012.1| outer membrane protein, putative [Brucella pinnipedialis
           M163/99/10]
 gi|254709271|ref|ZP_05171082.1| outer membrane protein, putative [Brucella pinnipedialis B2/94]
 gi|254713306|ref|ZP_05175117.1| outer membrane protein, putative [Brucella ceti M644/93/1]
 gi|254716340|ref|ZP_05178151.1| outer membrane protein, putative [Brucella ceti M13/05/1]
 gi|254731459|ref|ZP_05190037.1| outer membrane protein, putative [Brucella abortus bv. 4 str. 292]
 gi|256030794|ref|ZP_05444408.1| outer membrane protein, putative [Brucella pinnipedialis M292/94/1]
 gi|256045910|ref|ZP_05448784.1| outer membrane protein, putative [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|256112624|ref|ZP_05453545.1| outer membrane protein, putative [Brucella melitensis bv. 3 str.
           Ether]
 gi|256158815|ref|ZP_05456676.1| outer membrane protein, putative [Brucella ceti M490/95/1]
 gi|256254200|ref|ZP_05459736.1| outer membrane protein, putative [Brucella ceti B1/94]
 gi|256258680|ref|ZP_05464216.1| outer membrane protein, putative [Brucella abortus bv. 9 str. C68]
 gi|256368582|ref|YP_003106088.1| 25 kDa outer-membrane immunogenic protein precursor [Brucella
           microti CCM 4915]
 gi|260169698|ref|ZP_05756509.1| 25 kDa outer-membrane immunogenic protein precursor [Brucella sp.
           F5/99]
 gi|260546396|ref|ZP_05822136.1| conserved hypothetical protein [Brucella abortus NCTC 8038]
 gi|260563195|ref|ZP_05833681.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. 16M]
 gi|260567238|ref|ZP_05837708.1| Omp25d [Brucella suis bv. 4 str. 40]
 gi|260755975|ref|ZP_05868323.1| outer membrane protein [Brucella abortus bv. 6 str. 870]
 gi|260759199|ref|ZP_05871547.1| outer membrane protein [Brucella abortus bv. 4 str. 292]
 gi|260884996|ref|ZP_05896610.1| Omp25d [Brucella abortus bv. 9 str. C68]
 gi|261215250|ref|ZP_05929531.1| outer membrane protein [Brucella abortus bv. 3 str. Tulya]
 gi|261218121|ref|ZP_05932402.1| conserved hypothetical protein [Brucella ceti M13/05/1]
 gi|261221348|ref|ZP_05935629.1| Omp25d [Brucella ceti B1/94]
 gi|261314665|ref|ZP_05953862.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10]
 gi|261316777|ref|ZP_05955974.1| conserved hypothetical protein [Brucella pinnipedialis B2/94]
 gi|261321032|ref|ZP_05960229.1| conserved hypothetical protein [Brucella ceti M644/93/1]
 gi|261759234|ref|ZP_06002943.1| outer membrane protein [Brucella sp. F5/99]
 gi|265987848|ref|ZP_06100405.1| Omp25d [Brucella pinnipedialis M292/94/1]
 gi|265992322|ref|ZP_06104879.1| Omp25d [Brucella melitensis bv. 1 str. Rev.1]
 gi|265994064|ref|ZP_06106621.1| Omp25d [Brucella melitensis bv. 3 str. Ether]
 gi|265997308|ref|ZP_06109865.1| Omp25d [Brucella ceti M490/95/1]
 gi|297247515|ref|ZP_06931233.1| 22 kDa outer membrane protein precursor [Brucella abortus bv. 5
           str. B3196]
 gi|17983867|gb|AAL53011.1| 25 kDa outer-membrane immunogenic protein precursor [Brucella
           melitensis bv. 1 str. 16M]
 gi|23346896|gb|AAN29074.1| outer membrane protein, putative [Brucella suis 1330]
 gi|46251245|gb|AAS84593.1| Omp25d [Brucella abortus]
 gi|46251247|gb|AAS84594.1| Omp25d [Brucella ovis]
 gi|46251249|gb|AAS84595.1| Omp25d [Brucella canis]
 gi|46251253|gb|AAS84597.1| Omp25d [Brucella ceti]
 gi|46251255|gb|AAS84598.1| Omp25d [Brucella ceti]
 gi|46251257|gb|AAS84599.1| Omp25d [Brucella ceti]
 gi|46251259|gb|AAS84600.1| Omp25d [Brucella pinnipedialis]
 gi|62195231|gb|AAX73531.1| outer membrane protein, hypothetical [Brucella abortus bv. 1 str.
           9-941]
 gi|82615138|emb|CAJ10071.1| outer membrane protein, putative [Brucella melitensis biovar
           Abortus 2308]
 gi|148371121|gb|ABQ61100.1| putative outer membrane protein [Brucella ovis ATCC 25840]
 gi|161334917|gb|ABX61222.1| 22 kDa outer membrane protein precursor [Brucella canis ATCC 23365]
 gi|163673116|gb|ABY37227.1| 22 kDa outer membrane protein precursor [Brucella suis ATCC 23445]
 gi|189018946|gb|ACD71668.1| outer membrane protein, putative [Brucella abortus S19]
 gi|225618318|gb|EEH15361.1| Porin subfamily protein [Brucella ceti str. Cudo]
 gi|237789428|gb|EEP63638.1| Porin subfamily protein [Brucella abortus str. 2308 A]
 gi|255998740|gb|ACU47139.1| 25 kDa outer-membrane immunogenic protein precursor [Brucella
           microti CCM 4915]
 gi|260096503|gb|EEW80379.1| conserved hypothetical protein [Brucella abortus NCTC 8038]
 gi|260153211|gb|EEW88303.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. 16M]
 gi|260156756|gb|EEW91836.1| Omp25d [Brucella suis bv. 4 str. 40]
 gi|260669517|gb|EEX56457.1| outer membrane protein [Brucella abortus bv. 4 str. 292]
 gi|260676083|gb|EEX62904.1| outer membrane protein [Brucella abortus bv. 6 str. 870]
 gi|260874524|gb|EEX81593.1| Omp25d [Brucella abortus bv. 9 str. C68]
 gi|260916857|gb|EEX83718.1| outer membrane protein [Brucella abortus bv. 3 str. Tulya]
 gi|260919932|gb|EEX86585.1| Omp25d [Brucella ceti B1/94]
 gi|260923210|gb|EEX89778.1| conserved hypothetical protein [Brucella ceti M13/05/1]
 gi|261293722|gb|EEX97218.1| conserved hypothetical protein [Brucella ceti M644/93/1]
 gi|261296000|gb|EEX99496.1| conserved hypothetical protein [Brucella pinnipedialis B2/94]
 gi|261303691|gb|EEY07188.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10]
 gi|261739218|gb|EEY27214.1| outer membrane protein [Brucella sp. F5/99]
 gi|262551776|gb|EEZ07766.1| Omp25d [Brucella ceti M490/95/1]
 gi|262765045|gb|EEZ10966.1| Omp25d [Brucella melitensis bv. 3 str. Ether]
 gi|263003388|gb|EEZ15681.1| Omp25d [Brucella melitensis bv. 1 str. Rev.1]
 gi|264660045|gb|EEZ30306.1| Omp25d [Brucella pinnipedialis M292/94/1]
 gi|297174684|gb|EFH34031.1| 22 kDa outer membrane protein precursor [Brucella abortus bv. 5
           str. B3196]
          Length = 230

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 49/227 (21%), Positives = 84/227 (37%), Gaps = 30/227 (13%)

Query: 7   AVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNR-YVPIRHDFNGPYAGLSALYN 65
            +G S +A+ +  SA AAD +         + P+ +    Y   +  +    A L    N
Sbjct: 6   LLGASLVAVITSTSAYAADAIVAQEPAPIAIAPSFSWAGAYFGGQVGYGWGRAKLENRTN 65

Query: 66  GSFGEEAHHNAGGSIFAGYNVEDS-CIMYGVEGDVRYTVPVLA-----------DNIHSL 113
           G   E   +   G ++ GYN +     + G++ +V Y     +               + 
Sbjct: 66  GGTSEFKPNGFIGGLYTGYNFDTGNNFILGLDANVDYNNLKKSRDFITSGNPVQTTGETQ 125

Query: 114 HGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYET----GKAGEITPIAIGGTAGVGVEV 169
               G++R R GY + D  + Y   G        +    G+    +    G T G G++ 
Sbjct: 126 LRWSGAVRARAGYAI-DRFMPYIAGGVAFGGIKNSLRIGGEESSKSKTQTGWTVGAGIDY 184

Query: 170 GGLSESLVARLEYRASKYSKVEGFY-----------NTISLGVGMKF 205
              +++++ RLEYR + Y K                N I LGV  KF
Sbjct: 185 AA-TDNVLLRLEYRYTDYGKKNFGLNDLDTRGSFKTNDIRLGVAYKF 230


>gi|115522948|ref|YP_779859.1| putative outer-membrane immunogenic protein precursor
           [Rhodopseudomonas palustris BisA53]
 gi|115516895|gb|ABJ04879.1| putative outer-membrane immunogenic protein precursor
           [Rhodopseudomonas palustris BisA53]
          Length = 207

 Score =  102 bits (254), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 44/202 (21%), Positives = 70/202 (34%), Gaps = 22/202 (10%)

Query: 17  SFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSF---GEEAH 73
              SAQAAD      +    V   +         + + GPY G +  Y            
Sbjct: 15  GLVSAQAADLSYGRSYAPYTVNQPLNA-------YSWAGPYLGGNLGYAWGDIHNNSAKP 67

Query: 74  HNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLA-DNIHSLHGIGGSLRIRGGYEVSDSL 132
               G I  GYN +   ++YG+EGD++ T            +   G++R R GY  ++ +
Sbjct: 68  SGLSGGIQGGYNWQSGQMVYGLEGDLQITGANDTFAQYKFSNPWFGTVRGRIGYAFNN-V 126

Query: 133 LLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEG 192
           + Y T G    +          +    G T G G E G +  +  A++EY      +   
Sbjct: 127 MFYGTGGLAYGELTAEMGGLSQSHTNAGFTVGAGAEFGLM-PNWTAKIEYLYVDLGESNF 185

Query: 193 FYNT---------ISLGVGMKF 205
              T         +  GV   F
Sbjct: 186 SLTTRSHSYEFGIVRFGVNYHF 207


>gi|209548691|ref|YP_002280608.1| porin [Rhizobium leguminosarum bv. trifolii WSM2304]
 gi|209534447|gb|ACI54382.1| porin [Rhizobium leguminosarum bv. trifolii WSM2304]
          Length = 211

 Score =  102 bits (254), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 53/206 (25%), Positives = 87/206 (42%), Gaps = 11/206 (5%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+ L   +  S  A+A   +       + A    +     +A    V     + G Y G 
Sbjct: 1   MRVLIAGLMASVFAIAGISA------AQAADAVDQIPEAPVAQEAPVKPAGSWEGFYLGG 54

Query: 61  SALYNGSFGEEAHH--NAGGSIFAGYNVEDSCIMYGVEGDVRYTVPV-LADNIHSLHGIG 117
           +  YN        H    GG +F GYN +   I+YGVE D+ Y+     +  + + +G  
Sbjct: 55  AGTYNMGDFGSDRHTYGFGGQVFTGYNWQQGQIVYGVESDLGYSGDDVSSGGVKNKYGWN 114

Query: 118 GSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLV 177
           GS+R R GY+++   LLY T G  +     +    + +    G T G GVE   ++ ++ 
Sbjct: 115 GSVRGRVGYDMNP-FLLYGTAGLALGNVKVSDGTSDESKTNYGYTVGAGVE-AFVTNNIT 172

Query: 178 ARLEYRASKYSKVEGFYNTISLGVGM 203
            RLEYR + Y   +   ++ S   G 
Sbjct: 173 TRLEYRYTDYQSKDYDLDSGSFSRGY 198


>gi|306844392|ref|ZP_07476982.1| outer membrane protein [Brucella sp. BO1]
 gi|306275205|gb|EFM56955.1| outer membrane protein [Brucella sp. BO1]
          Length = 230

 Score =  102 bits (253), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 49/227 (21%), Positives = 83/227 (36%), Gaps = 30/227 (13%)

Query: 7   AVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNR-YVPIRHDFNGPYAGLSALYN 65
            +G S +A+ +  SA AAD +         + P  +    Y   +  +    A L    N
Sbjct: 6   LLGASLVAVITSTSAYAADAIVAQEPAPIAIAPGFSWAGAYFGGQVGYGWGRAKLENRTN 65

Query: 66  GSFGEEAHHNAGGSIFAGYNVEDS-CIMYGVEGDVRYTVPVLA-----------DNIHSL 113
           G   E   +   G ++ GYN +     + G++ +V Y     +               + 
Sbjct: 66  GGTSEFKPNGFIGGLYTGYNFDTGNNFILGLDANVDYNNLKKSRDFITNGNPVQTTGETQ 125

Query: 114 HGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYET----GKAGEITPIAIGGTAGVGVEV 169
               G++R R GY + D  + Y   G        +    G+    +    G T G G++ 
Sbjct: 126 LRWSGAVRARAGYAI-DRFMPYIAGGVAFGGIKNSLRIGGEESSKSKTQTGWTVGAGIDY 184

Query: 170 GGLSESLVARLEYRASKYSKVEGFY-----------NTISLGVGMKF 205
              +++++ RLEYR + Y K                N I LGV  KF
Sbjct: 185 AA-TDNVLLRLEYRYTDYGKKNFGLNDLDTRGSFKTNDIRLGVAYKF 230


>gi|254718339|ref|ZP_05180150.1| outer membrane protein, putative [Brucella sp. 83/13]
 gi|265983298|ref|ZP_06096033.1| conserved hypothetical protein [Brucella sp. 83/13]
 gi|306839561|ref|ZP_07472367.1| outer membrane protein [Brucella sp. NF 2653]
 gi|306842593|ref|ZP_07475242.1| outer membrane protein [Brucella sp. BO2]
 gi|264661890|gb|EEZ32151.1| conserved hypothetical protein [Brucella sp. 83/13]
 gi|306287238|gb|EFM58726.1| outer membrane protein [Brucella sp. BO2]
 gi|306405347|gb|EFM61620.1| outer membrane protein [Brucella sp. NF 2653]
          Length = 230

 Score =  102 bits (253), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 49/227 (21%), Positives = 83/227 (36%), Gaps = 30/227 (13%)

Query: 7   AVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNR-YVPIRHDFNGPYAGLSALYN 65
            +G S +A+ +  SA AAD +         + P  +    Y   +  +    A L    N
Sbjct: 6   LLGASLVAVITSTSAYAADAIVAQEPAPIAIAPGFSWAGAYFGGQVGYGWGRAKLENRTN 65

Query: 66  GSFGEEAHHNAGGSIFAGYNVEDS-CIMYGVEGDVRYTVPVLA-----------DNIHSL 113
           G   E   +   G ++ GYN +     + G++ +V Y     +               + 
Sbjct: 66  GGTSEFKPNGFIGGLYTGYNFDTGNNFILGLDANVDYNNLKKSRDFITSGNPVQTTGETQ 125

Query: 114 HGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYET----GKAGEITPIAIGGTAGVGVEV 169
               G++R R GY + D  + Y   G        +    G+    +    G T G G++ 
Sbjct: 126 LRWSGAVRARAGYAI-DRFMPYIAGGVAFGGIKNSLRIGGEESSKSKTQTGWTVGAGIDY 184

Query: 170 GGLSESLVARLEYRASKYSKVEGFY-----------NTISLGVGMKF 205
              +++++ RLEYR + Y K                N I LGV  KF
Sbjct: 185 AA-TDNVLLRLEYRYTDYGKKNFGLNDLDTRGSFKTNDIRLGVAYKF 230


>gi|17987290|ref|NP_539924.1| 25 kDa outer-membrane immunogenic protein precursor [Brucella
           melitensis bv. 1 str. 16M]
 gi|23501854|ref|NP_697981.1| outer membrane protein [Brucella suis 1330]
 gi|163843239|ref|YP_001627643.1| 22 kDa outer membrane protein precursor [Brucella suis ATCC 23445]
 gi|225852477|ref|YP_002732710.1| porin [Brucella melitensis ATCC 23457]
 gi|254704272|ref|ZP_05166100.1| porin [Brucella suis bv. 3 str. 686]
 gi|254706827|ref|ZP_05168655.1| porin [Brucella pinnipedialis M163/99/10]
 gi|256061069|ref|ZP_05451225.1| porin [Brucella neotomae 5K33]
 gi|256369396|ref|YP_003106904.1| outer membrane protein, putative [Brucella microti CCM 4915]
 gi|260168691|ref|ZP_05755502.1| outer membrane protein, putative [Brucella sp. F5/99]
 gi|261314294|ref|ZP_05953491.1| outer membrane protein 25b [Brucella pinnipedialis M163/99/10]
 gi|261325071|ref|ZP_05964268.1| outer membrane protein 25b [Brucella neotomae 5K33]
 gi|261754939|ref|ZP_05998648.1| outer membrane protein 25b [Brucella suis bv. 3 str. 686]
 gi|265991062|ref|ZP_06103619.1| outer membrane protein 25b [Brucella melitensis bv. 1 str. Rev.1]
 gi|17982969|gb|AAL52188.1| 25 kDa outer-membrane immunogenic protein precursor [Brucella
           melitensis bv. 1 str. 16M]
 gi|23347791|gb|AAN29896.1| outer membrane protein, putative [Brucella suis 1330]
 gi|46251214|gb|AAS84578.1| Omp25b [Brucella neotomae]
 gi|163673962|gb|ABY38073.1| 22 kDa outer membrane protein precursor [Brucella suis ATCC 23445]
 gi|225640842|gb|ACO00756.1| porin [Brucella melitensis ATCC 23457]
 gi|255999556|gb|ACU47955.1| outer membrane protein, putative [Brucella microti CCM 4915]
 gi|261301051|gb|EEY04548.1| outer membrane protein 25b [Brucella neotomae 5K33]
 gi|261303320|gb|EEY06817.1| outer membrane protein 25b [Brucella pinnipedialis M163/99/10]
 gi|261744692|gb|EEY32618.1| outer membrane protein 25b [Brucella suis bv. 3 str. 686]
 gi|263001846|gb|EEZ14421.1| outer membrane protein 25b [Brucella melitensis bv. 1 str. Rev.1]
 gi|326408994|gb|ADZ66059.1| porin [Brucella melitensis M28]
          Length = 236

 Score =  101 bits (252), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 41/208 (19%), Positives = 67/208 (32%), Gaps = 46/208 (22%)

Query: 42  ATNRYVPIRHDFNGPYAGLSALYNGSFGEEAH---------HNAGGSIFAGYNVEDS-CI 91
                V     +NG Y G    Y       +              G ++AGYN +     
Sbjct: 31  PAPVVVAPTFTWNGAYLGGQIGYGWGRSTLSDEDTSIRVKPDGFLGGLYAGYNFDMGNNF 90

Query: 92  MYGVEGDVRYTVPVLA-----------DNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGP 140
           + GV+GD+ Y     +             + S     G++R R G  + D  + Y   G 
Sbjct: 91  VLGVDGDITYNDLDASHSDTDPDLDLTTGVDSKLRWSGAVRARMGVAM-DRWMPYIAGGV 149

Query: 141 DVAQKYETGKAGE--------ITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEG 192
                  +    +         +    G  AG GV+    +++++ RLEYR + Y   + 
Sbjct: 150 AFGNVKNSVSLTDGIESIGVSQSKTMTGWAAGAGVDYAA-TDNVIVRLEYRYTDYGHKDF 208

Query: 193 FY---------------NTISLGVGMKF 205
                            + I LGV  KF
Sbjct: 209 SVVDGDLSVEARNKFKTHDIRLGVAYKF 236


>gi|325293521|ref|YP_004279385.1| Outer membrane protein [Agrobacterium sp. H13-3]
 gi|325061374|gb|ADY65065.1| Outer membrane protein [Agrobacterium sp. H13-3]
          Length = 210

 Score =  101 bits (252), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 49/209 (23%), Positives = 79/209 (37%), Gaps = 11/209 (5%)

Query: 7   AVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNG-PYAGLSALYN 65
            + V+SL   S  +A AAD V                    P      G  +A       
Sbjct: 3   TLIVTSLLALSASTAMAADAVYETPAPPVAQETLPVFTWSGPYLGIQGGAGWANGDFSAG 62

Query: 66  GSFGEEAHHNAGGSIFAGYNVEDSC-IMYGVEGDVRYTVPVLA-DNIHSLHGIGGSLRIR 123
           G    ++        FAGYN +     + G+EGDV Y         ++      GS+R R
Sbjct: 63  GPVASDSFDGGILGAFAGYNYQFDNNFVLGIEGDVDYNWNDNDYAGVNIGTDWQGSVRGR 122

Query: 124 GGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYR 183
            GY    +L+             ET  AG+ +    G T G G++    ++++  R+EYR
Sbjct: 123 VGYAFDRALIYGTAGWTATRGFIETPGAGKDSTTFNGYTVGAGLDY-AFTDNVFGRIEYR 181

Query: 184 ASKYSK-------VEGFYNTISLGVGMKF 205
            + Y          +   +T+ +G+G+KF
Sbjct: 182 YNDYGDKDIFGVNTDFDQSTVKVGLGVKF 210


>gi|256044638|ref|ZP_05447542.1| porin [Brucella melitensis bv. 1 str. Rev.1]
 gi|326538706|gb|ADZ86921.1| porin [Brucella melitensis M5-90]
          Length = 240

 Score =  101 bits (252), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 41/208 (19%), Positives = 67/208 (32%), Gaps = 46/208 (22%)

Query: 42  ATNRYVPIRHDFNGPYAGLSALYNGSFGEEAH---------HNAGGSIFAGYNVEDS-CI 91
                V     +NG Y G    Y       +              G ++AGYN +     
Sbjct: 35  PAPVVVAPTFTWNGAYLGGQIGYGWGRSTLSDEDTSIRVKPDGFLGGLYAGYNFDMGNNF 94

Query: 92  MYGVEGDVRYTVPVLA-----------DNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGP 140
           + GV+GD+ Y     +             + S     G++R R G  + D  + Y   G 
Sbjct: 95  VLGVDGDITYNDLDASHSDTDPDLDLTTGVDSKLRWSGAVRARMGVAM-DRWMPYIAGGV 153

Query: 141 DVAQKYETGKAGE--------ITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEG 192
                  +    +         +    G  AG GV+    +++++ RLEYR + Y   + 
Sbjct: 154 AFGNVKNSVSLTDGIESIGVSQSKTMTGWAAGAGVDYAA-TDNVIVRLEYRYTDYGHKDF 212

Query: 193 FY---------------NTISLGVGMKF 205
                            + I LGV  KF
Sbjct: 213 SVVDGDLSVEARNKFKTHDIRLGVAYKF 240


>gi|306844393|ref|ZP_07476983.1| outer membrane protein [Brucella sp. BO1]
 gi|306275206|gb|EFM56956.1| outer membrane protein [Brucella sp. BO1]
          Length = 227

 Score =  101 bits (251), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 54/238 (22%), Positives = 84/238 (35%), Gaps = 47/238 (19%)

Query: 3   KLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSA 62
           KL   +  S++ L +   A AAD V         V PT            +NG Y G   
Sbjct: 2   KLKALLFASTVVLVATTGANAADAVIEQEPAPVVVAPT----------FTWNGAYLGGQI 51

Query: 63  LYNGSF----------GEEAHHNAGGSIFAGYNVEDSC-IMYGVEGDVRYTVPVLA---- 107
            Y              G+       G ++AGYN +    ++ G++GDV Y          
Sbjct: 52  GYAWGKSHFSYDSTGLGDIKPDGFLGGLYAGYNFDLGNSVVLGIDGDVTYNDVSKNIDFL 111

Query: 108 -----DNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVA----QKYETGKAGEITPIA 158
                 +  +     G++R R GY V D  L Y   G        +      +   +   
Sbjct: 112 DGNDAGSFENRLRWSGAVRARAGYAV-DRFLPYIAGGVAFGSLRNRGEFEDASFSQSKTL 170

Query: 159 IGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFY-----------NTISLGVGMKF 205
            G T G G++    +++++ RLEYR + Y   +  +           N I  GV  KF
Sbjct: 171 TGWTIGAGMDYAA-TDNVILRLEYRYTDYGNKDYGFDDAAVTNNFKTNDIRFGVAYKF 227


>gi|265994897|ref|ZP_06107454.1| outer membrane protein 25b [Brucella melitensis bv. 3 str. Ether]
 gi|262766010|gb|EEZ11799.1| outer membrane protein 25b [Brucella melitensis bv. 3 str. Ether]
          Length = 236

 Score =  101 bits (251), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 41/208 (19%), Positives = 67/208 (32%), Gaps = 46/208 (22%)

Query: 42  ATNRYVPIRHDFNGPYAGLSALYNGSFGEEAH---------HNAGGSIFAGYNVEDS-CI 91
                V     +NG Y G    Y       +              G ++AGYN +     
Sbjct: 31  PAPVVVAPTFTWNGAYLGGQIGYGWGHSTLSDEDTSIRVKPDGFLGGLYAGYNFDMGNNF 90

Query: 92  MYGVEGDVRYTVPVLA-----------DNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGP 140
           + GV+GD+ Y     +             + S     G++R R G  + D  + Y   G 
Sbjct: 91  VLGVDGDITYNDLDASHSDTDPDLDLTTGVDSKLRWSGAVRARMGVAM-DRWMPYIAGGV 149

Query: 141 DVAQKYETGKAGE--------ITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEG 192
                  +    +         +    G  AG GV+    +++++ RLEYR + Y   + 
Sbjct: 150 AFGNVKNSVSLTDGIESIGVSQSKTMTGWAAGAGVDYAA-TDNVIVRLEYRYTDYGHKDF 208

Query: 193 FY---------------NTISLGVGMKF 205
                            + I LGV  KF
Sbjct: 209 SVVDGDLSVEARNKFKTHDIRLGVAYKF 236


>gi|256113516|ref|ZP_05454350.1| porin [Brucella melitensis bv. 3 str. Ether]
          Length = 240

 Score =  101 bits (251), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 41/208 (19%), Positives = 67/208 (32%), Gaps = 46/208 (22%)

Query: 42  ATNRYVPIRHDFNGPYAGLSALYNGSFGEEAH---------HNAGGSIFAGYNVEDS-CI 91
                V     +NG Y G    Y       +              G ++AGYN +     
Sbjct: 35  PAPVVVAPTFTWNGAYLGGQIGYGWGHSTLSDEDTSIRVKPDGFLGGLYAGYNFDMGNNF 94

Query: 92  MYGVEGDVRYTVPVLA-----------DNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGP 140
           + GV+GD+ Y     +             + S     G++R R G  + D  + Y   G 
Sbjct: 95  VLGVDGDITYNDLDASHSDTDPDLDLTTGVDSKLRWSGAVRARMGVAM-DRWMPYIAGGV 153

Query: 141 DVAQKYETGKAGE--------ITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEG 192
                  +    +         +    G  AG GV+    +++++ RLEYR + Y   + 
Sbjct: 154 AFGNVKNSVSLTDGIESIGVSQSKTMTGWAAGAGVDYAA-TDNVIVRLEYRYTDYGHKDF 212

Query: 193 FY---------------NTISLGVGMKF 205
                            + I LGV  KF
Sbjct: 213 SVVDGDLSVEARNKFKTHDIRLGVAYKF 240


>gi|92115908|ref|YP_575637.1| OmpA-like transmembrane region [Nitrobacter hamburgensis X14]
 gi|91798802|gb|ABE61177.1| OmpA-like transmembrane region [Nitrobacter hamburgensis X14]
          Length = 245

 Score =  101 bits (250), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 44/224 (19%), Positives = 78/224 (34%), Gaps = 25/224 (11%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRG--VVPTIATNRYVPIRHDFNGPYA 58
           M+K+ LA  V+ + +A+   AQAAD   R +         P      +    H       
Sbjct: 18  MKKILLA-SVAIVGMAAIVPAQAADLAARPYTKAPVYEAAPIYNWTGFYLGGHVGGAFGG 76

Query: 59  GLSALYNGSFGEEAHHNAGGSIFAGYNVED-SCIMYGVEGDVRYTVPVLADNIHSLHGIG 117
             +    G           G    GY+ +     ++G+  +  +      ++   ++   
Sbjct: 77  DHNLAAPGFTRNGNDGVFMGGGQIGYDYQFSPNWVFGIGANYSFLD---TNDHPFVNRGL 133

Query: 118 GSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPI-----AIGGTAGVGVEVGGL 172
           GS+  R GY    +LL YA  G   A    T   G  T         G T G G+E    
Sbjct: 134 GSVTGRLGYTWGPALL-YAKGGYAWADTRNTNGFGGDTFSNNRIGRDGFTVGGGLEY-MF 191

Query: 173 SESLVARLEYRASKYSKVEGFY-----------NTISLGVGMKF 205
           +++    +EY+   +      +           +TI +G+  +F
Sbjct: 192 TQNWSGLIEYQYYDFGTTRTTFRNQDVRFRNDEHTIKVGLNYRF 235


>gi|265984654|ref|ZP_06097389.1| outer membrane protein 31b [Brucella sp. 83/13]
 gi|264663246|gb|EEZ33507.1| outer membrane protein 31b [Brucella sp. 83/13]
          Length = 261

 Score =  101 bits (250), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 40/256 (15%), Positives = 80/256 (31%), Gaps = 54/256 (21%)

Query: 3   KLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVV------PTIATNRYVPIRHDFNGP 56
            +     ++S+A+    SA AAD +                        Y   +      
Sbjct: 7   TVMKTALLASVAMLFTSSAMAADIIVAEPAPVAVDTFSWTGGYIGINAGYAGGKFKHPFS 66

Query: 57  YAGLSALYNGSFG-EEAHHNAGGSIFAGYNVEDSC-IMYGVEGDVRYTVP---------- 104
                   + S   +       G + AGYN + +  I+ G E D + +            
Sbjct: 67  DVEPDRGEDFSGSLDVTASGFVGGVQAGYNWQLANGIVLGGEADFQGSTVKSKLVDNGDL 126

Query: 105 -----------VLADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGE 153
                        +  + +     G++R R G+  ++ L++Y T G    +   +  A +
Sbjct: 127 SDVGVAGNLSGDESFGLETKVQWFGTVRARLGFTPTERLMVYGTGGLAYGKVKTSLSAYD 186

Query: 154 I--------TPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSK---------------- 189
                    +    G T G GVE   ++ +   + EY  +   K                
Sbjct: 187 DGESFSAGNSKTKAGWTLGAGVEY-AVTNNWTLKSEYLYTDLGKRSFNYIDEENVNVNME 245

Query: 190 VEGFYNTISLGVGMKF 205
            +  ++T+ +G+  KF
Sbjct: 246 NKVNFHTVRIGLNYKF 261


>gi|86357119|ref|YP_469011.1| outer membrane protein [Rhizobium etli CFN 42]
 gi|86281221|gb|ABC90284.1| outer membrane protein [Rhizobium etli CFN 42]
          Length = 211

 Score =  101 bits (250), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 53/206 (25%), Positives = 90/206 (43%), Gaps = 11/206 (5%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+ L   +  S+ A+A   +       + A    +     +A +  V    ++ G Y G 
Sbjct: 1   MRVLIAGLMASAFAIAGVSA------AQAADAVDQVPEAPVAQDAPVKPAGNWEGFYLGG 54

Query: 61  SALYNGSFGEEAHH--NAGGSIFAGYNVEDSCIMYGVEGDVRYTVPV-LADNIHSLHGIG 117
           +  YN        H    GG +F GYN +   I+YGVE D+ Y+     +  + + +G  
Sbjct: 55  AGTYNMGDFGSDRHTYGFGGQVFTGYNWQAGQIVYGVESDLGYSGDDVSSGGVKNKYGWN 114

Query: 118 GSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLV 177
           GS+R R GY+++   LLY T G  +     +    + +    G T G GVE   ++ ++ 
Sbjct: 115 GSVRGRVGYDMNP-FLLYGTAGLALGNVKVSDGTSDESKTNYGYTVGAGVE-AFVTNNIT 172

Query: 178 ARLEYRASKYSKVEGFYNTISLGVGM 203
            RLEYR + Y   +   ++ S   G 
Sbjct: 173 TRLEYRYTDYQSKDYDLDSGSFSRGY 198


>gi|254701730|ref|ZP_05163558.1| porin [Brucella suis bv. 5 str. 513]
 gi|261752281|ref|ZP_05995990.1| outer membrane protein 25b [Brucella suis bv. 5 str. 513]
 gi|261742034|gb|EEY29960.1| outer membrane protein 25b [Brucella suis bv. 5 str. 513]
          Length = 236

 Score =  100 bits (249), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 40/208 (19%), Positives = 66/208 (31%), Gaps = 46/208 (22%)

Query: 42  ATNRYVPIRHDFNGPYAGLSALYNGSFGEEAH---------HNAGGSIFAGYNVEDS-CI 91
                V     +NG Y G    Y       +              G ++AGYN +     
Sbjct: 31  PAPVVVAPTFTWNGAYLGGQIGYGWGRSTLSDEDTSIRVKPDGFLGGLYAGYNFDMGNNF 90

Query: 92  MYGVEGDVRYTVPVLA-----------DNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGP 140
           + GV+GD+ Y     +             + S     G++R R    + D  + Y   G 
Sbjct: 91  VLGVDGDITYNDLDASHSDTDPDLDLTTGVDSKLRWSGAVRARMSVAM-DRWMPYIAGGV 149

Query: 141 DVAQKYETGKAGE--------ITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEG 192
                  +    +         +    G  AG GV+    +++++ RLEYR + Y   + 
Sbjct: 150 AFGNVKNSVSLTDGIESIGVSQSKTMTGWAAGAGVDYAA-TDNVIVRLEYRYTDYGHKDF 208

Query: 193 FY---------------NTISLGVGMKF 205
                            + I LGV  KF
Sbjct: 209 SVVDGDLSVEARNKFKTHDIRLGVAYKF 236


>gi|222082486|ref|YP_002541851.1| outer membrane protein [Agrobacterium radiobacter K84]
 gi|221727165|gb|ACM30254.1| outer membrane protein [Agrobacterium radiobacter K84]
          Length = 230

 Score =  100 bits (249), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 42/229 (18%), Positives = 65/229 (28%), Gaps = 30/229 (13%)

Query: 5   FLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALY 64
            L       A     +A  AD             P      +    +             
Sbjct: 4   VLGSAAFLFAFGMASAAYTADLSVSTPPAAPMEQPVFTWTGFYVGLNGGGAFGGDDKFGL 63

Query: 65  NGSF------GEEAHHNAGGSIFAGYNVEDS-CIMYGVEGDVRYTVPVLADNIH-----S 112
           +         G+       G    GYN +     + G+E D +      +         S
Sbjct: 64  HSGDTFLGKFGKIEGSGFFGGGQIGYNYQVDPNWVIGLEADFQGANIHDSVTNDGAHGSS 123

Query: 113 LHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAG-----EITPIAIGGTAGVGV 167
                G+LR R GY   D+ L Y T G         G               G   G GV
Sbjct: 124 KINWFGTLRPRVGYAY-DNTLFYGTGGLAYGHIDYKGSLDGVGSFSEDKTKAGWVLGAGV 182

Query: 168 EVGGLSESLVARLEYRASKYS-----------KVEGFYNTISLGVGMKF 205
           E    ++++ A+LEY+   +            K    +++I +GV  KF
Sbjct: 183 E-HAFTDNVTAKLEYQYVDFGSFTAGGDALSSKATADFHSIRVGVNYKF 230


>gi|299134246|ref|ZP_07027439.1| outer membrane protein Omp31 [Afipia sp. 1NLS2]
 gi|298590993|gb|EFI51195.1| outer membrane protein Omp31 [Afipia sp. 1NLS2]
          Length = 209

 Score =  100 bits (249), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 39/179 (21%), Positives = 63/179 (35%), Gaps = 15/179 (8%)

Query: 41  IATNRYVPIRHDFNGPYAGLSALYNGSF---GEEAHHNAGGSIFAGYNVEDS-CIMYGVE 96
             T       + + GPY G +  YN         +     G I  GYN +     + G+E
Sbjct: 32  PYTVNQPLNGYSWAGPYLGANLGYNFGDVSNSGTSPSGFSGGIQGGYNWQFGTPWVLGLE 91

Query: 97  GDVRYTVPVLA-DNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEIT 155
            D++ T            +   G++R R GY ++ + ++Y T G    Q   T      T
Sbjct: 92  ADLQATGADDTFAAWKFSNPWYGTIRGRVGYAINPNFMIYGTGGLAFGQLKGTMPGLSET 151

Query: 156 PIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEG---------FYNTISLGVGMKF 205
               G T G G E   L+ +   + EY                    ++T+ +GV   F
Sbjct: 152 HTTAGWTVGGGAEF-ALTNNWSLKAEYMYVDLDSSNFLITGLPNGYQFSTVRVGVNYHF 209


>gi|326410582|gb|ADZ67646.1| outer membrane protein Omp31 [Brucella melitensis M28]
          Length = 229

 Score =  100 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 41/232 (17%), Positives = 75/232 (32%), Gaps = 45/232 (19%)

Query: 16  ASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSFGEEAHH- 74
               SA AAD V             + T  +       N  YAG    +  S  ++  + 
Sbjct: 1   MFATSAMAADVVVSEPSAPTAA--PVDTFSWTGGYIGINAGYAGGKFKHPFSSFDKEDNE 58

Query: 75  -----------NAGGSIFAGYNVEDSC-IMYGVEGDVRYTVPVLADNI---------HSL 113
                         G + AGYN +    ++ G E D + +    + +           + 
Sbjct: 59  QVSGSLDVTAGGFVGGVQAGYNWQLDNGVVLGAETDFQGSSVTGSISAGASGLEGKAETK 118

Query: 114 HGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYE--------TGKAGEITPIAIGGTAGV 165
               G++R R GY  ++ L++Y T G    +           +           G T G 
Sbjct: 119 VEWFGTVRARLGYTATERLMVYGTGGLAYGKVKSAFNLGDDASALHTWSDKTKAGWTLGA 178

Query: 166 GVEVGGLSESLVARLEYRASKYSK------------VEGFYNTISLGVGMKF 205
           G E   ++ +   + EY  +   K             +  ++T+ +G+  KF
Sbjct: 179 GAEY-AINNNWTLKSEYLYTDLGKRNLVDVDNSFLESKVNFHTVRVGLNYKF 229


>gi|256060263|ref|ZP_05450438.1| outer membrane protein [Brucella neotomae 5K33]
 gi|261324236|ref|ZP_05963433.1| Omp25c [Brucella neotomae 5K33]
 gi|46251235|gb|AAS84588.1| Omp25c [Brucella neotomae]
 gi|261300216|gb|EEY03713.1| Omp25c [Brucella neotomae 5K33]
          Length = 228

 Score =  100 bits (248), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 54/239 (22%), Positives = 82/239 (34%), Gaps = 48/239 (20%)

Query: 3   KLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSA 62
           KL   +  S++ L +     AAD V         V PT            +NG Y G   
Sbjct: 2   KLKALLFASTVVLVAATGTNAADAVIEQEPAPVVVAPT----------FTWNGAYLGGQI 51

Query: 63  LYNGSF----------GEEAHHNAGGSIFAGYNVEDSC-IMYGVEGDVRYTVPVLA---- 107
            Y              G+       G ++AGYN +    ++ G++GDV Y          
Sbjct: 52  GYAWGKSHFSYDSTGLGDIKPDGFLGGLYAGYNFDLGNSVVLGIDGDVTYNDVSKNIDFL 111

Query: 108 ------DNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVA----QKYETGKAGEITPI 157
                     +     G++R R GY V D  L Y   G        +    G     +  
Sbjct: 112 DENNAAATFENRLRWSGAVRARAGYAV-DRFLPYIAGGVAFGSLRNRGEFEGTGFSQSKT 170

Query: 158 AIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFY-----------NTISLGVGMKF 205
             G T G G++    +++++ RLEYR + Y   +  +           N I  GV  KF
Sbjct: 171 LTGWTIGAGMDYAA-TDNVILRLEYRYTDYGNKDYGFDDAAVTNNFKTNDIRFGVAYKF 228


>gi|328542837|ref|YP_004302946.1| OmpA-like transmembrane domain [polymorphum gilvum SL003B-26A1]
 gi|326412583|gb|ADZ69646.1| OmpA-like transmembrane domain, putative [Polymorphum gilvum
           SL003B-26A1]
          Length = 223

 Score = 99.9 bits (247), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 51/232 (21%), Positives = 84/232 (36%), Gaps = 36/232 (15%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+ L  A    ++   +   A AAD  + A        P I  N+    R D++G Y G 
Sbjct: 1   MKSLAAAGVSIAVLAGASLPAFAADLPQPA-------QPVIYDNQVSSARFDWSGFYFGG 53

Query: 61  SALYNG----------SFGEEAHHNAGGSIFAGYNVED-SCIMYGVEGDVRYTVPVL--- 106
           +  +                       G + AGYN      I+ G+E D + +       
Sbjct: 54  NLGWGWGQFTTNSALTGRFNSDASGVNGGVHAGYNHAITPNIIAGLEADFQLSDLEKRRS 113

Query: 107 --ADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAG 164
                + +      ++R R GY   D  ++Y T G  +A         +    AIG T G
Sbjct: 114 VAGVGVKTSSDWNSTIRGRLGYAF-DRFMIYGTGGLAIADLEVAAAGSKGNETAIGWTLG 172

Query: 165 VGVEVGGLSESLVARLEYRASKYS-----------KVEGFYNTISLGVGMKF 205
            G+E G +++++ ARLEY    +            + +   +    GV  KF
Sbjct: 173 AGIE-GAVTDNVTARLEYLYQDFGRESFTLGGTRYRTDLDASIARFGVSYKF 223


>gi|306843011|ref|ZP_07475638.1| 22 kDa outer membrane protein precursor [Brucella sp. BO2]
 gi|306844622|ref|ZP_07477209.1| 22 kDa outer membrane protein precursor [Brucella sp. BO1]
 gi|306275066|gb|EFM56829.1| 22 kDa outer membrane protein precursor [Brucella sp. BO1]
 gi|306286803|gb|EFM58344.1| 22 kDa outer membrane protein precursor [Brucella sp. BO2]
          Length = 253

 Score = 99.9 bits (247), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 40/252 (15%), Positives = 79/252 (31%), Gaps = 54/252 (21%)

Query: 7   AVGVSSLALASFCSAQAADPVRRAHHGGRGVV------PTIATNRYVPIRHDFNGPYAGL 60
              ++S+A+    SA AAD +                        Y   +          
Sbjct: 3   TALLASVAMLFTSSAMAADIIVAEPAPVAVDTFSWTGGYIGINAGYAGGKFKHPFSGVEQ 62

Query: 61  SALYNGSFG-EEAHHNAGGSIFAGYNVEDSC-IMYGVEGDVRYT---------------- 102
               + S   +       G + AGYN + +  I+ G E D + +                
Sbjct: 63  DGGEDFSGSLDVTGSGFVGGVQAGYNWQLANGIVLGGEADFQGSTVKSKLVDKGDLSDIG 122

Query: 103 -----VPVLADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEI--- 154
                    +  + +     G++R R G+  ++ L++Y T G    +   +  A +    
Sbjct: 123 VAGNLDGDESFGLETKVQWFGTVRARLGFTPTERLMVYGTGGLAYGKVKTSLSAYDDGES 182

Query: 155 -----TPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSK----------------VEGF 193
                +    G T G GVE   ++ +   + EY  +   K                 +  
Sbjct: 183 FSAGNSKTKAGWTLGAGVEY-AVTNNWTLKSEYLYTDLGKRSFNYIDEENVNVNMENKVN 241

Query: 194 YNTISLGVGMKF 205
           ++T+ +G+  KF
Sbjct: 242 FHTVRIGLNYKF 253


>gi|254719645|ref|ZP_05181456.1| 22 kDa outer membrane protein precursor [Brucella sp. 83/13]
 gi|306837721|ref|ZP_07470589.1| 22 kDa outer membrane protein precursor [Brucella sp. NF 2653]
 gi|306407177|gb|EFM63388.1| 22 kDa outer membrane protein precursor [Brucella sp. NF 2653]
          Length = 253

 Score = 99.9 bits (247), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 40/252 (15%), Positives = 79/252 (31%), Gaps = 54/252 (21%)

Query: 7   AVGVSSLALASFCSAQAADPVRRAHHGGRGVV------PTIATNRYVPIRHDFNGPYAGL 60
              ++S+A+    SA AAD +                        Y   +          
Sbjct: 3   TALLASVAMLFTSSAMAADIIVAEPAPVAVDTFSWTGGYIGINAGYAGGKFKHPFSDVEP 62

Query: 61  SALYNGSFG-EEAHHNAGGSIFAGYNVEDSC-IMYGVEGDVRYTVPVL------------ 106
               + S   +       G + AGYN + +  I+ G E D + +                
Sbjct: 63  DRGEDFSGSLDVTASGFVGGVQAGYNWQLANGIVLGGEADFQGSTVKSKLVDNGDLSDVG 122

Query: 107 ---------ADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEI--- 154
                    +  + +     G++R R G+  ++ L++Y T G    +   +  A +    
Sbjct: 123 VAGNLSGDESFGLETKVQWFGTVRARLGFTPTERLMVYGTGGLAYGKVKTSLSAYDDGES 182

Query: 155 -----TPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSK----------------VEGF 193
                +    G T G GVE   ++ +   + EY  +   K                 +  
Sbjct: 183 FSAGNSKTKAGWTLGAGVEY-AVTNNWTLKSEYLYTDLGKRSFNYIDEENVNVNMENKVN 241

Query: 194 YNTISLGVGMKF 205
           ++T+ +G+  KF
Sbjct: 242 FHTVRIGLNYKF 253


>gi|118591879|ref|ZP_01549274.1| outer membrane protein, putative [Stappia aggregata IAM 12614]
 gi|118435522|gb|EAV42168.1| outer membrane protein, putative [Stappia aggregata IAM 12614]
          Length = 223

 Score = 99.5 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 47/225 (20%), Positives = 80/225 (35%), Gaps = 22/225 (9%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M++L LA    + A  +     AAD  +        V     +  +  +    N  +A  
Sbjct: 1   MKRLALAGMALTAAATASAPVLAADLPQSPAPAYEAVPAPQQSIDWTGLYVGGNLGWAFG 60

Query: 61  SAL---YNGSFGEEAHHNAGGSIFAGYNVED-SCIMYGVEGDVRYTVP-----VLADNIH 111
                  N +      +   G ++ GYN +    I+ G E D   T            + 
Sbjct: 61  QFDNKAGNNTGLGVDANGIAGGLYTGYNFQVTPNIVVGAEADFSLTDLEKSKSNGGLTLR 120

Query: 112 SLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGG 171
           S      + R R GY   D  L+Y   G  +A    +G     +  A+G T G G E   
Sbjct: 121 SKSDWNSNFRGRVGYAF-DRYLVYGAGGLAIADLEVSGNGDTDSKTALGWTLGAGGE-AA 178

Query: 172 LSESLVARLEYRASKYSKVEGFYN-----------TISLGVGMKF 205
           ++ ++ A+LEY    + + +   N            + +G+G KF
Sbjct: 179 ITNNVTAKLEYVYQDFGEQDFNLNGTGVSSDFNNSQVRMGIGYKF 223


>gi|227821495|ref|YP_002825465.1| putative outer membrane protein [Sinorhizobium fredii NGR234]
 gi|227340494|gb|ACP24712.1| putative outer membrane protein [Sinorhizobium fredii NGR234]
          Length = 212

 Score = 99.1 bits (245), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 58/217 (26%), Positives = 96/217 (44%), Gaps = 17/217 (7%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+ L  A+  S++ L +F +A AAD V              A   +      + G  A  
Sbjct: 1   MRTLTTALMASAITLVAFQAAHAADAVEEIPAAPAAEYTEPAVKNWSGA---YVGGTANW 57

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTV-PVLADNIHSLHGIGGS 119
                 + G       GG ++ GYNV+D  ++YG E DV Y      +       G+ GS
Sbjct: 58  HYGEADATGNNKSVAFGGGLYGGYNVQDGQMVYGGEADVNYAGNDSTSSGRKVKQGVNGS 117

Query: 120 LRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVAR 179
           LR R G +++  +L+Y T G  +     +  AG      +G TAG G E   +++++ AR
Sbjct: 118 LRGRVGVDMNP-VLVYGTAGLALGNAKLSTPAGSDDKTLVGWTAGAGAET-FVTDNVTAR 175

Query: 180 LEYRASKYSKVEG-----------FYNTISLGVGMKF 205
           +EYR + Y+  +              +++ LG+G+KF
Sbjct: 176 VEYRYTDYASKDFRAGGSTVSSGYDEHSVRLGMGVKF 212


>gi|237814592|ref|ZP_04593590.1| Porin subfamily protein [Brucella abortus str. 2308 A]
 gi|237789429|gb|EEP63639.1| Porin subfamily protein [Brucella abortus str. 2308 A]
          Length = 239

 Score = 99.1 bits (245), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 44/200 (22%), Positives = 68/200 (34%), Gaps = 38/200 (19%)

Query: 42  ATNRYVPIRHDFNGPYAGLSALYNGSF----------GEEAHHNAGGSIFAGYNVEDSC- 90
                V     +NG Y G    Y              G+       G ++AGYN +    
Sbjct: 42  PAPVVVAPTFTWNGAYLGGQIGYAWGKSHFSYDSTGLGDIKPDGFLGGLYAGYNFDLGNS 101

Query: 91  IMYGVEGDVRYTVPVLA----------DNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGP 140
           ++ G++GDV Y                    +     G++R R GY V D  L Y   G 
Sbjct: 102 VVLGIDGDVTYNDVSKNIDFLDENNAAATFENRLRWSGAVRARAGYAV-DRFLPYIAGGV 160

Query: 141 DVA----QKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFY-- 194
                  +    G     +    G T G G++    +++++ RLEYR + Y   +  +  
Sbjct: 161 AFGSLRNRGEFEGTGFSQSKTLTGWTIGAGMDYAA-TDNVILRLEYRYTDYGNKDYGFDD 219

Query: 195 ---------NTISLGVGMKF 205
                    N I  GV  KF
Sbjct: 220 AAVTNNFKTNDIRFGVAYKF 239


>gi|150395644|ref|YP_001326111.1| porin [Sinorhizobium medicae WSM419]
 gi|150027159|gb|ABR59276.1| porin [Sinorhizobium medicae WSM419]
          Length = 225

 Score = 99.1 bits (245), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 45/230 (19%), Positives = 73/230 (31%), Gaps = 30/230 (13%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYA-G 59
           M++ FL+   ++    +     AAD                  N +    +   G     
Sbjct: 1   MKRYFLS---AAFLAGALSPVVAADLAPVESPPAISAPAAFDWNGFYLGGNVGGGRADVD 57

Query: 60  LSALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLAD-------NIHS 112
            +    G           G + AGYN +    + G E D   +             +  S
Sbjct: 58  WTYQPFGETAHHDGKGFLGGVQAGYNWQIDGFVIGAEADFLGSSIDGDTPCPNPAYSCTS 117

Query: 113 LHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITP-----IAIGGTAGVGV 167
                 ++R R GY   D+LL+YAT G  + +       G  T         G  AG GV
Sbjct: 118 DTKWLSTVRARAGYSF-DNLLVYATGGLGIGRFEIKTDDGAGTSGSTIRNDTGWVAGAGV 176

Query: 168 EVGGLSESLVARLEYRASKYS------------KVEGFYNTISLGVGMKF 205
           E G  S +   + EY    +               +  ++T  +GV  +F
Sbjct: 177 EYGF-SPNWSIKAEYMHHDFGERTYTVDGGNPVDADFRFDTGKIGVNYRF 225


>gi|90422419|ref|YP_530789.1| putative outer-membrane immunogenic protein precursor
           [Rhodopseudomonas palustris BisB18]
 gi|90104433|gb|ABD86470.1| putative outer-membrane immunogenic protein precursor
           [Rhodopseudomonas palustris BisB18]
          Length = 207

 Score = 99.1 bits (245), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 49/202 (24%), Positives = 72/202 (35%), Gaps = 22/202 (10%)

Query: 17  SFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSF---GEEAH 73
              SAQAAD           V   +         H + GPY G +  Y            
Sbjct: 15  GLSSAQAADLPYGGSRAPYTVYQPLNA-------HSWAGPYLGGNLGYAWGDVHNSATEP 67

Query: 74  HNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLA-DNIHSLHGIGGSLRIRGGYEVSDSL 132
               G + AGYN +    +YG+EGD+  T       +    +   G++R R GY   D+L
Sbjct: 68  SGVAGGVQAGYNWQSGQFVYGLEGDIAITGADDTFASWKFSNPWFGTVRGRAGYSF-DNL 126

Query: 133 LLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEG 192
           L+YAT G    +          +    G T G G E G L+++  A++EY          
Sbjct: 127 LVYATGGLAFGELKGERFGQSNSSTNAGWTIGAGAEFG-LNQNWSAKVEYLYVDLGGSNF 185

Query: 193 FYNTI---------SLGVGMKF 205
               +          +GV   F
Sbjct: 186 SITGVQNSYQFGILRVGVNYHF 207


>gi|298292421|ref|YP_003694360.1| porin [Starkeya novella DSM 506]
 gi|296928932|gb|ADH89741.1| porin [Starkeya novella DSM 506]
          Length = 215

 Score = 99.1 bits (245), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 37/190 (19%), Positives = 56/190 (29%), Gaps = 22/190 (11%)

Query: 36  GVVPTIATNRYVPIRHDFNGPYAGLSALYNGSFGEE-------AHHNAGGSIFAGYNVED 88
                            + G Y G +A Y    G+E             G    G+N + 
Sbjct: 28  PYPVKAPPAVIAEPVFSWTGFYLGANAGYAWGSGQEGAETLGLDPDGFLGGGQIGFNYQF 87

Query: 89  SC-IMYGVEGDVRYTVPVLAD-NIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKY 146
              ++ G E D + +          S     G++R R GY   + +L Y T G       
Sbjct: 88  DNNVVLGAEADFQGSDIKDERLGFESKMDYFGTVRARLGYAFGN-VLPYVTGGLAWGHTE 146

Query: 147 ETGK--AGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSK---------VEGFYN 195
              K         A+G T G GVE    + +   + EY                     N
Sbjct: 147 VNDKLLGLTSDKTAVGWTVGGGVEY-AFTNNWTVKAEYLYMDLGDDYYASIGDKSGLTAN 205

Query: 196 TISLGVGMKF 205
            +  G+  KF
Sbjct: 206 VVRAGINYKF 215


>gi|13470965|ref|NP_102534.1| outer membrane protein [Mesorhizobium loti MAFF303099]
 gi|14021708|dbj|BAB48320.1| outer membrane protein [Mesorhizobium loti MAFF303099]
          Length = 226

 Score = 99.1 bits (245), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 39/213 (18%), Positives = 63/213 (29%), Gaps = 28/213 (13%)

Query: 19  CSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSFGEEAHHNAGG 78
             A AAD +                 +        +  Y   +        +       G
Sbjct: 16  GQALAADAISAEPATAHDWSGVYVGGQIGYGFGKTDATYNLPNTPTIRGSQDYDTDGFLG 75

Query: 79  SIFAGYNVEDSCIMYGVEGDVRYTVPVL---------ADNIHSLHGIGGSLRIRGGYEVS 129
            +  GYN + +  + GVE DV                 D   +     G+LR R GY   
Sbjct: 76  GVQIGYNYQINSAVLGVEADVSGADIKGHSDEITSGLGDRYDTKVDWFGTLRARAGYAF- 134

Query: 130 DSLLLYATVGPDVAQKYETGKAGEIT-----PIAIGGTAGVGVEVGGLSESLVARLEYRA 184
           D  L+Y T G            G           +G T G G+E   +++   A+ EY+ 
Sbjct: 135 DRTLIYGTGGLAFGSVENRYVDGPFDTFSEKNTKVGWTIGAGLEQ-AITDHWSAKFEYQY 193

Query: 185 SKYSKV------------EGFYNTISLGVGMKF 205
                             +  +N + +G+  KF
Sbjct: 194 VDLRDQTIDYAPNSNTTFDNTFNAVKIGMNYKF 226


>gi|294851523|ref|ZP_06792196.1| outer membrane protein [Brucella sp. NVSL 07-0026]
 gi|294820112|gb|EFG37111.1| outer membrane protein [Brucella sp. NVSL 07-0026]
          Length = 237

 Score = 98.7 bits (244), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 44/200 (22%), Positives = 68/200 (34%), Gaps = 38/200 (19%)

Query: 42  ATNRYVPIRHDFNGPYAGLSALYNGSF----------GEEAHHNAGGSIFAGYNVEDSC- 90
                V     +NG Y G    Y              G+       G ++AGYN +    
Sbjct: 40  PAPVVVAPTFTWNGAYLGGQIGYAWGKSHFSYDSTGLGDIKPDGFLGGLYAGYNFDLGNS 99

Query: 91  IMYGVEGDVRYTVPVLA----------DNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGP 140
           ++ G++GDV Y                    +     G++R R GY V D  L Y   G 
Sbjct: 100 VVLGIDGDVTYNDVSKNIDFLDENNAAATFENHLRWSGAVRARAGYAV-DRFLPYIAGGV 158

Query: 141 DVA----QKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFY-- 194
                  +    G     +    G T G G++    +++++ RLEYR + Y   +  +  
Sbjct: 159 AFGSLRNRGEFEGTGFSQSKTLTGWTIGAGMDYAA-TDNVILRLEYRYTDYGNKDYGFDD 217

Query: 195 ---------NTISLGVGMKF 205
                    N I  GV  KF
Sbjct: 218 AAVTNNFKTNDIRFGVAYKF 237


>gi|302319025|gb|ADL14702.1| outer membrane protein 31 [Brucella melitensis]
          Length = 240

 Score = 98.7 bits (244), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 44/241 (18%), Positives = 78/241 (32%), Gaps = 45/241 (18%)

Query: 7   AVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNG 66
           +V ++S+A     SA AAD V             + T  +       N  YAG    +  
Sbjct: 3   SVILASIAAMFATSAMAADVVVSEPSAPTVA--PVDTFSWTGGYIGINAGYAGGKFKHPF 60

Query: 67  SFGEEAHH------------NAGGSIFAGYNVEDSC-IMYGVEGDVRYTVPVLADNI--- 110
           S  ++  +               G + AGYN +    ++ G E D + +    + +    
Sbjct: 61  SSFDKEDNEQVSGSLDVTAGGFVGGVQAGYNWQLDNGVVLGAETDFQGSSVTGSISAGAS 120

Query: 111 ------HSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYE--------TGKAGEITP 156
                  +     G++R R GY  ++ L++Y T G    +           +        
Sbjct: 121 GLEGKAETKVEWFGTVRARLGYTATERLMVYGTGGLAYGKVKSAFNLGDDASALHTWSDK 180

Query: 157 IAIGGTAGVGVEVGGLSESLVARLEYRASKYSK------------VEGFYNTISLGVGMK 204
              G T G G E    + +   + EY      K             +  ++T   G+  K
Sbjct: 181 TKAGWTLGAGAEY-AFNNNWTLKSEYLYPYLGKRNLVDVDNSFLESKVNFHTDRFGLNYK 239

Query: 205 F 205
           F
Sbjct: 240 F 240


>gi|240850131|ref|YP_002971524.1| hemin binding protein D [Bartonella grahamii as4aup]
 gi|240267254|gb|ACS50842.1| hemin binding protein D [Bartonella grahamii as4aup]
          Length = 272

 Score = 98.7 bits (244), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 43/279 (15%), Positives = 80/279 (28%), Gaps = 92/279 (32%)

Query: 7   AVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNG 66
            V  S  +L S    QAAD V           P             + G Y G       
Sbjct: 6   LVSTSIFSLISISVVQAADMV----------TPEQPVPVIAAPAFSWTGFYLGGQIGSFS 55

Query: 67  SFGEEAH-------------------HNAGGSIFAGYNVEDSC-IMYGVEGDVRYTVPVL 106
                ++                       G ++AG N++     + G++ D+ ++    
Sbjct: 56  GKTTASYLKDETGIWNPIGKEDLPKLSGFIGGVYAGSNIDIDNGFIIGIDTDIMWSDKKG 115

Query: 107 ADNIH------------------------------------SLHGIGGSLRIRGGYEVSD 130
             +I+                                          G+ R++ G+ + +
Sbjct: 116 TKDINRPKKSQTEEASSEETNLTRDSHEEDSTIPIEAVRHTLKQKWAGATRVKVGFAI-E 174

Query: 131 SLLLYATVGPDVAQ---------------KYETGKAGEITPIAIGGTAGVGVEVGGLSES 175
            ++ Y + G    Q                  +    +     IG T G GV+   ++++
Sbjct: 175 RVMPYVSGGIAYTQLQNIFGLVADSNNRAVNFSDWLHDEKKTMIGYTLGGGVDF-AMTDN 233

Query: 176 LVARLEYRASKYSKVEG---------FYNTISLGVGMKF 205
           ++ R EYR S + K +            N   +GV  KF
Sbjct: 234 VIVRAEYRYSDFGKKKFVHDKFEMGYKTNDFRVGVAYKF 272


>gi|153007478|ref|YP_001368693.1| porin [Ochrobactrum anthropi ATCC 49188]
 gi|151559366|gb|ABS12864.1| porin [Ochrobactrum anthropi ATCC 49188]
          Length = 229

 Score = 98.7 bits (244), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 58/230 (25%), Positives = 86/230 (37%), Gaps = 29/230 (12%)

Query: 3   KLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSA 62
           KL   +  S++AL +   A+AAD V         V PT   +          G      +
Sbjct: 2   KLKALLLASTVALVAATGAKAADAVIEQEPVPVVVAPTFTWSGAYIGGQIGYGWGKSDFS 61

Query: 63  LYNGSFGEEAHHNAGGSIFAGYNVEDSC-IMYGVEGDVRYTVPVLA----------DNIH 111
               SFG        G I+AGYN +    I+ G++GDV Y                 +  
Sbjct: 62  GDVYSFGNVKPDGFLGGIYAGYNFDLGNSIVLGIDGDVTYNDVSKDIDVYSGDLAVGDFE 121

Query: 112 SLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAG-----EITPIAIGGTAGVG 166
           +     G++R R GY V D  + Y   G        +G          +    G TAG G
Sbjct: 122 TKLRWSGAVRARVGYAV-DRFMPYLAGGVAFGNIKNSGSIDGIGSFSESKTLTGWTAGAG 180

Query: 167 VEVGGLSESLVARLEYRASKYSKVEGFY-----------NTISLGVGMKF 205
           V+    +++L+ RLEYR + Y   +  +           N + LGV  KF
Sbjct: 181 VDYAA-TDNLIVRLEYRYTDYGDKDIEFGGLNVNQDFKTNEVRLGVAYKF 229


>gi|23502485|ref|NP_698612.1| outer membrane protein Omp31 [Brucella suis 1330]
 gi|163843871|ref|YP_001628275.1| 22 kDa outer membrane protein precursor [Brucella suis ATCC 23445]
 gi|225628052|ref|ZP_03786088.1| Porin subfamily protein [Brucella ceti str. Cudo]
 gi|256370036|ref|YP_003107547.1| outer membrane protein Omp31 [Brucella microti CCM 4915]
 gi|260169279|ref|ZP_05756090.1| outer membrane protein Omp31 [Brucella sp. F5/99]
 gi|260565895|ref|ZP_05836365.1| outer membrane protein 31b [Brucella suis bv. 4 str. 40]
 gi|261219740|ref|ZP_05934021.1| outer membrane protein 31b [Brucella ceti M13/05/1]
 gi|261222753|ref|ZP_05937034.1| outer membrane protein 31b [Brucella ceti B1/94]
 gi|261315779|ref|ZP_05954976.1| outer membrane protein 31b [Brucella pinnipedialis M163/99/10]
 gi|261318224|ref|ZP_05957421.1| outer membrane protein 31b [Brucella pinnipedialis B2/94]
 gi|261322630|ref|ZP_05961827.1| outer membrane protein 31b [Brucella ceti M644/93/1]
 gi|261325677|ref|ZP_05964874.1| outer membrane protein 31b [Brucella neotomae 5K33]
 gi|261752901|ref|ZP_05996610.1| outer membrane protein 31b [Brucella suis bv. 5 str. 513]
 gi|261755562|ref|ZP_05999271.1| outer membrane protein 31b [Brucella suis bv. 3 str. 686]
 gi|261758791|ref|ZP_06002500.1| outer membrane protein 31b [Brucella sp. F5/99]
 gi|265989255|ref|ZP_06101812.1| outer membrane protein 31b [Brucella pinnipedialis M292/94/1]
 gi|265998716|ref|ZP_06111273.1| outer membrane protein 31b [Brucella ceti M490/95/1]
 gi|294852932|ref|ZP_06793605.1| outer-membrane immunogenic protein [Brucella sp. NVSL 07-0026]
 gi|23348478|gb|AAN30527.1| outer membrane protein Omp31 [Brucella suis 1330]
 gi|46251200|gb|AAS84571.1| Omp31b [Brucella neotomae]
 gi|46251202|gb|AAS84572.1| Omp31b [Brucella pinnipedialis]
 gi|46251204|gb|AAS84573.1| Omp31b [Brucella ceti]
 gi|46251206|gb|AAS84574.1| Omp31b [Brucella ceti]
 gi|46251208|gb|AAS84575.1| Omp31b [Brucella ceti]
 gi|157310319|emb|CAN43873.1| outer membrane protein 31b [Brucella microti CCM 4915]
 gi|157310321|emb|CAN43874.1| outer membrane protein 31b [Brucella microti]
 gi|163674594|gb|ABY38705.1| 22 kDa outer membrane protein precursor [Brucella suis ATCC 23445]
 gi|225617215|gb|EEH14261.1| Porin subfamily protein [Brucella ceti str. Cudo]
 gi|256000199|gb|ACU48598.1| outer membrane protein Omp31 [Brucella microti CCM 4915]
 gi|260155413|gb|EEW90493.1| outer membrane protein 31b [Brucella suis bv. 4 str. 40]
 gi|260921337|gb|EEX87990.1| outer membrane protein 31b [Brucella ceti B1/94]
 gi|260924829|gb|EEX91397.1| outer membrane protein 31b [Brucella ceti M13/05/1]
 gi|261295320|gb|EEX98816.1| outer membrane protein 31b [Brucella ceti M644/93/1]
 gi|261297447|gb|EEY00944.1| outer membrane protein 31b [Brucella pinnipedialis B2/94]
 gi|261301657|gb|EEY05154.1| outer membrane protein 31b [Brucella neotomae 5K33]
 gi|261304805|gb|EEY08302.1| outer membrane protein 31b [Brucella pinnipedialis M163/99/10]
 gi|261738775|gb|EEY26771.1| outer membrane protein 31b [Brucella sp. F5/99]
 gi|261742654|gb|EEY30580.1| outer membrane protein 31b [Brucella suis bv. 5 str. 513]
 gi|261745315|gb|EEY33241.1| outer membrane protein 31b [Brucella suis bv. 3 str. 686]
 gi|262553340|gb|EEZ09174.1| outer membrane protein 31b [Brucella ceti M490/95/1]
 gi|264661452|gb|EEZ31713.1| outer membrane protein 31b [Brucella pinnipedialis M292/94/1]
 gi|294821521|gb|EFG38520.1| outer-membrane immunogenic protein [Brucella sp. NVSL 07-0026]
          Length = 261

 Score = 98.7 bits (244), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 44/268 (16%), Positives = 85/268 (31%), Gaps = 78/268 (29%)

Query: 3   KLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSA 62
            +     ++S+A+    SA AAD +                         + G Y G++A
Sbjct: 7   TVMKTALLASVAMLFTSSAMAADIIVAEPAPVAVDT------------FSWTGGYIGINA 54

Query: 63  LYNGSFG-------------------EEAHHNAGGSIFAGYNVEDSC-IMYGVEGDVRYT 102
            Y G                      +       G + AGYN + +  ++ G E D + +
Sbjct: 55  GYAGGKFKHPFSGIEQDGAQDFSGSLDVTASGFVGGVQAGYNWQLANGLVLGGEADFQGS 114

Query: 103 VP---------------------VLADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPD 141
                                    +  + +     G++R R G+  ++ L++Y T G  
Sbjct: 115 TVKSKLVDNGDLSDIGVAGNLSGDESFGLETKVQWFGTVRARLGFTPTERLMVYGTGGLA 174

Query: 142 VAQKYETGKAGEI--------TPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSK---- 189
             +   +  A +         +    G T G GVE   ++ +   + EY  +   K    
Sbjct: 175 YGKVKTSLSAYDDGESFSAGNSKTKAGWTLGAGVEY-AVTNNWTLKSEYLYTDLGKRSFN 233

Query: 190 ------------VEGFYNTISLGVGMKF 205
                        +  ++T+ LG+  KF
Sbjct: 234 YIDEENVNINMENKVNFHTVRLGLNYKF 261


>gi|62290498|ref|YP_222291.1| Omp31-1, outer membrane protein, 31 kDa [Brucella abortus bv. 1
           str. 9-941]
 gi|82700421|ref|YP_414995.1| OmpA-like transmembrane domain-containing protein [Brucella
           melitensis biovar Abortus 2308]
 gi|237816005|ref|ZP_04595002.1| OmpA-like transmembrane domain protein [Brucella abortus str. 2308
           A]
 gi|260547029|ref|ZP_05822768.1| conserved hypothetical protein [Brucella abortus NCTC 8038]
 gi|260755331|ref|ZP_05867679.1| outer membrane protein 31b [Brucella abortus bv. 6 str. 870]
 gi|260758554|ref|ZP_05870902.1| outer membrane protein 31b [Brucella abortus bv. 4 str. 292]
 gi|260762376|ref|ZP_05874719.1| outer membrane protein 31b [Brucella abortus bv. 2 str. 86/8/59]
 gi|260884349|ref|ZP_05895963.1| Omp31b [Brucella abortus bv. 9 str. C68]
 gi|261214598|ref|ZP_05928879.1| outer membrane protein 31b [Brucella abortus bv. 3 str. Tulya]
 gi|297248879|ref|ZP_06932597.1| Omp31b [Brucella abortus bv. 5 str. B3196]
 gi|46251194|gb|AAS84568.1| Omp31b [Brucella abortus]
 gi|62196630|gb|AAX74930.1| Omp31-1, outer membrane protein, 31 kDa [Brucella abortus bv. 1
           str. 9-941]
 gi|82616522|emb|CAJ11595.1| OmpA-like transmembrane domain [Brucella melitensis biovar Abortus
           2308]
 gi|237789303|gb|EEP63514.1| OmpA-like transmembrane domain protein [Brucella abortus str. 2308
           A]
 gi|260096079|gb|EEW79956.1| conserved hypothetical protein [Brucella abortus NCTC 8038]
 gi|260668872|gb|EEX55812.1| outer membrane protein 31b [Brucella abortus bv. 4 str. 292]
 gi|260672808|gb|EEX59629.1| outer membrane protein 31b [Brucella abortus bv. 2 str. 86/8/59]
 gi|260675439|gb|EEX62260.1| outer membrane protein 31b [Brucella abortus bv. 6 str. 870]
 gi|260873877|gb|EEX80946.1| Omp31b [Brucella abortus bv. 9 str. C68]
 gi|260916205|gb|EEX83066.1| outer membrane protein 31b [Brucella abortus bv. 3 str. Tulya]
 gi|297176048|gb|EFH35395.1| Omp31b [Brucella abortus bv. 5 str. B3196]
          Length = 261

 Score = 98.3 bits (243), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 44/268 (16%), Positives = 85/268 (31%), Gaps = 78/268 (29%)

Query: 3   KLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSA 62
            +     ++S+A+    SA AAD +                         + G Y G++A
Sbjct: 7   TVMKTALLASVAMLFTSSAMAADIIVAEPAPVAVDT------------FSWTGGYIGINA 54

Query: 63  LYNGSFG-------------------EEAHHNAGGSIFAGYNVEDSC-IMYGVEGDVRYT 102
            Y G                      +       G + AGYN + +  ++ G E D + +
Sbjct: 55  GYAGGKFKHPFSGIEQDGAQDFSGSLDVTASGFVGGVQAGYNWQLANGLVLGGEADFQGS 114

Query: 103 VP---------------------VLADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPD 141
                                    +  + +     G++R R G+  ++ L++Y T G  
Sbjct: 115 TVKSKLVDNGDLSDIGVAGNLSGDESFVLETKVQWFGTVRARLGFTPTERLMVYGTGGLA 174

Query: 142 VAQKYETGKAGEI--------TPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSK---- 189
             +   +  A +         +    G T G GVE   ++ +   + EY  +   K    
Sbjct: 175 YGKVKTSLSAYDDGESFSAGNSKTKAGWTLGAGVEY-AVTNNWTLKSEYLYTDLGKRSFN 233

Query: 190 ------------VEGFYNTISLGVGMKF 205
                        +  ++T+ LG+  KF
Sbjct: 234 YIDEENVNINMENKVNFHTVRLGLNYKF 261


>gi|256254959|ref|ZP_05460495.1| porin [Brucella ceti B1/94]
 gi|261222144|ref|ZP_05936425.1| Omp25b [Brucella ceti B1/94]
 gi|265998108|ref|ZP_06110665.1| Omp25b [Brucella ceti M490/95/1]
 gi|46251220|gb|AAS84581.1| Omp25b [Brucella ceti]
 gi|46251222|gb|AAS84582.1| Omp25b [Brucella ceti]
 gi|260920728|gb|EEX87381.1| Omp25b [Brucella ceti B1/94]
 gi|262552576|gb|EEZ08566.1| Omp25b [Brucella ceti M490/95/1]
          Length = 236

 Score = 98.3 bits (243), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 35/182 (19%), Positives = 60/182 (32%), Gaps = 31/182 (17%)

Query: 42  ATNRYVPIRHDFNGPYAGLSALYNGSFGEEAH---------HNAGGSIFAGYNVEDS-CI 91
                V     +NG Y G    Y       +              G ++AGYN +     
Sbjct: 31  PAPVVVAPTFTWNGAYLGGQIGYGWGRSTLSDEDTSIRVKPDGFLGGLYAGYNFDMGNNF 90

Query: 92  MYGVEGDVRYTVPVLA-----------DNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGP 140
           + GV+GD+ Y     +             + S     G++R R G  + D  + Y   G 
Sbjct: 91  VLGVDGDITYNDLDASHSDTDPDLDLTTGVDSKLRWSGAVRARMGVAM-DRWMPYIAGGV 149

Query: 141 DVAQKYETGKAGE--------ITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEG 192
                  +    +         +    G  AG GV+    +++++ RLEYR + Y   + 
Sbjct: 150 AFGNVKNSVSLTDGIESIGVSQSKTMTGWAAGAGVDYAA-TDNVIVRLEYRYTDYGHKDF 208

Query: 193 FY 194
             
Sbjct: 209 SV 210


>gi|306840766|ref|ZP_07473513.1| outer membrane protein Omp31 [Brucella sp. BO2]
 gi|306289161|gb|EFM60410.1| outer membrane protein Omp31 [Brucella sp. BO2]
          Length = 223

 Score = 98.3 bits (243), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 39/226 (17%), Positives = 72/226 (31%), Gaps = 45/226 (19%)

Query: 22  QAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSFGEEAHH------- 74
            AAD V             + T  +       N  YAG    +  S  +   +       
Sbjct: 1   MAADVVVSEPSAPTTA--PVDTFSWTGGYIGINAGYAGGKFKHPFSAFDTDDNERVSGSL 58

Query: 75  -----NAGGSIFAGYNVEDSC-IMYGVEGDVRYTVPVLADNIH---------SLHGIGGS 119
                   G + AGYN +    ++ G E D + +    + +           +     G+
Sbjct: 59  NITSGGFVGGVQAGYNWQLDNGVVLGAETDFQGSSVTGSISADAGGLEGKAETKVEWFGT 118

Query: 120 LRIRGGYEVSDSLLLYATVGPDVAQKY--------ETGKAGEITPIAIGGTAGVGVEVGG 171
           +R R GY  ++ L++Y T G    +           +           G T G G E   
Sbjct: 119 VRARLGYTATERLMVYGTGGLAYGKVKSAFNLGDDVSALHTWSDKTKAGWTLGAGAEY-A 177

Query: 172 LSESLVARLEYRASKYSK------------VEGFYNTISLGVGMKF 205
           ++ +   + EY  +   K             +  ++T+ +G+  KF
Sbjct: 178 INNNWTLKSEYLYTDLGKRNLIDVDDSFLESKVNFHTVRVGLNYKF 223


>gi|256159691|ref|ZP_05457444.1| porin [Brucella ceti M490/95/1]
          Length = 240

 Score = 98.3 bits (243), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 35/182 (19%), Positives = 60/182 (32%), Gaps = 31/182 (17%)

Query: 42  ATNRYVPIRHDFNGPYAGLSALYNGSFGEEAH---------HNAGGSIFAGYNVEDS-CI 91
                V     +NG Y G    Y       +              G ++AGYN +     
Sbjct: 35  PAPVVVAPTFTWNGAYLGGQIGYGWGRSTLSDEDTSIRVKPDGFLGGLYAGYNFDMGNNF 94

Query: 92  MYGVEGDVRYTVPVLA-----------DNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGP 140
           + GV+GD+ Y     +             + S     G++R R G  + D  + Y   G 
Sbjct: 95  VLGVDGDITYNDLDASHSDTDPDLDLTTGVDSKLRWSGAVRARMGVAM-DRWMPYIAGGV 153

Query: 141 DVAQKYETGKAGE--------ITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEG 192
                  +    +         +    G  AG GV+    +++++ RLEYR + Y   + 
Sbjct: 154 AFGNVKNSVSLTDGIESIGVSQSKTMTGWAAGAGVDYAA-TDNVIVRLEYRYTDYGHKDF 212

Query: 193 FY 194
             
Sbjct: 213 SV 214


>gi|225626662|ref|ZP_03784701.1| Porin subfamily protein [Brucella ceti str. Cudo]
 gi|225618319|gb|EEH15362.1| Porin subfamily protein [Brucella ceti str. Cudo]
          Length = 239

 Score = 97.9 bits (242), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 44/200 (22%), Positives = 69/200 (34%), Gaps = 38/200 (19%)

Query: 42  ATNRYVPIRHDFNGPYAGLSALYNGSF----------GEEAHHNAGGSIFAGYNVEDSC- 90
                V +   +NG Y G    Y              G+       G ++AGYN +    
Sbjct: 42  PAPVVVALTFTWNGAYLGGQIGYAWGKSHFSYDSTGLGDIKPDGFLGGLYAGYNFDLGNS 101

Query: 91  IMYGVEGDVRYTVPVLA----------DNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGP 140
           ++ G++GDV Y                    +     G++R R GY V D  L Y   G 
Sbjct: 102 VVLGIDGDVTYNDVSKNIDFLDENNAAATFENRLRWSGAVRARAGYAV-DRFLPYIAGGV 160

Query: 141 DVA----QKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFY-- 194
                  +    G     +    G T G G++    +++++ RLEYR + Y   +  +  
Sbjct: 161 AFGSLRNRGEFEGTGFSQSKTLTGWTIGAGMDYAA-TDNVILRLEYRYTDYGNKDYGFDD 219

Query: 195 ---------NTISLGVGMKF 205
                    N I  GV  KF
Sbjct: 220 AAVTNNFKTNDIRFGVAYKF 239


>gi|327189607|gb|EGE56759.1| outer membrane protein [Rhizobium etli CNPAF512]
          Length = 207

 Score = 97.9 bits (242), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 43/204 (21%), Positives = 75/204 (36%), Gaps = 10/204 (4%)

Query: 10  VSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSFG 69
            ++       +A AAD V+ A        P    +          G +        G+  
Sbjct: 6   ATAFLALVATTAFAADVVQEAPTAPVAAAPVFTWSGPYFGIDGGAG-WLNGDFSAGGASA 64

Query: 70  EEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLAD-NIHSLHGIGGSLRIRGGYEV 128
           +E  +      FAGYN +   I+ G+EG++ +                 G++R R GY  
Sbjct: 65  DEDFNGGVFGAFAGYNFQFDNIVVGIEGNIEHNWNEEDALGADVGTDWAGAVRGRVGYAF 124

Query: 129 SDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYS 188
             +L+  A          +     + T    G T G GV+   ++ ++ AR EYR + Y 
Sbjct: 125 DKALIYGAAGWAATRGYVDAPGFDKETETFNGYTVGAGVDF-AITNNIFARGEYRYNDYG 183

Query: 189 -------KVEGFYNTISLGVGMKF 205
                   V+   + +  G+G+KF
Sbjct: 184 EKDILGVDVDLDQHELKFGIGVKF 207


>gi|27382580|ref|NP_774109.1| outer-membrane immunogenic protein [Bradyrhizobium japonicum USDA
           110]
 gi|27355752|dbj|BAC52734.1| bll7469 [Bradyrhizobium japonicum USDA 110]
          Length = 208

 Score = 97.6 bits (241), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 50/201 (24%), Positives = 73/201 (36%), Gaps = 23/201 (11%)

Query: 18  FCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSFGEEAHH--- 74
             SA+AAD             P  A        + + GPY G +  Y     +       
Sbjct: 18  TASAEAADLSYGQRAPYTVNQPLNA--------YSWAGPYLGGNIGYEWGSVDNNPSKPS 69

Query: 75  NAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLA-DNIHSLHGIGGSLRIRGGYEVSDSLL 133
              G I AGYN ++   ++GVEGD++              +   G+LR R GY  S+ +L
Sbjct: 70  GFVGGIQAGYNFQNGPWVFGVEGDIQAAGADDTFAPWKFSNPWFGTLRGRVGYAFSN-VL 128

Query: 134 LYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKV--- 190
            Y T G    +          +  + G T G G EVG L+ +  A+LEY     S     
Sbjct: 129 FYGTAGLAFGELRAQTFGWTESHTSAGWTIGAGAEVG-LAPNWSAKLEYLYIDLSTSQFA 187

Query: 191 ------EGFYNTISLGVGMKF 205
                     + +  GV   F
Sbjct: 188 ITGVSNGYTASVVRAGVNYHF 208


>gi|148559219|ref|YP_001258157.1| putative outer membrane protein [Brucella ovis ATCC 25840]
 gi|46251231|gb|AAS84586.1| Omp25c [Brucella ovis]
 gi|148370476|gb|ABQ60455.1| putative outer membrane protein [Brucella ovis ATCC 25840]
          Length = 228

 Score = 97.6 bits (241), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 44/200 (22%), Positives = 68/200 (34%), Gaps = 38/200 (19%)

Query: 42  ATNRYVPIRHDFNGPYAGLSALYNGSF----------GEEAHHNAGGSIFAGYNVEDSC- 90
                V     +NG Y G    Y              G+       G ++AGYN +    
Sbjct: 31  PAPVVVAPTFTWNGAYLGGQIGYAWGKSHFSYDPTDLGDIKPDGFLGGLYAGYNFDLGNS 90

Query: 91  IMYGVEGDVRYTVPVLA----------DNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGP 140
           ++ G++GDV Y                    +     G++R R GY V D  L Y   G 
Sbjct: 91  VVLGIDGDVTYNDVSKNIDFLDENNAAATFENRLRWSGAVRARAGYAV-DRFLPYIAGGV 149

Query: 141 DVA----QKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFY-- 194
                  +    G     +    G T G G++    +++++ RLEYR + Y   +  +  
Sbjct: 150 AFGSLRNRGEFEGAGFSQSKTLTGWTIGAGMDYAA-TDNVILRLEYRYTDYGNKDYGFDD 208

Query: 195 ---------NTISLGVGMKF 205
                    N I  GV  KF
Sbjct: 209 AAVTNNFKTNDIRFGVAYKF 228


>gi|254702337|ref|ZP_05164165.1| 22 kDa outer membrane protein precursor [Brucella suis bv. 5 str.
           513]
 gi|254704867|ref|ZP_05166695.1| 22 kDa outer membrane protein precursor [Brucella suis bv. 3 str.
           686]
 gi|254708278|ref|ZP_05170106.1| 22 kDa outer membrane protein precursor [Brucella pinnipedialis
           M163/99/10]
 gi|254710652|ref|ZP_05172463.1| 22 kDa outer membrane protein precursor [Brucella pinnipedialis
           B2/94]
 gi|254714835|ref|ZP_05176646.1| 22 kDa outer membrane protein precursor [Brucella ceti M644/93/1]
 gi|254717892|ref|ZP_05179703.1| 22 kDa outer membrane protein precursor [Brucella ceti M13/05/1]
 gi|256032146|ref|ZP_05445760.1| 22 kDa outer membrane protein precursor [Brucella pinnipedialis
           M292/94/1]
 gi|256061667|ref|ZP_05451806.1| 22 kDa outer membrane protein precursor [Brucella neotomae 5K33]
 gi|256160342|ref|ZP_05458035.1| 22 kDa outer membrane protein precursor [Brucella ceti M490/95/1]
 gi|256255546|ref|ZP_05461082.1| 22 kDa outer membrane protein precursor [Brucella ceti B1/94]
          Length = 253

 Score = 97.6 bits (241), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 44/264 (16%), Positives = 84/264 (31%), Gaps = 78/264 (29%)

Query: 7   AVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNG 66
              ++S+A+    SA AAD +                         + G Y G++A Y G
Sbjct: 3   TALLASVAMLFTSSAMAADIIVAEPAPVAVDT------------FSWTGGYIGINAGYAG 50

Query: 67  SFG-------------------EEAHHNAGGSIFAGYNVEDSC-IMYGVEGDVRYTVPVL 106
                                 +       G + AGYN + +  ++ G E D + +    
Sbjct: 51  GKFKHPFSGIEQDGAQDFSGSLDVTASGFVGGVQAGYNWQLANGLVLGGEADFQGSTVKS 110

Query: 107 ---------------------ADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQK 145
                                +  + +     G++R R G+  ++ L++Y T G    + 
Sbjct: 111 KLVDNGDLSDIGVAGNLSGDESFGLETKVQWFGTVRARLGFTPTERLMVYGTGGLAYGKV 170

Query: 146 YETGKAGEI--------TPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSK-------- 189
             +  A +         +    G T G GVE   ++ +   + EY  +   K        
Sbjct: 171 KTSLSAYDDGESFSAGNSKTKAGWTLGAGVEY-AVTNNWTLKSEYLYTDLGKRSFNYIDE 229

Query: 190 --------VEGFYNTISLGVGMKF 205
                    +  ++T+ LG+  KF
Sbjct: 230 ENVNINMENKVNFHTVRLGLNYKF 253


>gi|163759157|ref|ZP_02166243.1| outer membrane protein [Hoeflea phototrophica DFL-43]
 gi|162283561|gb|EDQ33846.1| outer membrane protein [Hoeflea phototrophica DFL-43]
          Length = 212

 Score = 97.2 bits (240), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 57/217 (26%), Positives = 87/217 (40%), Gaps = 17/217 (7%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+   LA+  ++L++       AAD +               +  +        G Y   
Sbjct: 1   MRIRKLALLAAALSVPLATPVLAADAILEQPPVPPVAETLPQSFIWTGGYVGGYGEYKWG 60

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLA-DNIHSLHGIGGS 119
                     +           GYN +   I+YGVEGD+ Y+    +   +    G  GS
Sbjct: 61  EFDALAGDDADGFGGGVY---GGYNWQSDNIVYGVEGDLGYSGADASLGGVTGEQGFNGS 117

Query: 120 LRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVAR 179
           LR R GY+++   LLYAT G    +   T  AG  T   +G TAG G E   ++E++  R
Sbjct: 118 LRARLGYDINP-FLLYATGGLAATRAEVTSAAGSDTNTHLGWTAGAGAE-AFVTENITTR 175

Query: 180 LEYRASKYS-----------KVEGFYNTISLGVGMKF 205
           LEYR + Y                  +++ LG+GMKF
Sbjct: 176 LEYRYTDYGSETYNLGGTNVSSGFDDHSVRLGIGMKF 212


>gi|189024724|ref|YP_001935492.1| OmpA-like transmembrane domain protein [Brucella abortus S19]
 gi|254689800|ref|ZP_05153054.1| OmpA-like transmembrane domain-containing protein [Brucella abortus
           bv. 6 str. 870]
 gi|254694291|ref|ZP_05156119.1| OmpA-like transmembrane domain-containing protein [Brucella abortus
           bv. 3 str. Tulya]
 gi|254697943|ref|ZP_05159771.1| OmpA-like transmembrane domain-containing protein [Brucella abortus
           bv. 2 str. 86/8/59]
 gi|254730834|ref|ZP_05189412.1| OmpA-like transmembrane domain-containing protein [Brucella abortus
           bv. 4 str. 292]
 gi|256258053|ref|ZP_05463589.1| OmpA-like transmembrane domain-containing protein [Brucella abortus
           bv. 9 str. C68]
 gi|189020296|gb|ACD73018.1| OmpA-like transmembrane domain protein [Brucella abortus S19]
          Length = 253

 Score = 97.2 bits (240), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 44/264 (16%), Positives = 84/264 (31%), Gaps = 78/264 (29%)

Query: 7   AVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNG 66
              ++S+A+    SA AAD +                         + G Y G++A Y G
Sbjct: 3   TALLASVAMLFTSSAMAADIIVAEPAPVAVDT------------FSWTGGYIGINAGYAG 50

Query: 67  SFG-------------------EEAHHNAGGSIFAGYNVEDSC-IMYGVEGDVRYTVPVL 106
                                 +       G + AGYN + +  ++ G E D + +    
Sbjct: 51  GKFKHPFSGIEQDGAQDFSGSLDVTASGFVGGVQAGYNWQLANGLVLGGEADFQGSTVKS 110

Query: 107 ---------------------ADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQK 145
                                +  + +     G++R R G+  ++ L++Y T G    + 
Sbjct: 111 KLVDNGDLSDIGVAGNLSGDESFVLETKVQWFGTVRARLGFTPTERLMVYGTGGLAYGKV 170

Query: 146 YETGKAGEI--------TPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSK-------- 189
             +  A +         +    G T G GVE   ++ +   + EY  +   K        
Sbjct: 171 KTSLSAYDDGESFSAGNSKTKAGWTLGAGVEY-AVTNNWTLKSEYLYTDLGKRSFNYIDE 229

Query: 190 --------VEGFYNTISLGVGMKF 205
                    +  ++T+ LG+  KF
Sbjct: 230 ENVNINMENKVNFHTVRLGLNYKF 253


>gi|241518381|ref|YP_002979009.1| porin [Rhizobium leguminosarum bv. trifolii WSM1325]
 gi|240862794|gb|ACS60458.1| porin [Rhizobium leguminosarum bv. trifolii WSM1325]
          Length = 207

 Score = 97.2 bits (240), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 39/196 (19%), Positives = 69/196 (35%), Gaps = 10/196 (5%)

Query: 18  FCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSFGEEAHHNAG 77
             +A AAD V           P    +          G +        G+   E  +   
Sbjct: 14  STTALAADAVPVISDAPVAAAPAFTWSGPYLGIDGGAG-WLNGDFSAGGASASEDFNGGI 72

Query: 78  GSIFAGYNVEDSCIMYGVEGDVRYTVPVLAD-NIHSLHGIGGSLRIRGGYEVSDSLLLYA 136
              F GYN +   I+ G+EG++ +                 G++R R GY    +L+  A
Sbjct: 73  FGGFVGYNFQFDNIVVGIEGNLEHNWNEEEALGADVGTDWTGAVRGRVGYAFDKALIYGA 132

Query: 137 TVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYS-------K 189
                     +     + T    G T G G++   ++ ++ AR EYR + +         
Sbjct: 133 AGWTATRGYVDLPGLDKETETFNGYTVGAGLDF-AITNNIFARGEYRYNDFGEKDVLGVD 191

Query: 190 VEGFYNTISLGVGMKF 205
           V+   + +  G+G+KF
Sbjct: 192 VDLDQHELKFGIGVKF 207


>gi|75674387|ref|YP_316808.1| outer membrane protein [Nitrobacter winogradskyi Nb-255]
 gi|74419257|gb|ABA03456.1| possible outer membrane protein [Nitrobacter winogradskyi Nb-255]
          Length = 453

 Score = 96.8 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 46/234 (19%), Positives = 74/234 (31%), Gaps = 35/234 (14%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGP---Y 57
           M+K+ L V ++S A+    SAQAAD   R +     + P           +   G     
Sbjct: 1   MKKILLGVLLASTAM----SAQAADLAPRPYTKAPPIAPVYDWTGLYVGVNAGLGLGRNR 56

Query: 58  AGLSALYNGSFGEEAHHNAGGSIFAGYNVE----DSCIMYGVEGDVRYTVPVLADNIHSL 113
           A                 A G    GYN +       +++G+E D++           + 
Sbjct: 57  AVHDFGVGAISTHLQPLGAVGGGQIGYNWQTNSFFGPLVFGIEADIQGADMTDNRTNFAG 116

Query: 114 -------HGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYET----GKAGEITPIAIGGT 162
                      G+ R R G  ++  +L Y T G        T    G     +    G T
Sbjct: 117 LLQYNQRLDWFGTARGRVG-LINGPMLTYVTGGWAYGHVGTTVIQGGVPFAFSGGRNGWT 175

Query: 163 AGVGVEVGGLSESLVARLEYRASKYSKVEGFY-----------NTISLGVGMKF 205
            G GVE   L  +   ++EY    +      +           N    G+  +F
Sbjct: 176 FGSGVE-AALGGNWTGKIEYLYLDFGNRTDSFAGQALRSEMRENIFRAGLNYRF 228



 Score = 74.4 bits (181), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 29/174 (16%), Positives = 45/174 (25%), Gaps = 39/174 (22%)

Query: 70  EEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNI-----------HSLHGIGG 118
             A     G    GYN +   I+ G+E D +                     +S     G
Sbjct: 273 NLAPDGFVGGGQIGYNWQAGNIVLGLETDFQGATLQDNKTCIGCVPGASFDFNSKLQWFG 332

Query: 119 SLRIRGGYEVSDSLLLYATVGPDVAQKY----ETGKAGEITPIAIGGTAGVGVEV----- 169
           ++R R GY V +S + YAT G                   +    G   G G+E      
Sbjct: 333 TVRGRLGYAVGNS-MFYATGGFAYGNIRTALNTPLNNFNFSNTRTGYAVGGGIETPLPMV 391

Query: 170 -----GGLSESLVARLEYRASKYSKVEGFY-------------NTISLGVGMKF 205
                     +  +  EY      +                  +    G+   F
Sbjct: 392 NLFGGPLFGPNWTSTTEYLFVDLGRSSFNIGGGPNVLTTGAQEHIFRTGLNYHF 445


>gi|209886326|ref|YP_002290183.1| outer membrane protein Omp31 [Oligotropha carboxidovorans OM5]
 gi|209874522|gb|ACI94318.1| outer membrane protein Omp31 [Oligotropha carboxidovorans OM5]
          Length = 208

 Score = 96.8 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 36/177 (20%), Positives = 65/177 (36%), Gaps = 13/177 (7%)

Query: 41  IATNRYVPIRHDFNGPYAGLSALYNGSFGEEAHH---NAGGSIFAGYNVEDSC-IMYGVE 96
             T         + GPY G +  YN      +        G +  GYN +     ++G+E
Sbjct: 33  PYTVNQPLNGFSWAGPYLGANLGYNWGSVSNSGTNPTGFAGGVQGGYNWQFGSPWVFGLE 92

Query: 97  GDVRYTVPVLA-DNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEIT 155
            D++ T            +   G++R R GY ++ + +LY T G    +   +      +
Sbjct: 93  ADIQATGADDTFAAWKFSNPWYGTVRGRVGYALNPNFMLYGTGGLAFGELKGSTPFYSAS 152

Query: 156 PIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEG-------FYNTISLGVGMKF 205
            ++ G T G G E   L+ +   + EY                  ++T+ +GV   F
Sbjct: 153 HVSAGWTVGAGAEF-ALNNAWSLKAEYLYVDLDSSNINGLPNGYNFSTVRVGVNYHF 208


>gi|306842592|ref|ZP_07475241.1| outer membrane protein [Brucella sp. BO2]
 gi|306287237|gb|EFM58725.1| outer membrane protein [Brucella sp. BO2]
          Length = 228

 Score = 96.8 bits (239), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 45/200 (22%), Positives = 69/200 (34%), Gaps = 38/200 (19%)

Query: 42  ATNRYVPIRHDFNGPYAGLSALYNGSF----------GEEAHHNAGGSIFAGYNVEDSC- 90
                V     +NG Y G    Y              G+       G ++AGYN +    
Sbjct: 31  PAPVVVAPTFTWNGAYLGGQIGYAWGKSHFSYDSTGLGDIKPDGFLGGLYAGYNFDLGNS 90

Query: 91  IMYGVEGDVRYTVP----------VLADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGP 140
           ++ G++GDV Y               A    +     G++R R GY V D  L Y   G 
Sbjct: 91  VVLGIDGDVTYNDVSKKIDFLDENDAAATFENRLRWSGAVRARAGYAV-DRFLPYIAGGV 149

Query: 141 DVA----QKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFY-- 194
                  +    G     +    G T G G++    +++++ RLEYR + Y   +  +  
Sbjct: 150 AFGSLRNRGEFEGTGFSQSKTLTGWTIGAGMDYAA-TDNVILRLEYRYTDYGDKDYGFDD 208

Query: 195 ---------NTISLGVGMKF 205
                    N I  GV  KF
Sbjct: 209 AAVTNNFKTNDIRFGVAYKF 228


>gi|294853764|ref|ZP_06794436.1| outer-membrane immunogenic protein [Brucella sp. NVSL 07-0026]
 gi|294819419|gb|EFG36419.1| outer-membrane immunogenic protein [Brucella sp. NVSL 07-0026]
 gi|326553873|gb|ADZ88512.1| outer membrane protein Omp31 [Brucella melitensis M5-90]
          Length = 223

 Score = 96.8 bits (239), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 39/226 (17%), Positives = 73/226 (32%), Gaps = 45/226 (19%)

Query: 22  QAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSFGEEAHH------- 74
            AAD V             + T  +       N  YAG    +  S  ++  +       
Sbjct: 1   MAADVVVSEPSAPTAA--PVDTFSWTGGYIGINAGYAGGKFKHPFSSFDKEDNEQVSGSL 58

Query: 75  -----NAGGSIFAGYNVEDSC-IMYGVEGDVRYTVPVLADNI---------HSLHGIGGS 119
                   G + AGYN +    ++ G E D + +    + +           +     G+
Sbjct: 59  DVTAGGFVGGVQAGYNWQLDNGVVLGAETDFQGSSVTGSISAGASGLEGKAETKVEWFGT 118

Query: 120 LRIRGGYEVSDSLLLYATVGPDVAQKYE--------TGKAGEITPIAIGGTAGVGVEVGG 171
           +R R GY  ++ L++Y T G    +           +           G T G G E   
Sbjct: 119 VRARLGYTATERLMVYGTGGLAYGKVKSAFNLGDDASALHTWSDKTKAGWTLGAGAEY-A 177

Query: 172 LSESLVARLEYRASKYSK------------VEGFYNTISLGVGMKF 205
           ++ +   + EY  +   K             +  ++T+ +G+  KF
Sbjct: 178 INNNWTLKSEYLYTDLGKRNLVDVDNSFLESKVNFHTVRVGLNYKF 223


>gi|75676711|ref|YP_319132.1| putative outer-membrane immunogenic protein precursor [Nitrobacter
           winogradskyi Nb-255]
 gi|74421581|gb|ABA05780.1| putative outer-membrane immunogenic protein precursor [Nitrobacter
           winogradskyi Nb-255]
          Length = 206

 Score = 96.8 bits (239), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 46/218 (21%), Positives = 82/218 (37%), Gaps = 25/218 (11%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M ++ +A   +  + A   +A AAD   RA            T         + GPY G 
Sbjct: 1   MTRITIAALAAMASTALIGAAHAADFSYRAP----------YTVNQPLDAFSWAGPYLGG 50

Query: 61  SALYNGSFGEEA---HHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLA-DNIHSLHGI 116
           +  Y     + +        G + AG+N +   +++G+EGD++              +  
Sbjct: 51  NLGYAWGSVQNSLTRPDGVFGGVQAGFNWQSGPVVFGLEGDIQANAANDTFAAWKFSNPW 110

Query: 117 GGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESL 176
            G++R R GY  ++ +L+Y T G    +          +  + G T GVG EVG + ++ 
Sbjct: 111 FGTVRGRIGYAFNN-VLVYGTGGLAFGKLRAETFGLSESHTSAGWTVGVGAEVG-IYQNW 168

Query: 177 VARLEYRASKYSKVEGFYN---------TISLGVGMKF 205
            A++EY     S                 +  G+   F
Sbjct: 169 TAKVEYLYVDLSSSSFTITGAPHSYQSGMVRAGINYHF 206


>gi|90409178|ref|ZP_01217293.1| outer membrane protein OmpA [Psychromonas sp. CNPT3]
 gi|90309723|gb|EAS37893.1| outer membrane protein OmpA [Psychromonas sp. CNPT3]
          Length = 326

 Score = 96.8 bits (239), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 29/165 (17%), Positives = 61/165 (36%), Gaps = 10/165 (6%)

Query: 46  YVPIRHDFNGPYAGLSALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPV 105
           Y+  +  ++         Y     +    + G  +F GY+  D   + G   +       
Sbjct: 29  YIGAKAGWSKYQDACLYGY----TKCEEDSLGYGLFVGYDFTDWFAIEGGVTNHNEVNSS 84

Query: 106 LADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKA-GEITPIAIGGTAG 164
             +       I   L  + GY ++D++ LY  VG       +T    G+ +  + GG   
Sbjct: 85  YQNYDVEALAISSDLSTKFGYRLTDNVQLYTKVGISYQHINKTMSDLGDFSGSSFGGLVA 144

Query: 165 VGVEVGGLSESLVARLEYRAS----KYSKVEGFYNTISLGVGMKF 205
           +G++   L  +   R EY+        + ++   +  S+G+  +F
Sbjct: 145 MGIDY-KLDNNWSLRGEYQFIDGIGDDTSLKADLHFTSVGIKYRF 188


>gi|227821981|ref|YP_002825952.1| outer membrane protein [Sinorhizobium fredii NGR234]
 gi|227340981|gb|ACP25199.1| outer membrane protein [Sinorhizobium fredii NGR234]
          Length = 216

 Score = 96.4 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 47/206 (22%), Positives = 74/206 (35%), Gaps = 15/206 (7%)

Query: 14  ALASFCSAQAADPVRRAHHGGRGVVPTIATNR-YVPIRHDFNGPYAGLSALYNGSFGEEA 72
           A  +     AAD           +  T         +     G +        G+   E 
Sbjct: 12  ASLAAGPTYAADITEAPEPAPAILETTPTFVWTGGYVGLQGGGGWLNSDLSVPGASASED 71

Query: 73  HHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLA-----DNIHSLHGIGGSLRIRGGYE 127
                   FAGYN +    + GVEGDV Y     +      +      + GS+R R GY 
Sbjct: 72  FSGGLFGAFAGYNYQMGDWVVGVEGDVSYNWNDKSFTVFGASTEVGTDVSGSVRGRVGYT 131

Query: 128 VSDSLLLYATVGPDVAQKYETGKAGE-ITPIAIGGTAGVGVEVGGLSESLVARLEYRASK 186
           +++  LLY T G  V + +              G T G G++    + S+  R EYR + 
Sbjct: 132 LNEKALLYGTGGWAVTRGFVDVAGAPKEKETFNGWTIGGGIDY-AFTNSMFGRAEYRYND 190

Query: 187 YS-------KVEGFYNTISLGVGMKF 205
           +         V+   +  ++GVG+KF
Sbjct: 191 FGDKDVGGVDVDLDQHQFTVGVGVKF 216


>gi|17988112|ref|NP_540746.1| 25 kDa outer-membrane immunogenic protein precursor [Brucella
           melitensis bv. 1 str. 16M]
 gi|23501033|ref|NP_697160.1| outer membrane protein [Brucella suis 1330]
 gi|62289100|ref|YP_220893.1| hypothetical protein BruAb1_0116 [Brucella abortus bv. 1 str.
           9-941]
 gi|82699038|ref|YP_413612.1| outer membrane protein [Brucella melitensis biovar Abortus 2308]
 gi|161618107|ref|YP_001591994.1| 22 kDa outer membrane protein precursor [Brucella canis ATCC 23365]
 gi|163842394|ref|YP_001626798.1| 22 kDa outer membrane protein precursor [Brucella suis ATCC 23445]
 gi|189023375|ref|YP_001934143.1| outer membrane protein [Brucella abortus S19]
 gi|225851659|ref|YP_002731892.1| outer membrane protein [Brucella melitensis ATCC 23457]
 gi|254690429|ref|ZP_05153683.1| outer membrane protein [Brucella abortus bv. 6 str. 870]
 gi|254694917|ref|ZP_05156745.1| outer membrane protein [Brucella abortus bv. 3 str. Tulya]
 gi|254696123|ref|ZP_05157951.1| outer membrane protein [Brucella abortus bv. 2 str. 86/8/59]
 gi|254700932|ref|ZP_05162760.1| outer membrane protein [Brucella suis bv. 5 str. 513]
 gi|254705300|ref|ZP_05167128.1| outer membrane protein [Brucella suis bv. 3 str. 686]
 gi|254707183|ref|ZP_05169011.1| outer membrane protein [Brucella pinnipedialis M163/99/10]
 gi|254709272|ref|ZP_05171083.1| outer membrane protein [Brucella pinnipedialis B2/94]
 gi|254713305|ref|ZP_05175116.1| outer membrane protein [Brucella ceti M644/93/1]
 gi|254716341|ref|ZP_05178152.1| outer membrane protein [Brucella ceti M13/05/1]
 gi|254731460|ref|ZP_05190038.1| outer membrane protein [Brucella abortus bv. 4 str. 292]
 gi|256030795|ref|ZP_05444409.1| outer membrane protein [Brucella pinnipedialis M292/94/1]
 gi|256045911|ref|ZP_05448785.1| outer membrane protein [Brucella melitensis bv. 1 str. Rev.1]
 gi|256112625|ref|ZP_05453546.1| outer membrane protein [Brucella melitensis bv. 3 str. Ether]
 gi|256158816|ref|ZP_05456677.1| outer membrane protein [Brucella ceti M490/95/1]
 gi|256254201|ref|ZP_05459737.1| outer membrane protein [Brucella ceti B1/94]
 gi|256258681|ref|ZP_05464217.1| outer membrane protein [Brucella abortus bv. 9 str. C68]
 gi|256264830|ref|ZP_05467362.1| Omp25c [Brucella melitensis bv. 2 str. 63/9]
 gi|260546397|ref|ZP_05822137.1| conserved hypothetical protein [Brucella abortus NCTC 8038]
 gi|260563196|ref|ZP_05833682.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. 16M]
 gi|260567237|ref|ZP_05837707.1| Omp25c [Brucella suis bv. 4 str. 40]
 gi|260755976|ref|ZP_05868324.1| outer membrane protein [Brucella abortus bv. 6 str. 870]
 gi|260759200|ref|ZP_05871548.1| outer membrane protein [Brucella abortus bv. 4 str. 292]
 gi|260760488|ref|ZP_05872834.1| outer membrane protein [Brucella abortus bv. 2 str. 86/8/59]
 gi|260884997|ref|ZP_05896611.1| Omp25c [Brucella abortus bv. 9 str. C68]
 gi|261215251|ref|ZP_05929532.1| outer membrane protein [Brucella abortus bv. 3 str. Tulya]
 gi|261218122|ref|ZP_05932403.1| conserved hypothetical protein [Brucella ceti M13/05/1]
 gi|261221349|ref|ZP_05935630.1| Omp25c [Brucella ceti B1/94]
 gi|261314664|ref|ZP_05953861.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10]
 gi|261316778|ref|ZP_05955975.1| conserved hypothetical protein [Brucella pinnipedialis B2/94]
 gi|261321031|ref|ZP_05960228.1| conserved hypothetical protein [Brucella ceti M644/93/1]
 gi|261751447|ref|ZP_05995156.1| outer membrane protein [Brucella suis bv. 5 str. 513]
 gi|261756010|ref|ZP_05999719.1| outer membrane protein [Brucella suis bv. 3 str. 686]
 gi|265987849|ref|ZP_06100406.1| Omp25c [Brucella pinnipedialis M292/94/1]
 gi|265992323|ref|ZP_06104880.1| Omp25c [Brucella melitensis bv. 1 str. Rev.1]
 gi|265994065|ref|ZP_06106622.1| Omp25c [Brucella melitensis bv. 3 str. Ether]
 gi|265997309|ref|ZP_06109866.1| Omp25c [Brucella ceti M490/95/1]
 gi|297247516|ref|ZP_06931234.1| 22 kDa outer membrane protein precursor [Brucella abortus bv. 5
           str. B3196]
 gi|17983866|gb|AAL53010.1| 25 kDa outer-membrane immunogenic protein precursor [Brucella
           melitensis bv. 1 str. 16M]
 gi|23346897|gb|AAN29075.1| outer membrane protein, putative [Brucella suis 1330]
 gi|46251229|gb|AAS84585.1| Omp25c [Brucella abortus]
 gi|46251233|gb|AAS84587.1| Omp25c [Brucella canis]
 gi|46251237|gb|AAS84589.1| Omp25c [Brucella pinnipedialis]
 gi|46251239|gb|AAS84590.1| Omp25c [Brucella ceti]
 gi|46251241|gb|AAS84591.1| Omp25c [Brucella ceti]
 gi|46251243|gb|AAS84592.1| Omp25c [Brucella ceti]
 gi|62195232|gb|AAX73532.1| outer membrane protein, hypothetical [Brucella abortus bv. 1 str.
           9-941]
 gi|82615139|emb|CAJ10072.1| outer membrane protein, putative [Brucella melitensis biovar
           Abortus 2308]
 gi|161334918|gb|ABX61223.1| 22 kDa outer membrane protein precursor [Brucella canis ATCC 23365]
 gi|163673117|gb|ABY37228.1| 22 kDa outer membrane protein precursor [Brucella suis ATCC 23445]
 gi|189018947|gb|ACD71669.1| outer membrane protein, putative [Brucella abortus S19]
 gi|225640024|gb|ACN99937.1| outer membrane protein [Brucella melitensis ATCC 23457]
 gi|260096504|gb|EEW80380.1| conserved hypothetical protein [Brucella abortus NCTC 8038]
 gi|260153212|gb|EEW88304.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. 16M]
 gi|260156755|gb|EEW91835.1| Omp25c [Brucella suis bv. 4 str. 40]
 gi|260669518|gb|EEX56458.1| outer membrane protein [Brucella abortus bv. 4 str. 292]
 gi|260670923|gb|EEX57744.1| outer membrane protein [Brucella abortus bv. 2 str. 86/8/59]
 gi|260676084|gb|EEX62905.1| outer membrane protein [Brucella abortus bv. 6 str. 870]
 gi|260874525|gb|EEX81594.1| Omp25c [Brucella abortus bv. 9 str. C68]
 gi|260916858|gb|EEX83719.1| outer membrane protein [Brucella abortus bv. 3 str. Tulya]
 gi|260919933|gb|EEX86586.1| Omp25c [Brucella ceti B1/94]
 gi|260923211|gb|EEX89779.1| conserved hypothetical protein [Brucella ceti M13/05/1]
 gi|261293721|gb|EEX97217.1| conserved hypothetical protein [Brucella ceti M644/93/1]
 gi|261296001|gb|EEX99497.1| conserved hypothetical protein [Brucella pinnipedialis B2/94]
 gi|261303690|gb|EEY07187.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10]
 gi|261741200|gb|EEY29126.1| outer membrane protein [Brucella suis bv. 5 str. 513]
 gi|261745763|gb|EEY33689.1| outer membrane protein [Brucella suis bv. 3 str. 686]
 gi|262551777|gb|EEZ07767.1| Omp25c [Brucella ceti M490/95/1]
 gi|262765046|gb|EEZ10967.1| Omp25c [Brucella melitensis bv. 3 str. Ether]
 gi|263003389|gb|EEZ15682.1| Omp25c [Brucella melitensis bv. 1 str. Rev.1]
 gi|263095286|gb|EEZ18913.1| Omp25c [Brucella melitensis bv. 2 str. 63/9]
 gi|264660046|gb|EEZ30307.1| Omp25c [Brucella pinnipedialis M292/94/1]
 gi|289467873|gb|ADC95621.1| 25kDa outer membrane immunogenic protein precursor [Brucella
           melitensis bv. 1 str. M5]
 gi|297174685|gb|EFH34032.1| 22 kDa outer membrane protein precursor [Brucella abortus bv. 5
           str. B3196]
 gi|326408139|gb|ADZ65204.1| outer membrane protein, putative [Brucella melitensis M28]
 gi|326537850|gb|ADZ86065.1| outer membrane protein [Brucella melitensis M5-90]
          Length = 228

 Score = 96.4 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 44/200 (22%), Positives = 68/200 (34%), Gaps = 38/200 (19%)

Query: 42  ATNRYVPIRHDFNGPYAGLSALYNGSF----------GEEAHHNAGGSIFAGYNVEDSC- 90
                V     +NG Y G    Y              G+       G ++AGYN +    
Sbjct: 31  PAPVVVAPTFTWNGAYLGGQIGYAWGKSHFSYDSTGLGDIKPDGFLGGLYAGYNFDLGNS 90

Query: 91  IMYGVEGDVRYTVPVLA----------DNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGP 140
           ++ G++GDV Y                    +     G++R R GY V D  L Y   G 
Sbjct: 91  VVLGIDGDVTYNDVSKNIDFLDENNAAATFENRLRWSGAVRARAGYAV-DRFLPYIAGGV 149

Query: 141 DVA----QKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFY-- 194
                  +    G     +    G T G G++    +++++ RLEYR + Y   +  +  
Sbjct: 150 AFGSLRNRGEFEGTGFSQSKTLTGWTIGAGMDYAA-TDNVILRLEYRYTDYGNKDYGFDD 208

Query: 195 ---------NTISLGVGMKF 205
                    N I  GV  KF
Sbjct: 209 AAVTNNFKTNDIRFGVAYKF 228


>gi|218461202|ref|ZP_03501293.1| outer membrane protein [Rhizobium etli Kim 5]
 gi|218658675|ref|ZP_03514605.1| outer membrane protein [Rhizobium etli IE4771]
          Length = 207

 Score = 96.4 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 42/204 (20%), Positives = 73/204 (35%), Gaps = 10/204 (4%)

Query: 10  VSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSFG 69
            ++       +A AAD V+ A        P    +       D    +        G+  
Sbjct: 6   ATTFLALVATTAFAADVVQEAPTAPLAAAPVFTWSGPYFGI-DGGAAWLNGDFSAGGASA 64

Query: 70  EEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLAD-NIHSLHGIGGSLRIRGGYEV 128
            E  +      FAGYN +    + G+EG++ +                 G++R R GY  
Sbjct: 65  SEDFNGGVFGGFAGYNFQFDNFVVGIEGNLEHNWNEEDALGAEVGTDWAGAVRGRVGYAF 124

Query: 129 SDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYS 188
             +L+  A          +     + T    G T G GV+   ++ ++ AR EYR + Y 
Sbjct: 125 DKALIYGAAGWAATRGYVDAPGFDKETETFNGYTVGAGVDF-AITNNIFARGEYRYNDYG 183

Query: 189 -------KVEGFYNTISLGVGMKF 205
                   V+   + +  G+G+KF
Sbjct: 184 EQDILGVDVDLDQHELKFGIGVKF 207


>gi|39934247|ref|NP_946523.1| outer membrane protein [Rhodopseudomonas palustris CGA009]
 gi|39648095|emb|CAE26615.1| possible outer membrane protein [Rhodopseudomonas palustris CGA009]
          Length = 226

 Score = 96.4 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 51/218 (23%), Positives = 81/218 (37%), Gaps = 24/218 (11%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K+ LA        AS  +AQAAD      +    V   +           + GPY G 
Sbjct: 20  MRKVTLAAAAVIA--ASVSTAQAADMGYYRSNAPYTVNQPLNA-------FSWAGPYLGG 70

Query: 61  SALYNGSFGEEA---HHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLA-DNIHSLHGI 116
           +  Y+               G +  GYN +   I++G+EGD++++            +  
Sbjct: 71  NLGYSWGNVTNNITKPSGFSGGVQGGYNWQSGNIVFGLEGDIQFSTADDTFAQYKFSNPW 130

Query: 117 GGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESL 176
            G+ R R GY ++D +L+YAT G    Q          +  + G T G G E    +  L
Sbjct: 131 FGTGRGRIGYAMND-VLIYATGGLAFGQLKGQNVFASESHSSAGWTVGAGAEF-AFAPKL 188

Query: 177 VARLEYRASKYSKVEGFYNT---------ISLGVGMKF 205
            A++EY     S    F            +  G+   F
Sbjct: 189 SAKVEYLYMSLSTSNFFITGMPNGYNAGLVRAGINYHF 226


>gi|254718340|ref|ZP_05180151.1| outer membrane protein [Brucella sp. 83/13]
 gi|265983299|ref|ZP_06096034.1| conserved hypothetical protein [Brucella sp. 83/13]
 gi|306839562|ref|ZP_07472368.1| outer membrane protein [Brucella sp. NF 2653]
 gi|264661891|gb|EEZ32152.1| conserved hypothetical protein [Brucella sp. 83/13]
 gi|306405348|gb|EFM61621.1| outer membrane protein [Brucella sp. NF 2653]
          Length = 227

 Score = 96.0 bits (237), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 43/199 (21%), Positives = 69/199 (34%), Gaps = 37/199 (18%)

Query: 42  ATNRYVPIRHDFNGPYAGLSALYNGSF----------GEEAHHNAGGSIFAGYNVEDSC- 90
                V     +NG Y G    Y              G+       G ++AGYN +    
Sbjct: 31  PAPVVVAPTFTWNGAYLGGQIGYAWGKSHFSYDSTGLGDIKPDGFLGGLYAGYNFDLGNS 90

Query: 91  IMYGVEGDVRYTVPVLA---------DNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPD 141
           ++ G++GDV Y                +  +     G++R R GY V D  L Y   G  
Sbjct: 91  VVLGIDGDVTYNDVSKNIDFLDGNDAGSFENRLRWSGAVRARAGYAV-DRFLPYIAGGVA 149

Query: 142 VA----QKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFY--- 194
                 +      +   +    G T G G++    +++++ RLEYR + Y   +  +   
Sbjct: 150 FGSLRNRGEFEDASFSQSKTLTGWTIGAGMDYAA-TDNVILRLEYRYTDYGNKDYGFDDA 208

Query: 195 --------NTISLGVGMKF 205
                   N I  GV  KF
Sbjct: 209 AVTNNFKTNDIRFGVAYKF 227


>gi|158425351|ref|YP_001526643.1| outer membrane protein Omp31 precursor [Azorhizobium caulinodans
           ORS 571]
 gi|158332240|dbj|BAF89725.1| outer membrane protein Omp31 precursor [Azorhizobium caulinodans
           ORS 571]
          Length = 233

 Score = 96.0 bits (237), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 43/209 (20%), Positives = 70/209 (33%), Gaps = 43/209 (20%)

Query: 38  VPTIATNRYVPIRHDFNGPYAGLSALYNGSF------------GEEAHHNAGGSIFAGYN 85
            P  A    V     + G Y G +A Y G                            GYN
Sbjct: 27  YPVKAPVAPVAPVFSWTGFYIGANAGYGGDKYNYDFGVPTTATASTNSSGFFAGGQIGYN 86

Query: 86  VED-SCIMYGVEGDVRYTVPVL---------ADNIHSLHGIGGSLRIRGGYEVSDSLLLY 135
            +  + ++ G+E D++++             + NI S     G++R R GY   D  L Y
Sbjct: 87  YQFANNVVLGLETDLQWSGIDGTLNTVTPGASTNIKSSLDYFGTVRARVGYAF-DRFLPY 145

Query: 136 ATVGPDVAQKYETGKAG--------EITPIAIGGTAGVGVEVGGLSESLVARLEYRASKY 187
            T G    +    G           + +   +G T G GVE   ++ +   + EY+    
Sbjct: 146 ITGGMAYGKTKTEGSQFSRTGFTTFDDSDTKVGWTIGGGVEY-AITNNWTFKTEYQYVDL 204

Query: 188 SK-----------VEGFYNTISLGVGMKF 205
                        V+  ++T+  GV  KF
Sbjct: 205 GNSDYGIGTNAVSVDNKFHTVRAGVNYKF 233


>gi|114705635|ref|ZP_01438538.1| outer membrane protein [Fulvimarina pelagi HTCC2506]
 gi|114538481|gb|EAU41602.1| outer membrane protein [Fulvimarina pelagi HTCC2506]
          Length = 228

 Score = 95.6 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 55/205 (26%), Positives = 85/205 (41%), Gaps = 15/205 (7%)

Query: 12  SLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSFGEE 71
            LA  +     AA P     +      P        P    ++GPYAG    YN S  + 
Sbjct: 13  VLATIALALPLAAMPAHAQDNASETAFPDSRIPESAPPVAIWSGPYAGTFVGYNVSRFDN 72

Query: 72  ------AHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPV-------LADNIHSLHGIGG 118
                 +     G  +AG+N++D  ++YGVEGDV                ++     + G
Sbjct: 73  LRGASISGDGVAGGAYAGFNLQDGSLVYGVEGDVGGAGFDATRRNALGNLDLSGESNVFG 132

Query: 119 SLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVA 178
           SLR R G +V D  L+Y T G  +A+   +      +  ++G T G GVE   +++S+  
Sbjct: 133 SLRGRVGVDV-DPFLVYGTGGLAIAETELSLGGVSDSEASVGYTIGAGVE-AQVTDSIRT 190

Query: 179 RLEYRASKYSKVEGFYNTISLGVGM 203
           RLEYR S +   +      S+  G 
Sbjct: 191 RLEYRYSDFGSSDYDLGRTSVSSGF 215


>gi|307315839|ref|ZP_07595348.1| porin [Sinorhizobium meliloti BL225C]
 gi|306898513|gb|EFN29191.1| porin [Sinorhizobium meliloti BL225C]
          Length = 208

 Score = 95.6 bits (236), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 45/214 (21%), Positives = 78/214 (36%), Gaps = 15/214 (7%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K+       S  L     A AAD                + +          G  +G 
Sbjct: 1   MKKILF----CSFILFGSSGAMAADVTFDNSALPPVSEAPFSWSGAYIGVQGGGGWASGE 56

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSC-IMYGVEGDVRYTVPVLAD-NIHSLHGIGG 118
            + +  +  E+A+  + G  F GYN +    ++ G+EGDV +                 G
Sbjct: 57  FSGFGINGSEDANGGSLGG-FVGYNYQFDNNLVLGIEGDVEHDWNEQQVFGADFGTDWAG 115

Query: 119 SLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVA 178
           S+R R GY   ++L+             E    G+      G T G G++    +  +  
Sbjct: 116 SVRGRLGYAFDNALIYATAGWAATRGYVEVPGLGKDEKTFNGYTVGAGLDY-AFTNQVFG 174

Query: 179 RLEYRASKYSK-------VEGFYNTISLGVGMKF 205
           R+EYR + Y         V+   + + +G+G+KF
Sbjct: 175 RVEYRYNDYGDQDLQGINVDVDQHAVKVGLGIKF 208


>gi|260466903|ref|ZP_05813086.1| porin [Mesorhizobium opportunistum WSM2075]
 gi|259029299|gb|EEW30592.1| porin [Mesorhizobium opportunistum WSM2075]
          Length = 234

 Score = 95.2 bits (235), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 50/240 (20%), Positives = 76/240 (31%), Gaps = 41/240 (17%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+ L LA   +   L     A AAD    +   G      +            +  +   
Sbjct: 1   MKTLLLA---TVFILGPVGMACAADINEVSPVAGY-DWSGLYAGVDAGYAAGKSNLFIAG 56

Query: 61  SALYNGSFGEE--AHHNAGGSIFAGYNVED-SCIMYGVEGDVRYTVPVL----------- 106
                GS            G I  G N +  +  + G E D+ Y+               
Sbjct: 57  GGFGGGSDLNVPLDPDGFVGGIHIGTNYQMANNFVIGAEADIAYSNADGLTPVDTGGGGV 116

Query: 107 ADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYET-------GKAGEITPIAI 159
              + S     GS R+R GY   D  L Y T G   A+   T       G+        +
Sbjct: 117 TTLLKSELKWQGSARLRAGYAF-DRTLPYITAGVAAAKYEVTAISAGPGGEIPFHDESHV 175

Query: 160 GGTAGVGVEVGGLSESLVARLEYRASKYS--------------KVEGFYNTISLGVGMKF 205
           G T G G+E    ++  +AR EYR S +                V+   + + +G+  KF
Sbjct: 176 GWTVGAGIE-HAFTDRWIARAEYRYSDFGSQDLSLAAGLPTVTSVDLQTHDVRVGLSYKF 234


>gi|110634323|ref|YP_674531.1| OmpA-like transmembrane region [Mesorhizobium sp. BNC1]
 gi|110285307|gb|ABG63366.1| OmpA-like transmembrane region [Chelativorans sp. BNC1]
          Length = 216

 Score = 95.2 bits (235), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 63/213 (29%), Positives = 93/213 (43%), Gaps = 10/213 (4%)

Query: 2   QKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGV--VPTIATNRYVPIRHDFNGPYAG 59
           +K  L    ++  +A    A AAD +                      P      G    
Sbjct: 5   KKSMLGFAAAAAIVAGAMPAYAADVIMEQPPAPPAAPMEVAPVATWAGPYAGIALGYGFS 64

Query: 60  LSALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLA-DNIHSLHGIGG 118
                +G+ GE       G++F G+  +    +YGVEGD+ Y     +   +   HG+ G
Sbjct: 65  GEVSADGAPGEVETDGFVGNVFGGWQGQSGQFVYGVEGDIGYNGMEGSEGGVDVEHGVDG 124

Query: 119 SLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVA 178
           SLR R GY  +D++LLYAT G   ++   +G     +  A+G TAG GV+V  L+    A
Sbjct: 125 SLRARLGYAATDNVLLYATGGGAASRLEASGGGLTESETAVGWTAGAGVDV-KLTPKSFA 183

Query: 179 RLEYRASKYS------KVEGFYNTISLGVGMKF 205
           RLEYR +  S       V+   N + LGVGM+F
Sbjct: 184 RLEYRYTDLSAEFDSVDVDTTSNKVMLGVGMQF 216


>gi|260169699|ref|ZP_05756510.1| outer membrane protein [Brucella sp. F5/99]
 gi|261759235|ref|ZP_06002944.1| outer membrane protein [Brucella sp. F5/99]
 gi|261739219|gb|EEY27215.1| outer membrane protein [Brucella sp. F5/99]
          Length = 228

 Score = 95.2 bits (235), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 44/200 (22%), Positives = 69/200 (34%), Gaps = 38/200 (19%)

Query: 42  ATNRYVPIRHDFNGPYAGLSALYNGSF----------GEEAHHNAGGSIFAGYNVEDSC- 90
                V +   +NG Y G    Y              G+       G ++AGYN +    
Sbjct: 31  PAPVVVALTFTWNGAYLGGQIGYAWGKSHFSYDSTGLGDIKPDGFLGGLYAGYNFDLGNS 90

Query: 91  IMYGVEGDVRYTVPVLA----------DNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGP 140
           ++ G++GDV Y                    +     G++R R GY V D  L Y   G 
Sbjct: 91  VVLGIDGDVTYNDVSKNIDFLDENNAAATFENRLRWSGAVRARAGYAV-DRFLPYIAGGV 149

Query: 141 DVA----QKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFY-- 194
                  +    G     +    G T G G++    +++++ RLEYR + Y   +  +  
Sbjct: 150 AFGSLRNRGEFEGTGFSQSKTLTGWTIGAGMDYAA-TDNVILRLEYRYTDYGNKDYGFDD 208

Query: 195 ---------NTISLGVGMKF 205
                    N I  GV  KF
Sbjct: 209 AAVTNNFKTNDIRFGVAYKF 228


>gi|218663696|ref|ZP_03519626.1| outer membrane protein [Rhizobium etli IE4771]
          Length = 203

 Score = 95.2 bits (235), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 52/198 (26%), Positives = 87/198 (43%), Gaps = 11/198 (5%)

Query: 9   GVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSF 68
             S+ A+A   +       + A    +     +A +  V    ++ G Y G +  YN   
Sbjct: 1   MASAFAIAGVSA------AQAADAVDQVPEAPVAQDAPVKPAGNWEGFYLGGAGTYNMGD 54

Query: 69  GEEAHH--NAGGSIFAGYNVEDSCIMYGVEGDVRYTVPV-LADNIHSLHGIGGSLRIRGG 125
                H    GG +F GYN +   I+YGVE D+ Y+     +  + + +G  GS+R R G
Sbjct: 55  FGSDRHTYGFGGQVFTGYNWQAGQIVYGVESDLGYSGDDVSSGGVENKYGWNGSVRGRVG 114

Query: 126 YEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRAS 185
           Y+++   LLY T G  +     +    + +  A G T G GVE   ++ ++  RLEYR +
Sbjct: 115 YDMNP-FLLYGTAGLALGNIKVSDDTSDESKTAYGYTVGAGVE-AFVTNNITTRLEYRYT 172

Query: 186 KYSKVEGFYNTISLGVGM 203
            Y   +   ++ S   G 
Sbjct: 173 DYQSKDYDLDSGSFSRGY 190


>gi|256368583|ref|YP_003106089.1| 25Kda outer membrane protein precursor [Brucella microti CCM 4915]
 gi|255998741|gb|ACU47140.1| 25Kda outer membrane protein precursor [Brucella microti CCM 4915]
          Length = 228

 Score = 95.2 bits (235), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 44/200 (22%), Positives = 68/200 (34%), Gaps = 38/200 (19%)

Query: 42  ATNRYVPIRHDFNGPYAGLSALYNGSF----------GEEAHHNAGGSIFAGYNVEDSC- 90
                V     +NG Y G    Y              G+       G ++AGYN +    
Sbjct: 31  PAPVVVAPTFTWNGAYLGGQIGYAWGKSHFSYDSTGLGDIKPDGFLGGLYAGYNFDLGNS 90

Query: 91  IMYGVEGDVRYTVPVLA----------DNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGP 140
           ++ G++GDV Y                    +     G++R R GY V D  L Y   G 
Sbjct: 91  VVLGIDGDVTYNDVSKNIDFLDENNAAAAFENRLRWSGAVRARAGYAV-DRFLPYIAGGV 149

Query: 141 DVA----QKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFY-- 194
                  +    G     +    G T G G++    +++++ RLEYR + Y   +  +  
Sbjct: 150 AFGSLRNRGEFEGTGFSQSKTLTGWTIGAGMDYAA-TDNVILRLEYRYTDYGNKDYGFDD 208

Query: 195 ---------NTISLGVGMKF 205
                    N I  GV  KF
Sbjct: 209 AAVTNNFKTNDIRFGVAYKF 228


>gi|13471933|ref|NP_103500.1| outer membrane protein [Mesorhizobium loti MAFF303099]
 gi|14022677|dbj|BAB49286.1| outer membrane protein [Mesorhizobium loti MAFF303099]
          Length = 220

 Score = 94.9 bits (234), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 39/204 (19%), Positives = 65/204 (31%), Gaps = 20/204 (9%)

Query: 6   LAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYN 65
           LA+  S   LA+     AAD V              +   +        G      +   
Sbjct: 3   LALLCSVAFLAAASPVLAADIVE------PVAAMPFSWTGFYGGVQAGGGWNDSRWSGAT 56

Query: 66  GSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLA--------DNIHSLHGIG 117
                            GYN + +  + G+EGD+  +                 +     
Sbjct: 57  FDSFNTNGSGGIFGGQIGYNYQINQFVIGIEGDLAGSTVKGDGQCSTALGTTCETKQDYL 116

Query: 118 GSLRIRGGYEVSDSLLLYATVGPDVAQKY----ETGKAGEITPIAIGGTAGVGVEVGGLS 173
           GS+R R GY + D +L+Y   G    +      +           +G TAG+G E   L+
Sbjct: 117 GSVRGRLGYAI-DRILIYGDAGVAFTKYKIAEVDGFHQSFGGGSRVGWTAGLGAEY-ALT 174

Query: 174 ESLVARLEYRASKYSKVEGFYNTI 197
           +   A +E+    +    G  +TI
Sbjct: 175 DHWTAGVEWNYYDFGTKSGESDTI 198


>gi|17989189|ref|NP_541822.1| 31 kDa outer-membrane immunogenic protein precursor [Brucella
           melitensis bv. 1 str. 16M]
 gi|17985044|gb|AAL54086.1| 31 kDa outer-membrane immunogenic protein precursor [Brucella
           melitensis bv. 1 str. 16M]
          Length = 219

 Score = 94.5 bits (233), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 37/219 (16%), Positives = 69/219 (31%), Gaps = 50/219 (22%)

Query: 36  GVVPTIATNRYVPIRHDFNGPYAGLSALYNGSFG-------------------EEAHHNA 76
            V    A          + G Y G++A Y G                      +      
Sbjct: 2   VVSEPSAPTAAPVDTFSWTGGYIGINAGYAGGKFKHPFSSFDKEDNEQVSGSLDVTAGGF 61

Query: 77  GGSIFAGYNVEDSC-IMYGVEGDVRYTVPVLADNI---------HSLHGIGGSLRIRGGY 126
            G + AGYN +    ++ G E D + +    + +           +     G++R R GY
Sbjct: 62  VGGVQAGYNWQLDNGVVLGAETDFQGSSVTGSISAGASGLEGKAETKVEWFGTVRARLGY 121

Query: 127 EVSDSLLLYATVGPDVAQKYE--------TGKAGEITPIAIGGTAGVGVEVGGLSESLVA 178
             ++ L++Y T G    +           +           G T G G E   ++ +   
Sbjct: 122 TATERLMVYGTGGLAYGKVKSAFNLGDDASALHTWSDKTKAGWTLGAGAEY-AINNNWTL 180

Query: 179 RLEYRASKYSK------------VEGFYNTISLGVGMKF 205
           + EY  +   K             +  ++T+ +G+  KF
Sbjct: 181 KSEYLYTDLGKRNLVDVDNSFLESKVNFHTVRVGLNYKF 219


>gi|92118614|ref|YP_578343.1| putative outer-membrane immunogenic protein precursor [Nitrobacter
           hamburgensis X14]
 gi|91801508|gb|ABE63883.1| putative outer-membrane immunogenic protein precursor [Nitrobacter
           hamburgensis X14]
          Length = 206

 Score = 94.5 bits (233), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 44/200 (22%), Positives = 72/200 (36%), Gaps = 25/200 (12%)

Query: 19  CSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSF---GEEAHHN 75
            +AQAAD   R+            T       + + GPY G +  Y            + 
Sbjct: 19  GTAQAADFSYRSP----------YTVNQPLNAYSWAGPYLGGNLGYAWGSVQNSATKPNG 68

Query: 76  AGGSIFAGYNVEDSCIMYGVEGDVRYTVPVL-ADNIHSLHGIGGSLRIRGGYEVSDSLLL 134
             G + AGYN +   +++G+EGD++              +   G++R R GY  ++ +L+
Sbjct: 69  VFGGVQAGYNWQSGPLVFGLEGDIQANAADDIFARWKFSNPWFGTVRGRLGYAFNN-VLI 127

Query: 135 YATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFY 194
           Y T G               +    G T GVG E G + ++  A++EY     S      
Sbjct: 128 YGTGGLAFGALRAETFGLSESHTNAGWTVGVGAEFG-IYQNWTAKVEYLYVDLSSSNFTI 186

Query: 195 NT---------ISLGVGMKF 205
                      +  GV   F
Sbjct: 187 TDAPNSYQFGLVRAGVNYHF 206


>gi|90426297|ref|YP_534667.1| OmpA-like transmembrane region [Rhodopseudomonas palustris BisB18]
 gi|90108311|gb|ABD90348.1| OmpA-like transmembrane region [Rhodopseudomonas palustris BisB18]
          Length = 251

 Score = 94.5 bits (233), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 43/223 (19%), Positives = 74/223 (33%), Gaps = 21/223 (9%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K  L   V+ +A+A+   A AAD   R +      V     N          G     
Sbjct: 22  MKKFLLG-TVALVAMATTVPALAADLGARTYTKAPAYVAAPIYNWTGFYIGGHVGGAFVG 80

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVED-SCIMYGVEGDVRYTVPVLAD------NIHSL 113
                      +     G +  GY+ +     + GVE    +             +    
Sbjct: 81  DDSIGTGATRSSDGTFLGGVQGGYDYQFAPNWVLGVEAQYSWLDQGTDPVLVGPYSFSDK 140

Query: 114 HGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAG----EITPIAIGGTAGVGVEV 169
               GS+  R GY    +LL YA  G   A    T   G     ++  + G T G G+E 
Sbjct: 141 QKGLGSVTGRIGYTWGPALL-YAKGGYAFADYDTTVTLGGVGAAVSSKSDGYTVGAGLEY 199

Query: 170 GGLSESLVARLEYRASKYSKVEG-------FYNTISLGVGMKF 205
              +++   ++EY+   +  V+          + +  G+  +F
Sbjct: 200 -LFAQNWSGKVEYQYYDFGNVDFGGFSFKNDEHVVKAGLNYRF 241


>gi|146425515|emb|CAM89327.2| 25 kDa outer membrane protein [Brucella melitensis]
 gi|146425525|emb|CAM89318.2| 25 kDa outer membrane protein [Brucella melitensis]
 gi|146425535|emb|CAM89309.2| 25 kDa outer membrane protein [Brucella melitensis]
 gi|146425545|emb|CAM89300.2| 25 kDa outer membrane protein [Brucella melitensis]
 gi|146425565|emb|CAM89282.2| 25 kDa outer membrane protein [Brucella melitensis]
 gi|146425575|emb|CAM89273.2| 25 kDa outer membrane protein [Brucella melitensis]
 gi|146425585|emb|CAM89264.2| 25 kDa outer membrane protein [Brucella melitensis]
 gi|146425595|emb|CAM89255.2| 25 kDa outer membrane protein [Brucella melitensis]
 gi|146425605|emb|CAM89246.2| 25 kDa outer membrane protein [Brucella melitensis]
 gi|146425615|emb|CAM89237.2| 25 kDa outer membrane protein [Brucella melitensis]
 gi|146425625|emb|CAM89228.2| 25 kDa outer membrane protein [Brucella melitensis]
 gi|146425635|emb|CAM89219.2| 25 kDa outer membrane protein [Brucella melitensis]
 gi|146425645|emb|CAM89210.2| 25 kDa outer membrane protein [Brucella melitensis]
 gi|146425655|emb|CAM89201.2| 25 kDa outer membrane protein [Brucella melitensis]
 gi|146425665|emb|CAM89192.2| 25 kDa outer membrane protein [Brucella melitensis]
 gi|146425675|emb|CAM89183.2| 25 kDa outer membrane protein [Brucella melitensis]
 gi|146425685|emb|CAM89174.2| 25 kDa outer membrane protein [Brucella melitensis]
 gi|146425695|emb|CAM89165.2| 25 kDa outer membrane protein [Brucella melitensis]
 gi|146425705|emb|CAM89156.2| 25 kDa outer membrane protein [Brucella abortus]
 gi|146425715|emb|CAM89147.2| 25 kDa outer membrane protein [Brucella abortus]
 gi|146425725|emb|CAM89138.2| 25 kDa outer membrane protein [Brucella abortus]
 gi|146425735|emb|CAM89129.2| 25 kDa outer membrane protein [Brucella abortus]
 gi|146425745|emb|CAM89120.2| 25 kDa outer membrane protein [Brucella abortus]
 gi|146425755|emb|CAM89111.2| 25 kDa outer membrane protein [Brucella abortus]
 gi|146425765|emb|CAM89102.2| 25 kDa outer membrane protein [Brucella abortus]
 gi|146425775|emb|CAM89093.2| 25 kDa outer membrane protein [Brucella abortus]
 gi|146425785|emb|CAM89084.2| 25 kDa outer membrane protein [Brucella abortus]
 gi|146425795|emb|CAM89075.2| 25 kDa outer membrane protein [Brucella abortus]
 gi|146425805|emb|CAM89066.2| 25 kDa outer membrane protein [Brucella abortus]
 gi|146425815|emb|CAM89057.2| 25 kDa outer membrane protein [Brucella abortus]
 gi|146425825|emb|CAM89048.2| 25 kDa outer membrane protein [Brucella abortus]
 gi|146425835|emb|CAM89039.2| 25 kDa outer membrane protein [Brucella abortus]
 gi|146425845|emb|CAM89030.2| 25 kDa outer membrane protein [Brucella abortus]
 gi|146425855|emb|CAM89021.2| 25 kDa outer membrane protein [Brucella abortus]
 gi|146425865|emb|CAM89012.2| 25 kDa outer membrane protein [Brucella abortus]
 gi|146425875|emb|CAM89003.2| 25 kDa outer membrane protein [Brucella abortus]
 gi|146425885|emb|CAM88994.2| 25 kDa outer membrane protein [Brucella abortus]
 gi|146425895|emb|CAM88985.2| 25 kDa outer membrane protein [Brucella abortus]
 gi|146425905|emb|CAM88976.2| 25 kDa outer membrane protein [Brucella abortus]
 gi|146426370|emb|CAM89822.2| 25 kDa outer membrane protein [Brucella suis]
 gi|146426380|emb|CAM89813.2| 25 kDa outer membrane protein [Brucella suis]
 gi|146426390|emb|CAM89804.2| 25 kDa outer membrane protein [Brucella suis]
 gi|146426400|emb|CAM89795.2| 25 kDa outer membrane protein [Brucella suis]
 gi|146426410|emb|CAM89786.2| 25 kDa outer membrane protein [Brucella suis]
 gi|146426420|emb|CAM89777.2| 25 kDa outer membrane protein [Brucella suis]
 gi|146426430|emb|CAM89768.2| 25 kDa outer membrane protein [Brucella suis]
 gi|146426440|emb|CAM89759.2| 25 kDa outer membrane protein [Brucella suis]
 gi|146426450|emb|CAM89750.2| 25 kDa outer membrane protein [Brucella suis]
 gi|146426460|emb|CAM89741.2| 25 kDa outer membrane protein [Brucella suis]
 gi|146426470|emb|CAM89732.2| 25 kDa outer membrane protein [Brucella suis]
 gi|146426480|emb|CAM89723.2| 25 kDa outer membrane protein [Brucella suis]
 gi|146426490|emb|CAM89714.2| 25 kDa outer membrane protein [Brucella suis]
 gi|146426500|emb|CAM89705.2| 25 kDa outer membrane protein [Brucella suis]
 gi|146426510|emb|CAM89696.2| 25 kDa outer membrane protein [Brucella suis]
 gi|146426520|emb|CAM89687.2| 25 kDa outer membrane protein [Brucella suis]
 gi|146426530|emb|CAM89678.2| 25 kDa outer membrane protein [Brucella suis]
 gi|146426540|emb|CAM89669.2| 25 kDa outer membrane protein [Brucella suis]
 gi|146426550|emb|CAM89660.2| 25 kDa outer membrane protein [Brucella suis]
 gi|146426560|emb|CAM89651.2| 25 kDa outer membrane protein [Brucella suis]
 gi|146426570|emb|CAM89642.2| 25 kDa outer membrane protein [Brucella suis]
 gi|146426580|emb|CAM89633.2| 25 kDa outer membrane protein [Brucella suis]
 gi|146426590|emb|CAM89624.2| 25 kDa outer membrane protein [Brucella suis]
 gi|146426600|emb|CAM89615.2| 25 kDa outer membrane protein [Brucella suis]
 gi|146426610|emb|CAM89606.2| 25 kDa outer membrane protein [Brucella suis]
 gi|146426620|emb|CAM89597.2| 25 kDa outer membrane protein [Brucella suis]
 gi|146426630|emb|CAM89588.2| 25 kDa outer membrane protein [Brucella suis]
 gi|146426640|emb|CAM89579.2| 25 kDa outer membrane protein [Brucella suis]
 gi|146426650|emb|CAM89570.2| 25 kDa outer membrane protein [Brucella suis]
 gi|146426660|emb|CAM89561.2| 25 kDa outer membrane protein [Brucella suis]
 gi|146426670|emb|CAM89552.2| 25 kDa outer membrane protein [Brucella suis ATCC 23445]
 gi|146426680|emb|CAM89543.2| 25 kDa outer membrane protein [Brucella suis]
 gi|146426690|emb|CAM89534.2| 25 kDa outer membrane protein [Brucella suis]
 gi|146426700|emb|CAM89525.2| 25 kDa outer membrane protein [Brucella suis]
 gi|146426710|emb|CAM89516.2| 25 kDa outer membrane protein [Brucella suis]
 gi|146426720|emb|CAM89507.2| 25 kDa outer membrane protein [Brucella suis]
 gi|146426730|emb|CAM89498.2| 25 kDa outer membrane protein [Brucella suis]
 gi|146426740|emb|CAM89489.2| 25 kDa outer membrane protein [Brucella suis]
 gi|146426750|emb|CAM89480.2| 25 kDa outer membrane protein [Brucella suis]
 gi|146426760|emb|CAM89471.2| 25 kDa outer membrane protein [Brucella suis]
 gi|146426770|emb|CAM89462.2| 25 kDa outer membrane protein [Brucella suis]
 gi|146426780|emb|CAM89453.2| 25 kDa outer membrane protein [Brucella suis 1330]
 gi|146426900|emb|CAM89345.2| 25 kDa outer membrane protein [Brucella melitensis]
 gi|146426910|emb|CAM89336.2| 25 kDa outer membrane protein [Brucella melitensis]
 gi|146427366|emb|CAM90326.2| 25 kDa outer membrane protein [Brucella sp. 5/95]
 gi|146427376|emb|CAM90317.2| 25 kDa outer membrane protein [Brucella sp. 59/94]
 gi|146427386|emb|CAM90308.2| 25 kDa outer membrane protein [Brucella sp. UK28/03-13840]
 gi|146427396|emb|CAM90299.2| 25 kDa outer membrane protein [Brucella sp. F7/99]
 gi|146427406|emb|CAM90290.2| 25 kDa outer membrane protein [Brucella sp. F10/99]
 gi|146427416|emb|CAM90281.2| 25 kDa outer membrane protein [Brucella sp. F9/99]
 gi|146427426|emb|CAM90272.2| 25 kDa outer membrane protein [Brucella sp. F8/99]
 gi|146427436|emb|CAM90263.2| 25 kDa outer membrane protein [Brucella sp. F6/99]
 gi|146427446|emb|CAM90254.2| 25 kDa outer membrane protein [Brucella sp. UK5/01]
 gi|146427456|emb|CAM90245.2| 25 kDa outer membrane protein [Brucella sp. UK40/99]
 gi|146427466|emb|CAM90236.2| 25 kDa outer membrane protein [Brucella sp. UK13/99]
 gi|146427476|emb|CAM90227.2| 25 kDa outer membrane protein [Brucella sp. 61/94]
 gi|146427486|emb|CAM90218.2| 25 kDa outer membrane protein [Brucella sp. 4/96]
 gi|146427496|emb|CAM90209.2| 25 kDa outer membrane protein [Brucella sp. 55/94]
 gi|146427506|emb|CAM90200.2| 25 kDa outer membrane protein [Brucella sp. UK24/00 (M192)]
 gi|146427516|emb|CAM90191.2| 25 kDa outer membrane protein [Brucella sp. 44/94]
 gi|146427526|emb|CAM90182.2| 25 kDa outer membrane protein [Brucella sp. 39/94]
 gi|146427536|emb|CAM90173.2| 25 kDa outer membrane protein [Brucella sp. UK31/04]
 gi|146427546|emb|CAM90164.2| 25 kDa outer membrane protein [Brucella sp. VLA04/06]
 gi|146427556|emb|CAM90155.2| 25 kDa outer membrane protein [Brucella sp. VLA04/105]
 gi|146427566|emb|CAM90146.2| 25 kDa outer membrane protein [Brucella sp. VLA04.72]
 gi|146427576|emb|CAM90137.2| 25 kDa outer membrane protein [Brucella sp. VLA04.67]
 gi|146427586|emb|CAM90128.2| 25 kDa outer membrane protein [Brucella sp. F96/2]
 gi|146427596|emb|CAM90119.2| 25 kDa outer membrane protein [Brucella sp. F23/97]
 gi|146427606|emb|CAM90110.2| 25 kDa outer membrane protein [Brucella sp. UK15/02]
 gi|146427616|emb|CAM90101.2| 25 kDa outer membrane protein [Brucella sp. UK10/01]
 gi|146427626|emb|CAM90092.2| 25 kDa outer membrane protein [Brucella sp. UK4/01]
 gi|146427636|emb|CAM90083.2| 25 kDa outer membrane protein [Brucella sp. UK10/00]
 gi|146427646|emb|CAM90074.2| 25 kDa outer membrane protein [Brucella sp. UK5/97]
 gi|146427656|emb|CAM90065.2| 25 kDa outer membrane protein [Brucella sp. UK3/97]
 gi|146427666|emb|CAM90056.2| 25 kDa outer membrane protein [Brucella sp. UK1/97]
 gi|146427676|emb|CAM90047.2| 25 kDa outer membrane protein [Brucella sp. 2/96]
 gi|146427686|emb|CAM90038.2| 25 kDa outer membrane protein [Brucella sp. 14/95]
 gi|146427696|emb|CAM90029.2| 25 kDa outer membrane protein [Brucella sp. UK35/99]
 gi|146427706|emb|CAM90020.2| 25 kDa outer membrane protein [Brucella sp. UK15/98]
 gi|146427716|emb|CAM90011.2| 25 kDa outer membrane protein [Brucella sp. 52/94]
 gi|146427726|emb|CAM90002.2| 25 kDa outer membrane protein [Brucella sp. 36/94]
 gi|146427846|emb|CAM89894.2| 25 kDa outer membrane protein [Brucella suis]
 gi|146427856|emb|CAM89885.2| 25 kDa outer membrane protein [Brucella suis]
 gi|146427866|emb|CAM89876.2| 25 kDa outer membrane protein [Brucella suis]
 gi|146427876|emb|CAM89867.2| 25 kDa outer membrane protein [Brucella suis]
 gi|146427886|emb|CAM89858.2| 25 kDa outer membrane protein [Brucella suis]
 gi|146427896|emb|CAM89849.2| 25 kDa outer membrane protein [Brucella suis]
 gi|146427906|emb|CAM89840.2| 25 kDa outer membrane protein [Brucella suis]
 gi|146427916|emb|CAM89831.2| 25 kDa outer membrane protein [Brucella suis]
 gi|146427988|emb|CAM90407.2| 25 kDa outer membrane protein [Brucella sp. F5/02]
 gi|146428001|emb|CAM90398.2| 25 kDa outer membrane protein [Brucella sp. F5/99]
 gi|146428011|emb|CAM90389.2| 25 kDa outer membrane protein [Brucella sp. VLA05/8]
 gi|146428021|emb|CAM90380.2| 25 kDa outer membrane protein [Brucella sp. VLA05/4]
 gi|146428031|emb|CAM90371.2| 25 kDa outer membrane protein [Brucella sp. UK3/05]
 gi|146428041|emb|CAM90362.2| 25 kDa outer membrane protein [Brucella sp. 14/94]
 gi|146428051|emb|CAM90353.2| 25 kDa outer membrane protein [Brucella sp. UK2/2000]
 gi|146428061|emb|CAM90344.2| 25 kDa outer membrane protein [Brucella sp. UK1/2000]
 gi|146428071|emb|CAM90335.2| 25 kDa outer membrane protein [Brucella sp. UK43/99]
 gi|170015689|emb|CAP05282.1| 25 kDa outer membrane protein [Brucella sp. BO1]
          Length = 163

 Score = 94.1 bits (232), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 47/169 (27%), Positives = 73/169 (43%), Gaps = 16/169 (9%)

Query: 7   AVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNG 66
            V VS+  L    +A AAD ++          P +     V  ++ + G Y GL   Y  
Sbjct: 1   LVIVSAALLPFSATAFAADAIQEQ--------PPVPAPVEVAPQYSWAGGYTGLYLGYGW 52

Query: 67  SF------GEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLA-DNIHSLHGIGGS 119
           +       G     +     FAG+N +   I+YGVEGD  Y+    + D +    G  GS
Sbjct: 53  NKAKTSTVGSIKPDDWKAGAFAGWNFQQDQIVYGVEGDAGYSWAKKSKDGLEVKQGFEGS 112

Query: 120 LRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVE 168
           LR R GY+++  ++ Y T G   +Q        + +   +G TAG G+E
Sbjct: 113 LRARVGYDLNP-VMPYLTAGIAGSQIKLNNGLDDESKFRVGWTAGAGLE 160


>gi|146427796|emb|CAM89939.2| 25 kDa outer membrane protein [Brucella canis]
 gi|146427806|emb|CAM89930.2| 25 kDa outer membrane protein [Brucella canis]
 gi|146427816|emb|CAM89921.2| 25 kDa outer membrane protein [Brucella canis]
 gi|146427826|emb|CAM89912.2| 25 kDa outer membrane protein [Brucella canis]
 gi|146427836|emb|CAM89903.2| 25 kDa outer membrane protein [Brucella canis]
          Length = 163

 Score = 94.1 bits (232), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 47/169 (27%), Positives = 73/169 (43%), Gaps = 16/169 (9%)

Query: 7   AVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNG 66
            V VS+  L    +A AAD ++          P +     V  ++ + G Y GL   Y  
Sbjct: 1   LVIVSAALLPFSATAFAADAIQEQ--------PPVPAPVEVAPQYSWAGGYTGLYLGYGW 52

Query: 67  SF------GEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLA-DNIHSLHGIGGS 119
           +       G     +     FAG+N +   I+YGVEGD  Y+    + D +    G  GS
Sbjct: 53  NKAKTSTVGSIKPDDWKAGAFAGWNFQKDQIVYGVEGDAGYSWAKKSKDGLEVKQGFEGS 112

Query: 120 LRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVE 168
           LR R GY+++  ++ Y T G   +Q        + +   +G TAG G+E
Sbjct: 113 LRARVGYDLNP-VMPYLTAGIAGSQIKLNNGLDDESKFRVGWTAGAGLE 160


>gi|146427766|emb|CAM89966.2| 25 kDa outer membrane protein [Brucella canis]
 gi|146427776|emb|CAM89957.2| 25 kDa outer membrane protein [Brucella canis]
 gi|146427786|emb|CAM89948.2| 25 kDa outer membrane protein [Brucella canis]
          Length = 163

 Score = 94.1 bits (232), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 47/169 (27%), Positives = 72/169 (42%), Gaps = 16/169 (9%)

Query: 7   AVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNG 66
            V VS+  L    +A AAD ++          P +     V  ++ + G Y GL   Y  
Sbjct: 1   LVIVSAALLPFSATAFAADAIQEQ--------PPVPAPVEVAPQYSWAGGYTGLYLGYGW 52

Query: 67  SF------GEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLA-DNIHSLHGIGGS 119
           +       G     +     FAG+N +   I+YGVEGD  Y+    + D      G  GS
Sbjct: 53  NKAKTSTVGSIKPDDWKAGAFAGWNFQKDQIVYGVEGDAGYSWAKKSKDGPEVKQGFEGS 112

Query: 120 LRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVE 168
           LR R GY+++  ++ Y T G   +Q        + +   +G TAG G+E
Sbjct: 113 LRARVGYDLNP-VMPYLTAGIAGSQIKLNNGLDDESKFRVGWTAGAGLE 160


>gi|12620707|gb|AAG60983.1|AF322013_102 ID693 [Bradyrhizobium japonicum]
          Length = 325

 Score = 94.1 bits (232), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 40/238 (16%), Positives = 72/238 (30%), Gaps = 36/238 (15%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIAT-----NRYVPIRHDFNG 55
           M+K+ L +     AL +   +   D   +        +P  A        Y+     +  
Sbjct: 85  MKKI-LILTACIGALCAAAPSFGTDLAGQPVKVKAAPLPVAAPIIDWSGYYMGANGGWGT 143

Query: 56  PYAGLSALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLAD------- 108
            +         S G             GY  +   ++YG+EG   +     ++       
Sbjct: 144 SHNCWDFNGITSEGCHNSTGGTVGGQIGYRWQIFNMVYGLEGQGNWADFRGSNVSTAFPT 203

Query: 109 -NIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVA-------QKYETGKAGEITPIAIG 160
             + +     G L    GY  + ++LLY   G  V              + G+   +  G
Sbjct: 204 DTVGTTTDAFGLLTGHIGYAFN-AVLLYGKGGAAVTSNTYYVNSVATGTELGKNNDVRWG 262

Query: 161 GTAGVGVEVGGLSESLVARLEYRASKYSKVEG-------------FYNTISLGVGMKF 205
           G  G G EV  L+ +  A +EY      +                  + I+  +  KF
Sbjct: 263 GVLGAGAEVS-LTPNWSAGVEYNHLFMQRSNISFPAALGADRAHQDVDLITARLNYKF 319


>gi|86358535|ref|YP_470427.1| outer membrane protein [Rhizobium etli CFN 42]
 gi|86282637|gb|ABC91700.1| outer membrane protein [Rhizobium etli CFN 42]
          Length = 208

 Score = 94.1 bits (232), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 43/205 (20%), Positives = 74/205 (36%), Gaps = 11/205 (5%)

Query: 10  VSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSFG 69
            ++       SA AAD V+          P    +       D    +        G+  
Sbjct: 6   ATTFLALVATSAFAADAVQDVPAAPVAAAPAFTWSGPYLGI-DGGASWLNGDFSAGGASD 64

Query: 70  EEAHHNAGGSIFAGYNVEDSC-IMYGVEGDVRYTVPVLAD-NIHSLHGIGGSLRIRGGYE 127
            +  +      FAGYN +    I+ G+EG++ Y                 G++R R GY 
Sbjct: 65  SQDFNGGVFGAFAGYNFQFDNNIVVGIEGNLEYNWNEEEALGADVGTDWAGAVRGRVGYA 124

Query: 128 VSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKY 187
              +LL  A          +   + + T    G T G GV+   ++ ++ AR EYR + +
Sbjct: 125 FDRALLYGAAGWTATRGYVDLPGSDKETETFNGYTVGAGVDF-AITNNIFARGEYRYNDF 183

Query: 188 S-------KVEGFYNTISLGVGMKF 205
                    V+   + +  G+G+KF
Sbjct: 184 GEKDILGVDVDLNQHELKFGIGVKF 208


>gi|75674443|ref|YP_316864.1| outer membrane protein [Nitrobacter winogradskyi Nb-255]
 gi|74419313|gb|ABA03512.1| possible outer membrane protein [Nitrobacter winogradskyi Nb-255]
          Length = 241

 Score = 94.1 bits (232), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 46/219 (21%), Positives = 74/219 (33%), Gaps = 22/219 (10%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K+ LA  V+ L +A+   AQAAD   R +      VP    N          G   G 
Sbjct: 18  MKKILLA-SVAFLGMAAIVPAQAADLAPRPYTKAPPYVPAPIYNWTGFYLGGHIGGAFGG 76

Query: 61  SALY-NGSFGEEAHHNAGGSIFAGYNVED-SCIMYGVEGDVRYTVPVLADNIHSLHGIGG 118
                   F         G    GY+ +     ++G+E +  +            +   G
Sbjct: 77  PGNVLAPGFFNNNDGAFMGGGQVGYDTQFSPNWVFGIEANYSFLD----TGSFFANRGLG 132

Query: 119 SLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVA 178
           S+  R GY    +LL Y   G   A    T           G T G G+E    +++   
Sbjct: 133 SVTARLGYTWGPALL-YVKGGYGWADSRFTNGFAGNGG-RDGYTVGGGLEY-LFTQNWSG 189

Query: 179 RLEYRASKYSKVEG------------FYNTISLGVGMKF 205
           ++EY+      V                +T+ +G+  +F
Sbjct: 190 KVEYQYYDLGNVNFFGPLGGIGNFRNDQHTVKVGLNYRF 228


>gi|319405138|emb|CBI78744.1| Pap31 [Bartonella sp. AR 15-3]
          Length = 278

 Score = 93.7 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 49/284 (17%), Positives = 80/284 (28%), Gaps = 96/284 (33%)

Query: 7   AVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNG 66
            +  S +AL +  + QAAD       G   VV              + G Y G       
Sbjct: 6   LMTASVVALMTASAVQAADITVPQEVGETIVVAPA---------FSWTGFYFGGQIGGFS 56

Query: 67  SFGEEAH--------------------HNAGGSIFAGYNVEDSC-IMYGVEGDVRYTVPV 105
           S    +                         G  +AG NV+    ++ GV+ D+  +   
Sbjct: 57  SKTSFSSRDAEDLNKWDSLNKALWSKPSGFMGGFYAGSNVDLGNGLILGVDTDIVLSGQK 116

Query: 106 LAD--------------------------------NIHSLHGIGGSLRIRGGYEVSDSLL 133
                                              N        G+ R+R G+  +D ++
Sbjct: 117 DTKEHTVAVELKDQNAKQQREEQPENAKEAEITKYNHTLKEKWAGATRVRIGFA-ADRIM 175

Query: 134 LYATVGPDVAQKYET-----------------------GKAGEITPIAIGGTAGVGVEVG 170
            Y   G    Q  +T                           + +   IG T   GV+  
Sbjct: 176 PYVAGGVAYTQLQDTLETSVSQGKMPVQRNDETETSSQTNTVDESKTMIGYTLAAGVDF- 234

Query: 171 GLSESLVARLEYRASKYSK---------VEGFYNTISLGVGMKF 205
            ++++++ R EYR S + K         V    N   +GV  KF
Sbjct: 235 AMTDNVMLRAEYRYSDFGKKKLHNDKLEVSYKANDFRVGVAYKF 278


>gi|316932716|ref|YP_004107698.1| putative outer-membrane immunogenic protein [Rhodopseudomonas
           palustris DX-1]
 gi|315600430|gb|ADU42965.1| putative outer-membrane immunogenic protein precursor
           [Rhodopseudomonas palustris DX-1]
          Length = 207

 Score = 93.7 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 51/218 (23%), Positives = 80/218 (36%), Gaps = 24/218 (11%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K+ LA        A   +AQAAD      +    V   +           + GPY G 
Sbjct: 1   MRKVTLAAAAMIA--AGMSTAQAADMGYYRSNAPYTVNQPLNA-------FSWAGPYLGG 51

Query: 61  SALYNGSFGEEA---HHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLA-DNIHSLHGI 116
           +  Y                G +  GYN +   I++G+EGD++++            +  
Sbjct: 52  NLGYGWGNVTNNITKPSGFSGGLQGGYNWQSGNIVFGLEGDIQFSTADDTFAPYKFSNPW 111

Query: 117 GGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESL 176
            G+ R R GY ++D +L+YAT G    Q      A   +  + G T G G E    +  L
Sbjct: 112 FGTGRGRIGYAMND-VLIYATGGLAFGQLKGQNLAVSESHSSAGWTVGAGAEF-AFAPKL 169

Query: 177 VARLEYRASKYSKVEGFYN---------TISLGVGMKF 205
            A++EY     S    F            +  G+   F
Sbjct: 170 SAKVEYLYMSLSTNNFFITGMPNGYNAGMVRAGINYHF 207


>gi|192289773|ref|YP_001990378.1| outer-membrane immunogenic protein precursor [Rhodopseudomonas
           palustris TIE-1]
 gi|192283522|gb|ACE99902.1| putative outer-membrane immunogenic protein precursor
           [Rhodopseudomonas palustris TIE-1]
          Length = 207

 Score = 93.7 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 51/218 (23%), Positives = 81/218 (37%), Gaps = 24/218 (11%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K+ LA        AS  +AQAAD      +    V   +           + GPY G 
Sbjct: 1   MRKVTLAAAAVIA--ASVSTAQAADMGYYRSNAPYTVNQPLNA-------FSWAGPYLGG 51

Query: 61  SALYNGSFGEEA---HHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLA-DNIHSLHGI 116
           +  Y+               G +  GYN +   I++G+EGD++++            +  
Sbjct: 52  NLGYSWGNVTNNITKPSGFSGGVQGGYNWQSGNIVFGLEGDIQFSTADDTFAQYKFSNPW 111

Query: 117 GGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESL 176
            G+ R R GY ++D +L+YAT G    Q          +  + G T G G E    +  L
Sbjct: 112 FGTGRGRIGYAMND-VLIYATGGLAFGQLKGQNVFASESHSSAGWTVGAGAEF-AFAPKL 169

Query: 177 VARLEYRASKYSKVEGFYNT---------ISLGVGMKF 205
            A++EY     S    F            +  G+   F
Sbjct: 170 SAKVEYLYMSLSTSNFFITGMPNGYNAGLVRAGINYHF 207


>gi|289467881|gb|ADC95625.1| 31kDa outer membrane immunogenic protein precursor [Brucella
           melitensis bv. 1 str. M5]
          Length = 219

 Score = 93.7 bits (231), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 37/219 (16%), Positives = 68/219 (31%), Gaps = 50/219 (22%)

Query: 36  GVVPTIATNRYVPIRHDFNGPYAGLSALYNGSFG-------------------EEAHHNA 76
            V    A          + G Y G++A Y G                      +      
Sbjct: 2   VVSEPSAPTAAPVDTFSWTGGYIGINAGYAGGKFKHPFSSFDKEDNEQVSGSLDVTAGGF 61

Query: 77  GGSIFAGYNVEDSC-IMYGVEGDVRYTVPVLADNI---------HSLHGIGGSLRIRGGY 126
            G + AGYN +    ++ G E D + +    + +           +     G++R R GY
Sbjct: 62  VGGVQAGYNWQLDNGVVLGAETDFQGSSVTGSISAGASGLEGKAETKVEWFGTVRARLGY 121

Query: 127 EVSDSLLLYATVGPDVAQKYETGK--------AGEITPIAIGGTAGVGVEVGGLSESLVA 178
             ++ L++Y T G    +                       G T G G E   ++ +   
Sbjct: 122 TATERLMVYGTGGLAYGKVKSAFNLGDDAGALHTWSDKTKAGWTLGAGAEY-AINNNWTL 180

Query: 179 RLEYRASKYSK------------VEGFYNTISLGVGMKF 205
           + EY  +   K             +  ++T+ +G+  KF
Sbjct: 181 KSEYLYTDLGKRNLVDVDNSFLESKVNFHTVRVGLNYKF 219


>gi|148253259|ref|YP_001237844.1| putative outer membrane protein [Bradyrhizobium sp. BTAi1]
 gi|146405432|gb|ABQ33938.1| putative outer membrane protein precursor [Bradyrhizobium sp.
           BTAi1]
          Length = 206

 Score = 93.3 bits (230), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 44/202 (21%), Positives = 71/202 (35%), Gaps = 23/202 (11%)

Query: 17  SFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSF---GEEAH 73
              SAQAAD             P  A        + + GPY G +  Y            
Sbjct: 15  GSVSAQAADFNYGRQAPYTVNQPLNA--------YSWAGPYLGGTLGYEWGSVGNNPTKP 66

Query: 74  HNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLA-DNIHSLHGIGGSLRIRGGYEVSDSL 132
               G + AGYN ++   ++G EGD+  T            +   G++R R GY  ++ +
Sbjct: 67  SGLVGGLTAGYNWQNGPWVFGAEGDINLTGANDTFAPWKFSNPWFGTVRGRAGYAFNN-I 125

Query: 133 LLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKV-- 190
           L Y T G               +  ++G T G G E G L+++  A++EY          
Sbjct: 126 LFYGTGGLAFGGLRGETFGLSESHTSLGWTLGAGAEFG-LAQNWTAKIEYLYIDLDSSNF 184

Query: 191 -------EGFYNTISLGVGMKF 205
                  +  +  +  G+   F
Sbjct: 185 VITGAKNDYRFGVVRAGINFHF 206


>gi|146425555|emb|CAM89291.2| 25 kDa outer membrane protein [Brucella melitensis]
          Length = 163

 Score = 93.3 bits (230), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 47/169 (27%), Positives = 73/169 (43%), Gaps = 16/169 (9%)

Query: 7   AVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNG 66
            V VS+  L    +A AAD ++          P +     V  ++ + G Y GL   Y  
Sbjct: 1   LVIVSAALLPFSATAFAADAIQEQ--------PPVPAPVEVAPQYSWAGGYTGLYLGYGW 52

Query: 67  SF------GEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLA-DNIHSLHGIGGS 119
           +       G     +     FAG+N +   I+YGVEGD  Y+    + D +    G  GS
Sbjct: 53  NKAKTSTVGSIKPDDWKAGAFAGWNFQQDQIVYGVEGDAGYSWAKKSKDGLEVKQGFEGS 112

Query: 120 LRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVE 168
           LR R GY+++  ++ Y T G   +Q        + +   +G TAG G+E
Sbjct: 113 LRARVGYDLNP-VMPYLTAGIVGSQIKLNNGLDDESKFRVGWTAGAGLE 160


>gi|146426790|emb|CAM89444.2| 25 kDa outer membrane protein [Brucella ovis]
 gi|146426800|emb|CAM89435.2| 25 kDa outer membrane protein [Brucella ovis]
 gi|146426810|emb|CAM89426.2| 25 kDa outer membrane protein [Brucella ovis]
 gi|146426820|emb|CAM89417.2| 25 kDa outer membrane protein [Brucella ovis]
 gi|146426830|emb|CAM89408.2| 25 kDa outer membrane protein [Brucella ovis]
 gi|146426840|emb|CAM89399.2| 25 kDa outer membrane protein [Brucella ovis]
 gi|146426850|emb|CAM89390.2| 25 kDa outer membrane protein [Brucella ovis]
 gi|146426860|emb|CAM89381.2| 25 kDa outer membrane protein [Brucella ovis]
 gi|146426870|emb|CAM89372.2| 25 kDa outer membrane protein [Brucella ovis]
 gi|146426880|emb|CAM89363.2| 25 kDa outer membrane protein [Brucella ovis]
 gi|146426890|emb|CAM89354.2| 25 kDa outer membrane protein [Brucella ovis]
          Length = 163

 Score = 93.3 bits (230), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 46/169 (27%), Positives = 73/169 (43%), Gaps = 16/169 (9%)

Query: 7   AVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNG 66
            V VS+  L    +A AAD ++          P +     V  ++ + G Y GL   Y  
Sbjct: 1   LVIVSAALLPFSATAFAADAIQEQ--------PPVPAPVEVAPQYSWAGGYTGLYLGYGW 52

Query: 67  SF------GEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLA-DNIHSLHGIGGS 119
           +       G     +     FAG+N +   I+YGVEG+  Y+    + D +    G  GS
Sbjct: 53  NKAKTSTVGSIKPDDWKAGAFAGWNFQQDQIVYGVEGNAGYSWAKKSKDGLEVKQGFEGS 112

Query: 120 LRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVE 168
           LR R GY+++  ++ Y T G   +Q        + +   +G TAG G+E
Sbjct: 113 LRARVGYDLNP-VMPYLTAGIAGSQIKLNNGLDDESKFRVGWTAGAGLE 160


>gi|75674930|ref|YP_317351.1| outer membrane protein [Nitrobacter winogradskyi Nb-255]
 gi|74419800|gb|ABA03999.1| possible outer membrane protein [Nitrobacter winogradskyi Nb-255]
          Length = 209

 Score = 93.3 bits (230), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 44/213 (20%), Positives = 80/213 (37%), Gaps = 26/213 (12%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K+ L   +++  L S  +A AAD   R +      VP           +++ G Y G 
Sbjct: 1   MKKILL---ITAAVLVSVPAASAADLAPRPYTKAPPYVPAP--------IYNWTGFYLGG 49

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVED-SCIMYGVEGDVRYTVPVLADNIHSLHGIGGS 119
                 S G +      G + +G++++     ++G+EG   +        I   +   GS
Sbjct: 50  HIGGAFSNGRDGV--FLGGVQSGWDLQFAPNWVFGLEGSYSFLD----SGIAGANLGLGS 103

Query: 120 LRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPI--AIGGTAGVGVEVGGLSESLV 177
              R GY      L Y   G   A          I P     G T G G+E    +++  
Sbjct: 104 ATARLGYTWGGPALFYVKGGYGTAVLRGNNAIFGINPNIGLDGYTVGAGLEY-MFTQNWA 162

Query: 178 ARLEYRASKYS-----KVEGFYNTISLGVGMKF 205
            ++EY+   +       +    +T+ +G+  +F
Sbjct: 163 GKVEYQYFDFGRIAGTNINLDTHTVKVGLNYRF 195


>gi|163867925|ref|YP_001609129.1| hemin binding protein D [Bartonella tribocorum CIP 105476]
 gi|161017576|emb|CAK01134.1| hemin binding protein D [Bartonella tribocorum CIP 105476]
          Length = 279

 Score = 92.9 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 44/286 (15%), Positives = 79/286 (27%), Gaps = 99/286 (34%)

Query: 7   AVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNG 66
            +  S  +L S    QAAD V          VP+            + G Y G       
Sbjct: 6   LISTSIFSLISISVLQAADIVVSEQPVPVITVPS----------FSWTGFYLGGQIGNFS 55

Query: 67  SFGEEAH-------------------HNAGGSIFAGYNVEDSC-IMYGVEGDVRYTVPVL 106
                 +                       G ++AG N++     + G++ DV ++    
Sbjct: 56  GKTTANYLTKETGIWNPVEKEYLPKLSGFMGGVYAGSNIDIDNGFIIGIDTDVMWSNKKS 115

Query: 107 ADNI-------------------------------------HSLHGIGGSLRIRGGYEVS 129
             +I                                            G+ R++ G+   
Sbjct: 116 TKDILLPKKDETGEKKSLEKTSHTRDSHEDASTTLVEGVSHTLKQKWSGATRVKVGFAF- 174

Query: 130 DSLLLYATVGPDVAQ---------------------KYETGKAGEITPIAIGGTAGVGVE 168
           + ++ Y + G    Q                        +    +     IG T G GV+
Sbjct: 175 ERMMPYVSGGIAYTQLQNILSAVVDSATVADSESRAIDSSDWLHDEKKTMIGYTLGGGVD 234

Query: 169 VGGLSESLVARLEYRASKYSKVEG---------FYNTISLGVGMKF 205
              ++++++ R EYR S + K +            N   +GV  KF
Sbjct: 235 F-AMTDNVIVRAEYRYSDFGKKKFVQDKVEMSYKTNDFRVGVAYKF 279


>gi|240849915|ref|YP_002971304.1| hemin binding protein C [Bartonella grahamii as4aup]
 gi|240267038|gb|ACS50626.1| hemin binding protein C [Bartonella grahamii as4aup]
          Length = 277

 Score = 92.5 bits (228), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 47/281 (16%), Positives = 84/281 (29%), Gaps = 91/281 (32%)

Query: 7   AVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNG 66
            +  S+ A  S  +AQAAD +           PT      V     + G Y G       
Sbjct: 6   LITASAFAFVSVSAAQAADVIV-------PPSPTPVAPVIVAPTFSWTGFYLGGQLGGFS 58

Query: 67  SFGEEA-----------------HHNAGGSIFAGYNVEDSC-IMYGVEGDVRYTVPVLAD 108
              +                        G ++AG NV+    ++ GV+ D+ ++      
Sbjct: 59  GKTKMDILSNGKKIPAPDDLLPKLSGFMGGLYAGSNVDLGNGLILGVDTDIMWSNKDDTK 118

Query: 109 NIHS---------------------------------------LHGIGGSLRIRGGYEVS 129
             ++                                            G+ R+R G+  +
Sbjct: 119 TGNTYVILPDHINYIKKILTESGINIGKDALEAGAKRTHSFTFKEKWAGATRVRIGFA-A 177

Query: 130 DSLLLYATVGPDVAQKYE----------------TGKAGEITPIAIGGTAGVGVEVGGLS 173
           + ++ Y   G    Q  +                +G   + T   +G T G GV+   ++
Sbjct: 178 ERIMPYVAGGIAYTQLQDTASISITGKDSDKVIASGTLSDETKTLVGYTLGAGVD-LAMT 236

Query: 174 ESLVARLEYRASKYSKVEGFY---------NTISLGVGMKF 205
            +++ R EYR S + K +            N   +GV  KF
Sbjct: 237 NNVIVRAEYRYSDFGKKKFSNDKYETSYKTNDFRVGVAYKF 277


>gi|312112850|ref|YP_004010446.1| outer membrane protein [Rhodomicrobium vannielii ATCC 17100]
 gi|311217979|gb|ADP69347.1| outer membrane protein [Rhodomicrobium vannielii ATCC 17100]
          Length = 233

 Score = 92.5 bits (228), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 44/226 (19%), Positives = 80/226 (35%), Gaps = 31/226 (13%)

Query: 2   QKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLS 61
           +   L + +   A+     A AAD  R          P I         + + G Y G++
Sbjct: 5   RYRSLYLAIIGAAVTVPLGANAADMYRAPAPTTYAPPPPIVQP------NTWAGFYVGIN 58

Query: 62  ALYNGSFGEEAHHN----AGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSL---H 114
             Y     +++         G    GYN +    +YG+E D++        + ++     
Sbjct: 59  GGYGWGASDDSTRGDVNGGFGGGQIGYNFQSGNFVYGLETDLQAGRITGKSDDYASKETT 118

Query: 115 GIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGE----ITPIAIGGTAGVGVEVG 170
              G+LR R GY   ++LL Y T G       +     +          G TAG G+E  
Sbjct: 119 DWFGTLRGRLGYAFGNTLL-YGTGGFAYGGVNQKMNYADVLFSNDDTRTGWTAGAGIEY- 176

Query: 171 GLSESLVARLEYRASKYSKVE------------GFYNTISLGVGMK 204
            +S +   + EY+   + K +              ++T  +G+  +
Sbjct: 177 KVSGNWSLKGEYQYVDFGKEDLSGAASTIEGPETSFHTAKIGLNYR 222


>gi|319782584|ref|YP_004142060.1| porin [Mesorhizobium ciceri biovar biserrulae WSM1271]
 gi|317168472|gb|ADV12010.1| porin [Mesorhizobium ciceri biovar biserrulae WSM1271]
          Length = 242

 Score = 92.2 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 50/241 (20%), Positives = 74/241 (30%), Gaps = 41/241 (17%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+ L LA   +++ LA    A AAD    +           A           N   AG 
Sbjct: 7   MKILLLA---TAIILAPAGMACAADIAETSPTSAYDWSGLYAGVDIGYAAGKSNLFIAGG 63

Query: 61  SALYNGSFG-EEAHHNAGGSIFAGYNVEDSC-IMYGVEGDVRYTVPVL------------ 106
                         +   G +  G N +     + G E D+ Y                 
Sbjct: 64  GLGGATDLNVGVDPNGFIGGVHIGANYQMENSFVIGAEADIAYGNIDGLTALDAGGGGGV 123

Query: 107 ADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYE--------TGKAGEITPIA 158
              + S     GS R+R GY   D  L Y T G   A+             +    +   
Sbjct: 124 TTLLKSELKWSGSARLRAGYAF-DRTLPYITAGVAAAKYELIAVSAGGPAAEVTLHSDSH 182

Query: 159 IGGTAGVGVEVGGLSESLVARLEYRASKYSK--------------VEGFYNTISLGVGMK 204
           +G T G G+E    ++  +AR EYR S +                V+     I +G+  K
Sbjct: 183 VGWTVGAGIE-HAFTDRWIARAEYRYSDFGSQDLSVAAGLPTETHVDLQTQDIRVGLSYK 241

Query: 205 F 205
           F
Sbjct: 242 F 242


>gi|27377123|ref|NP_768652.1| hypothetical protein bll2012 [Bradyrhizobium japonicum USDA 110]
 gi|27350266|dbj|BAC47277.1| bll2012 [Bradyrhizobium japonicum USDA 110]
          Length = 308

 Score = 92.2 bits (227), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 40/238 (16%), Positives = 72/238 (30%), Gaps = 36/238 (15%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIAT-----NRYVPIRHDFNG 55
           M+K+ L +     AL +   +   D   +        +P  A        Y+     +  
Sbjct: 68  MKKI-LILTACIGALCAAAPSFGTDLAGQPVKVKAAPLPVAAPIIDWSGYYMGANGGWGT 126

Query: 56  PYAGLSALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLAD------- 108
            +         S G             GY  +   ++YG+EG   +     ++       
Sbjct: 127 SHNCWDFNGITSEGCHNSTGGTVGGQIGYRWQIFNMVYGLEGQGNWADFRGSNVSTAFPT 186

Query: 109 -NIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVA-------QKYETGKAGEITPIAIG 160
             + +     G L    GY  + ++LLY   G  V              + G+   +  G
Sbjct: 187 DTVGTTTDAFGLLTGHIGYAFN-AVLLYGKGGAAVTSNTYYVNSVATGTELGKNNDVRWG 245

Query: 161 GTAGVGVEVGGLSESLVARLEYRASKYSKVEG-------------FYNTISLGVGMKF 205
           G  G G EV  L+ +  A +EY      +                  + I+  +  KF
Sbjct: 246 GVLGAGAEVS-LTPNWSAGVEYNHLFMQRSNISFPAALGADRAHQDVDLITARLNYKF 302


>gi|315121798|ref|YP_004062287.1| outer membrane protein [Candidatus Liberibacter solanacearum
           CLso-ZC1]
 gi|313495200|gb|ADR51799.1| outer membrane protein [Candidatus Liberibacter solanacearum
           CLso-ZC1]
          Length = 231

 Score = 92.2 bits (227), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 87/232 (37%), Positives = 122/232 (52%), Gaps = 28/232 (12%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGG------RGVVPTIATNRYVPIRHDFN 54
           M+K FLAVGVS+L L SF + QAAD V+R             V   ++ NRYV  +    
Sbjct: 1   MKKFFLAVGVSTLTLVSFSAVQAADAVQRPQRRQHASVSRGVVPTVVSANRYVYSQQGIE 60

Query: 55  GPYAGLSALYNGSFGEEAHH-NAGGSIFAGYNVEDSCIMYGVEGDVRYT----------- 102
           GPYAG+S  +  +F  + H+ + GGS+FAGYNV++    YG E D RY+           
Sbjct: 61  GPYAGMSIFHERNFSGKDHNKDIGGSLFAGYNVQEGDFFYGAEADARYSHDIASKEHKAA 120

Query: 103 -----VPVLADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPI 157
                       ++      GSLR RGGYE++  +++Y TVG     K     A      
Sbjct: 121 RLDQKDDAAVSKMYHAADFSGSLRFRGGYEIAAPVVVYGTVGVAAVHKASKAPADAAASP 180

Query: 158 AI----GGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFYNTISLGVGMKF 205
           A     GGTAG+GVE   L ++++ R+EYRA+KYS V    N +SLG+G++F
Sbjct: 181 AKAFYIGGTAGLGVE-SVLVDNIIGRVEYRATKYSGVSHLQNVVSLGLGIRF 231


>gi|146427736|emb|CAM89993.2| 25 kDa outer membrane protein [Brucella neotomae]
 gi|146427746|emb|CAM89984.2| 25 kDa outer membrane protein [Brucella neotomae]
 gi|146427756|emb|CAM89975.2| 25 kDa outer membrane protein [Brucella neotomae]
          Length = 163

 Score = 92.2 bits (227), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 47/169 (27%), Positives = 73/169 (43%), Gaps = 16/169 (9%)

Query: 7   AVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNG 66
            V VS+  L    +A AAD ++          P +     V  ++ + G Y GL   Y  
Sbjct: 1   LVIVSAALLPFSATAFAADAIQEQ--------PPVPAPVEVAPQYSWAGGYTGLYLGYGW 52

Query: 67  SF------GEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLA-DNIHSLHGIGGS 119
           +       G     +     FAG+N +   I+YGVEGD  Y+    + D +    G  GS
Sbjct: 53  NKAKTSTVGSIKPDDWKAGAFAGWNFQQDQIVYGVEGDAGYSWAKKSKDGLEVKQGFEGS 112

Query: 120 LRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVE 168
           LR R GY+++  ++ Y T G   +Q        + +   +G TAG G+E
Sbjct: 113 LRARVGYDLN-LVMPYLTAGIAGSQIKLNNGLDDESKFRVGWTAGAGLE 160


>gi|261218682|ref|ZP_05932963.1| outer membrane protein 25b [Brucella ceti M13/05/1]
 gi|261321820|ref|ZP_05961017.1| outer membrane protein 25b [Brucella ceti M644/93/1]
 gi|260923771|gb|EEX90339.1| outer membrane protein 25b [Brucella ceti M13/05/1]
 gi|261294510|gb|EEX98006.1| outer membrane protein 25b [Brucella ceti M644/93/1]
          Length = 229

 Score = 91.8 bits (226), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 35/168 (20%), Positives = 59/168 (35%), Gaps = 37/168 (22%)

Query: 73  HHNAGGSIFAGYNVEDSC-IMYGVEGDVRYTVPVLA-----------DNIHSLHGIGGSL 120
                G ++AGYN +     + GV+GD+ Y     +             + S     G++
Sbjct: 64  PDGFLGGLYAGYNFDMGNNFVLGVDGDITYNDLDASHSDTDPDLDLTTGVDSKLRWSGAV 123

Query: 121 RIRGGYEVSDSLLLYATVGPDVAQKYETGKAGE--------ITPIAIGGTAGVGVEVGGL 172
           R R G  + D  + Y   G        +    +         +    G  AG GV+    
Sbjct: 124 RARMGVAM-DRWMPYIAGGVAFGNVKNSVSLTDGIESIGVSQSKTMTGWAAGAGVDYAA- 181

Query: 173 SESLVARLEYRASKYSKVEGFY---------------NTISLGVGMKF 205
           +++++ RLEYR + Y   +                  + I LGV  KF
Sbjct: 182 TDNVIVRLEYRYTDYGHKDFSVVDGDLSVEARNKFKTHDIRLGVAYKF 229


>gi|146343868|ref|YP_001208916.1| putative outer membrane protein [Bradyrhizobium sp. ORS278]
 gi|146196674|emb|CAL80701.1| putative outer membrane protein precursor [Bradyrhizobium sp.
           ORS278]
          Length = 278

 Score = 91.8 bits (226), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 50/280 (17%), Positives = 78/280 (27%), Gaps = 92/280 (32%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+ L       SL +AS  S  AAD   R                     +++ G Y G 
Sbjct: 6   MKTL---ASAVSLLIASSLSTFAADLSARYTKAPPPA-----------AIYNWTGGYFGG 51

Query: 61  SALYNGSFGEE-----------------------------AHHNAGGSIFAGYNVEDSCI 91
           +  Y                                          G + AGYN +    
Sbjct: 52  NIGYGWGRSNLGTTLDQTSSWATEPVPFQNQFVAISNNRLNPSGVVGGLQAGYNWQAGPS 111

Query: 92  MYGVEGDVRYTVPV-------------LADNIHSLHGIGGSLRIRGGYEVSDSLLLYATV 138
           ++G+E D+  +                   N    +    +LR R GY + D+ LLY T 
Sbjct: 112 VFGIEADINGSGVNKRVVYTGVNVPTTRTFNESIRNDWFMTLRGRAGYAI-DTTLLYVTG 170

Query: 139 GPDVAQKYET---------GKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSK 189
           G  V     +          K G       G T G GVE    + +   + EY  +    
Sbjct: 171 GLAVGNVKGSWDLTSGNGYNKTGSADQTRAGWTIGAGVE-HAFAPNWTVKAEYLYTDLGS 229

Query: 190 V-------------------------EGFYNTISLGVGMK 204
           +                         +  ++T+ +GV  K
Sbjct: 230 INYTSGYVPGSTFAPPGFNYVERLSQDFTFHTVRIGVNYK 269


>gi|222102056|ref|YP_002546646.1| hypothetical protein Arad_12130 [Agrobacterium radiobacter K84]
 gi|221728173|gb|ACM31182.1| conserved hypothetical protein [Agrobacterium radiobacter K84]
          Length = 205

 Score = 91.8 bits (226), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 43/185 (23%), Positives = 70/185 (37%), Gaps = 18/185 (9%)

Query: 35  RGVVPTIATNRYVPIRHDFNGPYAGLSALYNGS-----FGEEAHHNAGGSIFAGYNVEDS 89
                     +     ++++G Y G    Y+ +       +++ +        GYN +  
Sbjct: 25  TADQSAPQPEQQAYSAYNWSGFYLGAQGGYSWNKAKYLGADQSLNTGSAGAHVGYNFQTG 84

Query: 90  CIMYGVEGDVRYTVPVLADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETG 149
            I+YG+E D  Y          +      S R R GY +  +LL           K +  
Sbjct: 85  NIIYGIENDFNYN---FDKGNKADLQWDASGRARVGYALDRTLLFATAGLAAAGGKVDAP 141

Query: 150 KAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFYN---------TISLG 200
             G+   I IG TAG GVE   L+++++ R EYR S + K +   +          I LG
Sbjct: 142 AIGKKDDILIGWTAGAGVE-RALTDNILIRGEYRYSDFGKKDFGSDIGDFSATQQKIILG 200

Query: 201 VGMKF 205
              KF
Sbjct: 201 ASYKF 205


>gi|297248917|ref|ZP_06932626.1| Omp31b [Brucella abortus bv. 5 str. B3196]
 gi|297174251|gb|EFH33607.1| Omp31b [Brucella abortus bv. 5 str. B3196]
          Length = 176

 Score = 91.8 bits (226), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 29/170 (17%), Positives = 58/170 (34%), Gaps = 31/170 (18%)

Query: 66  GSFGEEAHHNAGGSIFAGYNVEDSC-IMYGVEGDVRYTVPVLADNI---------HSLHG 115
               +       G + AGYN +    ++ G E D + +    + +           +   
Sbjct: 8   SGSLDATAGGFVGGVQAGYNWQLDNGVVLGAETDFQGSSVTGSISAGASGLEGKAETKVE 67

Query: 116 IGGSLRIRGGYEVSDSLLLYATVGPDVAQKYE--------TGKAGEITPIAIGGTAGVGV 167
             G++R R GY  ++ L++Y T G    +           +           G T G G 
Sbjct: 68  WFGTVRARLGYTATERLMVYGTGGLAYGKVKSAFNLGDDASALHTWSDKTKAGWTLGAGA 127

Query: 168 EVGGLSESLVARLEYRASKYSK------------VEGFYNTISLGVGMKF 205
           E   ++ +   + EY  +   K             +  ++T+ +G+  KF
Sbjct: 128 EY-AINNNWTLKSEYLYTDLGKRNLVDVDNSFLESKVNFHTVRVGLNYKF 176


>gi|115525004|ref|YP_781915.1| putative outer-membrane immunogenic protein precursor
           [Rhodopseudomonas palustris BisA53]
 gi|115518951|gb|ABJ06935.1| putative outer-membrane immunogenic protein precursor
           [Rhodopseudomonas palustris BisA53]
          Length = 219

 Score = 91.8 bits (226), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 49/225 (21%), Positives = 79/225 (35%), Gaps = 34/225 (15%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K+ LA   ++  LA   ++ AAD   R +               V    +++G YAG+
Sbjct: 1   MKKILLA---TTALLAMGATSFAADLPARVYTKAP---------VLVAPGVNWSGFYAGV 48

Query: 61  SALYNGSFG---------EEAHHNAGGSIFAGYNVEDS--CIMYGVEGDVRYTVPVLAD- 108
              Y  S            +  +   G    GYN +      ++G+E D   +       
Sbjct: 49  FGGYGWSQDIKVDGLAIATDEINGGFGGGTVGYNWQAPGSQWVFGIEVDAAGSSLKYTTV 108

Query: 109 NIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVE 168
                    GS+  R GY V D+ L YA  G   A    T      + +  G T G G+E
Sbjct: 109 GFEDKIDAFGSVTGRVGYAV-DAALFYAKGGFAWADNKVTVPGFSESKLHTGWTVGGGLE 167

Query: 169 VGGLSESLVARLEYRASKYS--------KVEGFYNTISLGVGMKF 205
               + +   + EY  + Y          +    +T+  GV   F
Sbjct: 168 Y-MFAPAWSVKGEYMYADYGKETYGNIVDIGATVHTVKAGVNYHF 211


>gi|118593370|ref|ZP_01550754.1| outer membrane protein, putative [Stappia aggregata IAM 12614]
 gi|118434048|gb|EAV40705.1| outer membrane protein, putative [Stappia aggregata IAM 12614]
          Length = 208

 Score = 91.4 bits (225), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 43/219 (19%), Positives = 67/219 (30%), Gaps = 29/219 (13%)

Query: 2   QKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLS 61
           + L  A   S LA     +A AAD               +                    
Sbjct: 4   KHLLFAGATSLLA----SNAHAADLEVEPVAIQTYDWQGVYGGGQFGFGWFEGRDNL--- 56

Query: 62  ALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVL--ADNIHSLHGIGGS 119
                    E   +  G +  GYN      + G+EG+          + N+        +
Sbjct: 57  -----GSPPENLASPVGGVHVGYNHMLGQFVLGIEGEANLANFSDTTSANLDVDINWMIA 111

Query: 120 LRIRGGYEVSDSLLLYATVGPDVAQK--YETGKAGEITPIAIGGTAGVGVEVGGLSESLV 177
            R+R GY   D  L +AT G   ++      G     +    G   G GVE G ++E + 
Sbjct: 112 ARLRAGYAF-DRFLAFATTGVSFSEVTFEIPGTGISDSNTHTGFLFGGGVE-GYVTEHIS 169

Query: 178 ARLEYRASKYS-----------KVEGFYNTISLGVGMKF 205
            R EY+   +             +EG  + +  GV   F
Sbjct: 170 VRAEYQHHWFGNESYNVGAGAFDIEGDLDLLRAGVSYHF 208


>gi|49473903|ref|YP_031945.1| hemin binding protein c [Bartonella quintana str. Toulouse]
 gi|21689903|gb|AAM68128.1| hemin-binding protein C [Bartonella quintana]
 gi|49239406|emb|CAF25744.1| Hemin binding protein c [Bartonella quintana str. Toulouse]
          Length = 277

 Score = 91.4 bits (225), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 48/281 (17%), Positives = 80/281 (28%), Gaps = 91/281 (32%)

Query: 7   AVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNG 66
            +  S+ A  S  + QAAD V            T      V     + G Y G       
Sbjct: 6   LITASAFAFVSASTVQAADVVV-------PPRSTPIAPVIVAPTFSWTGFYIGGQIGGFS 58

Query: 67  SFGEEA-----------------HHNAGGSIFAGYNVEDSC-IMYGVEGDVRYTVPVLAD 108
           S  +                        G I+ G NV+    ++ GV+ D+ ++      
Sbjct: 59  SKTKMNILANGKTFPVKDDLLPKLSGFMGGIYVGSNVDLGNGLILGVDTDIIWSDKKYTK 118

Query: 109 N---------------------------------------IHSLHGIGGSLRIRGGYEVS 129
                                                           G+ R+R G+  +
Sbjct: 119 TGKVYEITEQHIPYIKKMLTEAGIAISNNDLKPGAKRVHSFTFKEKWAGATRVRIGFA-A 177

Query: 130 DSLLLYATVGPDVAQKYE----------------TGKAGEITPIAIGGTAGVGVEVGGLS 173
           + ++ Y   G    Q  +                +G   + T   +G T G GV+   ++
Sbjct: 178 ERIMPYVAGGIAYTQLQDIGSISIKNKDSSKVIASGNLSDETKTFVGYTLGAGVD-LAMT 236

Query: 174 ESLVARLEYRASKYSKVEGF---------YNTISLGVGMKF 205
            ++V R EYR S + K +            N   +GV  KF
Sbjct: 237 NNVVVRAEYRYSDFGKKKFTKGQLETSYKTNDFRVGVAYKF 277


>gi|163867545|ref|YP_001608744.1| hemin binding protein C [Bartonella tribocorum CIP 105476]
 gi|161017191|emb|CAK00749.1| hemin binding protein C [Bartonella tribocorum CIP 105476]
          Length = 277

 Score = 91.4 bits (225), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 46/281 (16%), Positives = 83/281 (29%), Gaps = 91/281 (32%)

Query: 7   AVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNG 66
            +  S+ A  S  +AQAAD +           PT      V     + G Y G       
Sbjct: 6   LITASAFAFVSVSAAQAADVIV-------PPSPTPVAPVIVAPTFSWTGFYFGGQIGGFS 58

Query: 67  SFGEEA-----------------HHNAGGSIFAGYNVEDSC-IMYGVEGDVRYT------ 102
              +                        G ++AG N++    ++ GV+ D+ ++      
Sbjct: 59  GKTKMDILAKGQKIPVSDDYLPKLSGFMGGLYAGSNIDLGNGLILGVDTDIMWSNKDDTK 118

Query: 103 ---------------------------------VPVLADNIHSLHGIGGSLRIRGGYEVS 129
                                                  +        G+ R+R G+  +
Sbjct: 119 TGKTYVIAPGHINYINKILKDAAINIGKDALEAGAKRTHSFTFKEKWAGATRVRIGFA-A 177

Query: 130 DSLLLYATVGPDVAQKYE----------------TGKAGEITPIAIGGTAGVGVEVGGLS 173
           + ++ Y   G    Q  +                +G   + T   +G T G GV+   ++
Sbjct: 178 ERIMPYVAGGIAYTQLQDTASISITEKDSDKVIASGTLSDETKTLVGYTLGAGVD-LAMT 236

Query: 174 ESLVARLEYRASKYSKVEGFY---------NTISLGVGMKF 205
            +++ R EYR S + K +            N   +GV  KF
Sbjct: 237 NNIIVRAEYRYSDFGKKKFSNDKYETSYKTNDFRVGVAYKF 277


>gi|110632458|ref|YP_672666.1| outer membrane protein, 31 kDa [Mesorhizobium sp. BNC1]
 gi|110283442|gb|ABG61501.1| outer membrane protein, 31 kDa [Chelativorans sp. BNC1]
          Length = 237

 Score = 91.0 bits (224), Expect = 9e-17,   Method: Composition-based stats.
 Identities = 40/216 (18%), Positives = 70/216 (32%), Gaps = 28/216 (12%)

Query: 7   AVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNG 66
            +  ++ A     SA AAD +  A        P  A   +        G  A     +N 
Sbjct: 3   LLVATAAACVISSSAFAADILYDAPPAPPAPPPPPAPFNWTGPYVGVYGGIAAGDIKHNL 62

Query: 67  S-----------FGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNI----- 110
           +                   A G I  GY+ + +  + G   D+  T   + ++      
Sbjct: 63  NVLGNVPFTGLLTERSRAGGAIGGIQVGYDWQVNNWVLGAVADIAATNYEVKNSYYVLGT 122

Query: 111 -----HSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAG-----EITPIAIG 160
                 S     G++R R GY   D  L+Y   G    +  +T         + +    G
Sbjct: 123 RIAKDSSKLSYLGTVRARAGYAW-DRTLVYGHGGFAYGKTKQTSDFIGTDTLKQSQTRTG 181

Query: 161 GTAGVGVEVGGLSESLVARLEYRASKYSKVEGFYNT 196
            T G GVE   +++ +    EY    + K + + + 
Sbjct: 182 WTIGAGVEY-AVTDRISLGSEYSYVDFGKKDIYKDA 216


>gi|239832169|ref|ZP_04680498.1| Hypothetical protein, conserved [Ochrobactrum intermedium LMG 3301]
 gi|239824436|gb|EEQ96004.1| Hypothetical protein, conserved [Ochrobactrum intermedium LMG 3301]
          Length = 212

 Score = 91.0 bits (224), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 44/220 (20%), Positives = 77/220 (35%), Gaps = 26/220 (11%)

Query: 2   QKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLS 61
           ++   AV + +  +A   SA AAD +    +           +      HD++G Y G  
Sbjct: 3   KRSITAVALGAAIVAFAGSAFAADMMGATDYS--------YNDPVASGPHDWSGNYIGAQ 54

Query: 62  ALYNGSFGEE---AHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVP--VLADNIHSLHGI 116
              + S           A G +  G N++   +++G E +  +      +          
Sbjct: 55  IGASSSKVPGPFTNRTGALGGVVVGKNMQSGNVVFGAELEGNFAEAEHRIGHGGSLQQSW 114

Query: 117 GGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESL 176
            G+ + + GY   D  L+Y T G  V +               G   G GVE   L+  L
Sbjct: 115 NGNAKGKVGYAF-DKTLVYGTAGYGVTRFKAKDNTTSAPGWEGGALIGAGVEQ-ALTGPL 172

Query: 177 VARLEYRASKYSKVEGFY-----------NTISLGVGMKF 205
             + EY   ++S V+              ++I  G+  KF
Sbjct: 173 SVKAEYDFQRFSDVKSRVNGVEQRNNLKNHSIKAGLNYKF 212


>gi|126729809|ref|ZP_01745622.1| outer membrane protein, putative [Sagittula stellata E-37]
 gi|126709928|gb|EBA08981.1| outer membrane protein, putative [Sagittula stellata E-37]
          Length = 220

 Score = 90.6 bits (223), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 38/212 (17%), Positives = 69/212 (32%), Gaps = 24/212 (11%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K  L + V+  AL +  SA + D           V    A         ++ G Y GL
Sbjct: 26  MKKHILTMTVAIAALGTAASAGSLDVTPVEPAPMTPVEVVPAAPVG-----NWTGGYTGL 80

Query: 61  SALYNG-SFGEEAHHNAGGSIFAGYNVEDSC-IMYGVEGDVRYTVPVLADNIHSLHGIGG 118
           S      S G          +  GY+ +    I+ G E + +    +  +          
Sbjct: 81  SLGGAQASSGGSEESGMIYGLHGGYDYQFGNGIVLGGEAEFQGNNDLSVNGFDV--DNVS 138

Query: 119 SLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVA 178
             + R GY++    L+Y T G                        G+G+E   +++    
Sbjct: 139 RAKARMGYDLG-QALVYGTAGVSKVNTSIGEA--------TSPVYGLGMEY-KVTDKFSV 188

Query: 179 RLEYRASKY-----SKVEGFYNTISLGVGMKF 205
             EY    +     +  +   +++SL    +F
Sbjct: 189 GAEYLNEDFQDLGSTNTDLQQDSLSLRGNFRF 220


>gi|217977074|ref|YP_002361221.1| porin [Methylocella silvestris BL2]
 gi|217502450|gb|ACK49859.1| porin [Methylocella silvestris BL2]
          Length = 254

 Score = 90.6 bits (223), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 52/244 (21%), Positives = 78/244 (31%), Gaps = 43/244 (17%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRG------VVPTIATNRYVPIRHDFN 54
           M +  L   V ++ALA   +A AAD   RA                +     +       
Sbjct: 2   MLRRLLLASVGAVALAG--TAFAADLPSRAPPPVYVPPAPIFTWTGVYIGGQIGYAWGTQ 59

Query: 55  GPYAGLSALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLAD------ 108
               G S +              G    GYN++ S  + G+EG V  +    +       
Sbjct: 60  NANFGDSFIGTLGSVSYDTSGVLGGAHVGYNLQLSQFVVGLEGSVDGSSMSKSAFLTDEF 119

Query: 109 ----NIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYET----GKAGEITPIAIG 160
                + +   I GS+R R GY   D +LLYAT G   A               +   +G
Sbjct: 120 GNSLTLSAQSNIQGSIRGRVGYAW-DRVLLYATGGVAFAGVKANFYGPFSYDSASSTRVG 178

Query: 161 GTAGVGVEVGGLSESLVARLEYRASKYS-------------------KVEGFYNTISLGV 201
            T G G+E   ++ +   R EYR S +                          N + +G 
Sbjct: 179 WTVGGGLEY-AVTNNWSVRAEYRYSDFGHSTFYPSNYGSVVLTSPFINRHFKENQVQVGF 237

Query: 202 GMKF 205
             KF
Sbjct: 238 SYKF 241


>gi|86748303|ref|YP_484799.1| outer membrane protein [Rhodopseudomonas palustris HaA2]
 gi|86571331|gb|ABD05888.1| outer membrane protein [Rhodopseudomonas palustris HaA2]
          Length = 207

 Score = 90.6 bits (223), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 47/200 (23%), Positives = 72/200 (36%), Gaps = 22/200 (11%)

Query: 19  CSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSFGEEA---HHN 75
            +AQAAD           V   +           + GPY G +  Y              
Sbjct: 17  STAQAADMGYYGSRTPYTVNQPLNA-------FSWAGPYLGGNLGYAFGNVTNNITKPSG 69

Query: 76  AGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLA-DNIHSLHGIGGSLRIRGGYEVSDSLLL 134
             G +  GYN +   I++G+EGD++++       +    +   G+ R R GY ++D +LL
Sbjct: 70  FSGGVQGGYNWQSGNIVFGLEGDIQFSTANDTFASYKFSNPWFGTARGRVGYAMND-ILL 128

Query: 135 YATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFY 194
           YAT G    Q          +  + G T G G E    +  L A++EY     S    F 
Sbjct: 129 YATGGLAFGQLKGEYLLSSESHTSAGWTVGAGAEF-AFAPKLSAKVEYLYGSLSTNNFFI 187

Query: 195 NT---------ISLGVGMKF 205
                      I  G+   F
Sbjct: 188 TGAPNGYNFGLIRAGINYHF 207


>gi|307320995|ref|ZP_07600402.1| porin [Sinorhizobium meliloti AK83]
 gi|306893369|gb|EFN24148.1| porin [Sinorhizobium meliloti AK83]
          Length = 213

 Score = 90.2 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 53/210 (25%), Positives = 79/210 (37%), Gaps = 13/210 (6%)

Query: 8   VGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLS-ALYNG 66
           V V+    +    A  A  + +A      V    +            G     S     G
Sbjct: 5   VLVAVFGASLLGGAAHAADLAQAPEPAPTVETISSFVWTGGYLGLQGGGGWLNSDLSVPG 64

Query: 67  SFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPV---LADNIHSLHGIGGSLRIR 123
               E         FAGYN +    + GVEGDV Y          +  +   + GS+R R
Sbjct: 65  GSASEKFSGGLFGAFAGYNYQHGDWVVGVEGDVSYNWNDETVFGSDTEAGTDVSGSVRAR 124

Query: 124 GGYEVSDSLLLYATVGPDVAQKYETGKAGE-ITPIAIGGTAGVGVEVGGLSESLVARLEY 182
            GY V+D  L+YAT G  V + +              G T G GV+ G  ++S+  R EY
Sbjct: 125 LGYTVNDRTLIYATGGWAVTRGFVDVAGAPKEKETFNGWTIGGGVDYGF-TDSVFGRAEY 183

Query: 183 RASKYSK-------VEGFYNTISLGVGMKF 205
           R + +         V+   +  ++GVG+KF
Sbjct: 184 RYNDFGDKDVGGVNVDLDQHQFTVGVGVKF 213


>gi|13471424|ref|NP_102990.1| outer membrane protein [Mesorhizobium loti MAFF303099]
 gi|14022166|dbj|BAB48776.1| outer membrane protein [Mesorhizobium loti MAFF303099]
          Length = 225

 Score = 90.2 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 45/226 (19%), Positives = 75/226 (33%), Gaps = 25/226 (11%)

Query: 3   KLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDF-NGPYAGLS 61
           +  + +G    A     +A AAD                     +       + P+    
Sbjct: 2   RASIFIGSVFFAALMAGTALAADATVELPVASSYNWTGGYIGAQIGGGWSKVDQPWGFTE 61

Query: 62  ALYN-GSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYT------VPVLADNIHSLH 114
           A  N             G + AGYN +    ++G E D+  T           D      
Sbjct: 62  ASPNIFDQDNADGSGVVGGLHAGYNWQSGSFVFGGEADINATGIDGDDGGSGGDINGFKA 121

Query: 115 GIGGSLRIRGGYEVSDSLLLYATVGPDV----AQKYETGKAGEITPIAIGGTAGVGVEVG 170
               S+R R G+   D +L+Y T G       A   + G+    +    G T G G E  
Sbjct: 122 RWVASVRARAGFAF-DRVLIYGTGGYAYLNGKADTRDVGRQESHSASFNGWTIGAGAEY- 179

Query: 171 GLSESLVARLEYRASKYSKVEGFY-----------NTISLGVGMKF 205
            L++++  R EYR + +      +           +T+++GV  KF
Sbjct: 180 ALTDNITVRGEYRYADFGSKTVVFNNYVEDISPALHTVTIGVSYKF 225


>gi|49475067|ref|YP_033108.1| hemin binding protein a [Bartonella henselae str. Houston-1]
 gi|2150037|gb|AAC39274.1| Pap31 [Bartonella henselae phage 60457]
 gi|49237872|emb|CAF27068.1| Hemin binding protein a [Bartonella henselae str. Houston-1]
          Length = 279

 Score = 90.2 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 51/284 (17%), Positives = 84/284 (29%), Gaps = 95/284 (33%)

Query: 7   AVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNG 66
            +  S +AL S  +AQAAD +         +               + G Y G       
Sbjct: 6   LMTTSVIALISASAAQAADVIVPHEVAPTVISAPA---------FSWTGFYIGGQVGNFS 56

Query: 67  SFGEEAH----------------HNAGGSIFAGYNVEDSC-IMYGVEGDVRYTV------ 103
           S  E                       G I+AG N++    ++ GVE D  +        
Sbjct: 57  SKVEITDPNKKDKLFSKDDTPKPSGFMGGIYAGSNMDLGNNMILGVETDAVWADREDAKT 116

Query: 104 -------------------------------------PVLADNIHSLHGIGGSLRIRGGY 126
                                                    D++       G+ R+R G+
Sbjct: 117 SSAEAIGQDELETFRDSLKKANAAFAQGKTSDNVAAVDKHTDSLALKEKWSGATRVRIGF 176

Query: 127 EVSDSLLLYATVGPDVAQKY----------------ETGKAGEITPIAIGGTAGVGVEVG 170
             +D ++ Y   G   AQ                   T +  + T   +G T G GV+  
Sbjct: 177 TAADRIMPYVAGGVSYAQVQAVSSTKVTQAADDAEIATAQLFDKTKTLVGFTLGGGVDF- 235

Query: 171 GLSESLVARLEYRASKYSKVEG---------FYNTISLGVGMKF 205
            ++++++ R EYR S + K +            N   +GV  KF
Sbjct: 236 AMTDNVLLRAEYRYSDFGKKKFEKEGSEFSYKTNDFRVGVAYKF 279


>gi|31322670|gb|AAP22071.1| outer membrane protein [Sinorhizobium fredii]
          Length = 212

 Score = 90.2 bits (222), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 56/217 (25%), Positives = 95/217 (43%), Gaps = 17/217 (7%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+ L   +  S++AL +  +A AAD V              A   +      + G  A  
Sbjct: 1   MRTLTTTLMASAIALVALQAAHAADAVDEVPAAPAAEYTDPAVKNWSGA---YVGGTANW 57

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVL-ADNIHSLHGIGGS 119
                 + G       GG ++ GYNV+D  ++YG E DV Y      +       G+ GS
Sbjct: 58  HHGEADATGGNTSAGFGGGLYGGYNVQDGQMVYGGEADVNYAGNDSHSSGRRVKQGVNGS 117

Query: 120 LRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVAR 179
           +R R G +++  +L+Y T G  +     +  AG      +G TAG G E   +++++ AR
Sbjct: 118 VRGRVGVDLNP-VLVYGTAGLALGNAKLSTPAGSDDKTLVGWTAGAGAET-FVTDNVTAR 175

Query: 180 LEYRASKYSKVEG-----------FYNTISLGVGMKF 205
           +EYR + Y+  +              +++ LG+G+KF
Sbjct: 176 VEYRYTDYASKDFRTGGSTVSSGYDEHSVKLGMGVKF 212


>gi|213161917|ref|ZP_03347627.1| outer membrane protein A [Salmonella enterica subsp. enterica
           serovar Typhi str. E00-7866]
 gi|213425902|ref|ZP_03358652.1| outer membrane protein A [Salmonella enterica subsp. enterica
           serovar Typhi str. E02-1180]
 gi|213622699|ref|ZP_03375482.1| outer membrane protein A [Salmonella enterica subsp. enterica
           serovar Typhi str. E98-2068]
 gi|289826790|ref|ZP_06545725.1| outer membrane protein A [Salmonella enterica subsp. enterica
           serovar Typhi str. E98-3139]
          Length = 369

 Score = 90.2 bits (222), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 35/216 (16%), Positives = 70/216 (32%), Gaps = 32/216 (14%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K  +A+ V+         AQAA                     Y   +  ++  +   
Sbjct: 20  MKKTAIAIAVALA--GFATVAQAA---------------PKDNTWYAGAKLGWSQYHDT- 61

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGSL 120
              +  + G    +  G   F GY V            +        +   +    G  L
Sbjct: 62  --GFIHNDGPTHENQLGAGAFGGYQVNPYVGFEMGYDWLGRMPYKGDNTNGAYKAQGVQL 119

Query: 121 RIRGGYEVSDSLLLYATVGPDVAQKYET-----GKAGEITPIAIGGTAGVGVEVGGLSES 175
             + GY ++D L +Y  +G  V +         G + +     +      G+E   ++  
Sbjct: 120 TAKLGYPITDDLDVYTRLGGMVWRADTKSNVPGGASTKDHDTGVSPVFAGGIEY-AITPE 178

Query: 176 LVARLEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
           +  RLEY+ +      + +    +   +S+GV  +F
Sbjct: 179 IATRLEYQWTNNIGDANTIGTRPDNGLLSVGVSYRF 214


>gi|300024284|ref|YP_003756895.1| porin [Hyphomicrobium denitrificans ATCC 51888]
 gi|299526105|gb|ADJ24574.1| porin [Hyphomicrobium denitrificans ATCC 51888]
          Length = 218

 Score = 89.8 bits (221), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 40/196 (20%), Positives = 66/196 (33%), Gaps = 25/196 (12%)

Query: 33  GGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSFG-EEAHHNAGGSIFAGYNVEDSCI 91
           G             V     ++G Y G++  Y  S           G    GYN +   +
Sbjct: 25  GPYQPYNPPPEAAPVYQPAIWDGAYIGINGGYGWSDARPTEPEGGFGGGQIGYNWQRGRV 84

Query: 92  MYGVEGDVRYTVPVL------ADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQK 145
           ++G+EGD +             D   S      ++R R G+      LLYAT G  VA  
Sbjct: 85  VFGLEGDFQGADISGRAYTFDGDTARSDMNWFSTVRGRLGFTSGP-WLLYATGGLAVADV 143

Query: 146 Y----ETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRAS------------KYSK 189
                  G++   +    G   G G+E    S++  A+ EY                + +
Sbjct: 144 DHRANLEGQSFRGSDTLTGYAVGGGLE-WKFSQNWSAKAEYLYLGLGDSKLTADNGDFVR 202

Query: 190 VEGFYNTISLGVGMKF 205
           +     T+ +G+   F
Sbjct: 203 INNDVQTVRVGLNYHF 218


>gi|319898374|ref|YP_004158467.1| Pap31 [Bartonella clarridgeiae 73]
 gi|319402338|emb|CBI75877.1| Pap31 [Bartonella clarridgeiae 73]
          Length = 292

 Score = 89.8 bits (221), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 51/298 (17%), Positives = 81/298 (27%), Gaps = 110/298 (36%)

Query: 7   AVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNG 66
            +  S +AL +  +AQAAD       G   VV              + G Y G       
Sbjct: 6   LMTASVVALMTAYAAQAADITVPQETGETIVVAPA---------FSWTGFYVGGQIGGFS 56

Query: 67  SFGEEAH--------------------HNAGGSIFAGYNVEDSC-IMYGVEGDVRYTVPV 105
           S    +                         G  + G NV+    ++ GV+ DV ++   
Sbjct: 57  SKTSFSSRDGDDSKKWLPLHKDLWSKPSGFTGGFYTGSNVDLGNGLILGVDTDVIWSGRK 116

Query: 106 LADNIHS-----------------------------------------LHGIGGSLRIRG 124
                                                                G+ RIR 
Sbjct: 117 DEKTHEVTVELEDKDKNKHQEKSVSRSPVVFADGEEKEVEITKYGHTLKEKWAGATRIRI 176

Query: 125 GYEVSDSLLLYATVGPDVAQKYETGKAG----------------------------EITP 156
           G+  +D ++ Y   G    Q  ++                                + + 
Sbjct: 177 GFA-ADRIMPYVAGGVAYTQLQDSFSTSVSRQKVSGAKAERADKEPSAEPNTVNTVDESK 235

Query: 157 IAIGGTAGVGVEVGGLSESLVARLEYRASKYSK---------VEGFYNTISLGVGMKF 205
             IG T G GV+   +++++V R EYR S + K         V    N   +GV  KF
Sbjct: 236 TMIGYTLGAGVDF-AMTDNVVLRAEYRYSDFGKKKLHNDKLEVNYKANDFRVGVAYKF 292


>gi|153009238|ref|YP_001370453.1| hypothetical protein Oant_1908 [Ochrobactrum anthropi ATCC 49188]
 gi|151561126|gb|ABS14624.1| conserved hypothetical protein [Ochrobactrum anthropi ATCC 49188]
          Length = 212

 Score = 89.8 bits (221), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 44/220 (20%), Positives = 78/220 (35%), Gaps = 26/220 (11%)

Query: 2   QKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLS 61
           ++   AV + +  +A   SA AAD +    +           +      HD++G Y G  
Sbjct: 3   KRSITAVALGAAIVAFAGSAFAADMMGATDYS--------YNDPVAAGPHDWSGNYVGAQ 54

Query: 62  ALYNGSFGEE---AHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVP--VLADNIHSLHGI 116
              + S           A G +  G N++   +++G E +  +      + +        
Sbjct: 55  VGASSSRVPGPFTNRTGALGGVVVGKNMQSGNVVFGGELEGNFAEAEHRIGNGGSLQQSW 114

Query: 117 GGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESL 176
            G+ + + GY   D  L+Y T G  V +               G   G GVE   LS  L
Sbjct: 115 NGNAKGKVGYAF-DKTLVYGTAGYGVTRFKAKDNTTSAPGWEGGALVGAGVEQ-ALSGPL 172

Query: 177 VARLEYRASKYSKVEGFY-----------NTISLGVGMKF 205
             + EY   +++ V+              ++I  G+  KF
Sbjct: 173 SVKAEYDFQRFNDVKSRVNGVEQRNNLKNHSIKAGLNYKF 212


>gi|15965438|ref|NP_385791.1| outer-membrane protein [Sinorhizobium meliloti 1021]
 gi|307310613|ref|ZP_07590260.1| porin [Sinorhizobium meliloti BL225C]
 gi|15074619|emb|CAC46264.1| Probable outer-membrane protein [Sinorhizobium meliloti 1021]
 gi|306899723|gb|EFN30349.1| porin [Sinorhizobium meliloti BL225C]
          Length = 215

 Score = 89.8 bits (221), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 53/212 (25%), Positives = 79/212 (37%), Gaps = 15/212 (7%)

Query: 8   VGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLS-ALYNG 66
           V V+    +    A  A  + +A      V    +            G     S     G
Sbjct: 5   VLVAVFGASLLGGAAHAADLAQAPEPAPTVETISSFVWTGGYLGLQGGGGWLNSDLSVPG 64

Query: 67  SFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPV-----LADNIHSLHGIGGSLR 121
               E         FAGYN +    + GVEGDV Y            +  +   + GS+R
Sbjct: 65  GSASEKFSGGLFGAFAGYNYQHGDWVVGVEGDVSYNWNDETVTVFGSDTEAGTDVSGSVR 124

Query: 122 IRGGYEVSDSLLLYATVGPDVAQKYETGKAGE-ITPIAIGGTAGVGVEVGGLSESLVARL 180
            R GY V+D  L+YAT G  V + +              G T G GV+ G  ++S+  R 
Sbjct: 125 ARLGYTVNDRTLIYATGGWAVTRGFVDVAGAPKEKETFNGWTIGGGVDYGF-TDSVFGRA 183

Query: 181 EYRASKYSK-------VEGFYNTISLGVGMKF 205
           EYR + +         V+   +  ++GVG+KF
Sbjct: 184 EYRYNDFGDKDVGGVNVDLDQHQFTVGVGVKF 215


>gi|319403668|emb|CBI77253.1| Hemin binding protein d [Bartonella rochalimae ATCC BAA-1498]
          Length = 262

 Score = 89.8 bits (221), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 46/263 (17%), Positives = 85/263 (32%), Gaps = 70/263 (26%)

Query: 7   AVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNG 66
            +   S         QAAD ++         VP I+++        + G Y G       
Sbjct: 6   LLVACSWTFIPVSMVQAADIMKPHQSQSYQPVPVISSSN----NFSWTGFYVGAQIGGFS 61

Query: 67  SFGEEAH----------------------HNAGGSIFAGYNVEDS-CIMYGVEGDVRYTV 103
                +                           G I+AG N   S  ++ G++ D+ ++ 
Sbjct: 62  GEATLSPIQDSVEEDREGQGFSEIKSPKLSGFIGGIYAGSNFSLSKDLILGIDTDMVWSG 121

Query: 104 PVLAD---------NIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQ---------- 144
                         ++       G++R+R G+ + D ++ Y + G    Q          
Sbjct: 122 KKNTKVFDVQDMSIDMSIKEKWAGAMRMRVGFAM-DRVMPYVSGGVSYVQLQNVFTAKRL 180

Query: 145 -------------KYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVE 191
                             K  + T I +G + G GV+V  ++++++ R EYR S + K +
Sbjct: 181 AKAVVRERRNTLPSDSEPKFLDETKILVGYSVGGGVDV-AMTDNVIMRAEYRYSDFGKKK 239

Query: 192 G---------FYNTISLGVGMKF 205
                       N   +GV  KF
Sbjct: 240 FAKDNVDLSYKTNDFRVGVAYKF 262


>gi|168243859|ref|ZP_02668791.1| outer membrane protein A [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL486]
 gi|198244081|ref|YP_002215003.1| outer membrane protein A [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
 gi|197938597|gb|ACH75930.1| outer membrane protein A [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
 gi|205337186|gb|EDZ23950.1| outer membrane protein A [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL486]
 gi|312912061|dbj|BAJ36035.1| outer membrane protein A [Salmonella enterica subsp. enterica
           serovar Typhimurium str. T000240]
 gi|323129338|gb|ADX16768.1| outer membrane protein A [Salmonella enterica subsp. enterica
           serovar Typhimurium str. 4/74]
 gi|326627270|gb|EGE33613.1| outer membrane protein A [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 9]
          Length = 369

 Score = 89.8 bits (221), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 36/219 (16%), Positives = 71/219 (32%), Gaps = 38/219 (17%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K  +A+ V+         AQAA                     Y   +  ++  +   
Sbjct: 20  MKKTAIAIAVALA--GFATVAQAA---------------PKDNTWYAGAKLGWSQYHDT- 61

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGG-- 118
              +  + G    +  G   F GY V       G E    +   +     +         
Sbjct: 62  --GFIHNDGPTHENQLGAGAFGGYQV---NPYVGFEMGYDWLGRMPYKGDNINGAYKAQG 116

Query: 119 -SLRIRGGYEVSDSLLLYATVGPDVAQKYET-----GKAGEITPIAIGGTAGVGVEVGGL 172
             L  + GY ++D L +Y  +G  V +         G + +     +      G+E   +
Sbjct: 117 VQLTAKLGYPITDDLDVYTRLGGMVWRADTKSNVPGGPSTKDHDTGVSPVFAGGIEY-AI 175

Query: 173 SESLVARLEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
           +  +  RLEY+ +      + +    +   +S+GV  +F
Sbjct: 176 TPEIATRLEYQWTNNIGDANTIGTRPDNGLLSVGVSYRF 214


>gi|213646608|ref|ZP_03376661.1| outer membrane protein A [Salmonella enterica subsp. enterica
           serovar Typhi str. J185]
          Length = 358

 Score = 89.8 bits (221), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 35/216 (16%), Positives = 70/216 (32%), Gaps = 32/216 (14%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K  +A+ V+         AQAA                     Y   +  ++  +   
Sbjct: 9   MKKTAIAIAVALA--GFATVAQAA---------------PKDNTWYAGAKLGWSQYHDT- 50

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGSL 120
              +  + G    +  G   F GY V            +        +   +    G  L
Sbjct: 51  --GFIHNDGPTHENQLGAGAFGGYQVNPYVGFEMGYDWLGRMPYKGDNTNGAYKAQGVQL 108

Query: 121 RIRGGYEVSDSLLLYATVGPDVAQKYET-----GKAGEITPIAIGGTAGVGVEVGGLSES 175
             + GY ++D L +Y  +G  V +         G + +     +      G+E   ++  
Sbjct: 109 TAKLGYPITDDLDVYTRLGGMVWRADTKSNVPGGASTKDHDTGVSPVFAGGIEY-AITPE 167

Query: 176 LVARLEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
           +  RLEY+ +      + +    +   +S+GV  +F
Sbjct: 168 IATRLEYQWTNNIGDANTIGTRPDNGLLSVGVSYRF 203


>gi|90419513|ref|ZP_01227423.1| OmpA-like transmembrane domain [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90336450|gb|EAS50191.1| OmpA-like transmembrane domain [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 223

 Score = 89.8 bits (221), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 47/194 (24%), Positives = 77/194 (39%), Gaps = 26/194 (13%)

Query: 36  GVVPTIATNRYVPIRHDFNGPYAGLSALYNGSFGEEA------HHNAGGSIFAGYNVEDS 89
              P  A        + ++G YAG    YN S  +++           G ++ GYN +  
Sbjct: 32  PQPPVAAPIAPSTPVYVWSGAYAGAFVGYNTSNFDQSTGASFDGDGFVGGVYTGYNWQAD 91

Query: 90  CIMYGVEGDVRYTVPVLADNI-------HSLHGIGGSLRIRGGYEVSDSLLLYATVGPDV 142
             ++G+E D+  +    +           +   I GS R R G  V D  L++AT G   
Sbjct: 92  QFVFGLEADLGGSDVDASGTNAATGAQLDADSNIFGSFRARVGVAV-DPFLVFATGGLAA 150

Query: 143 AQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYS-----------KVE 191
           A+   +      +  +IG T G GVE   +S+ +  RLEYR S +               
Sbjct: 151 ARNELSLNGFSDSQTSIGYTLGAGVE-ARVSDDVTTRLEYRYSDFGSETYDLGNTSVSSG 209

Query: 192 GFYNTISLGVGMKF 205
              ++I  G+ +KF
Sbjct: 210 FDEHSIRAGIALKF 223


>gi|85713978|ref|ZP_01044967.1| possible outer membrane protein [Nitrobacter sp. Nb-311A]
 gi|85699104|gb|EAQ36972.1| possible outer membrane protein [Nitrobacter sp. Nb-311A]
          Length = 453

 Score = 89.5 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 47/233 (20%), Positives = 70/233 (30%), Gaps = 35/233 (15%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGP---Y 57
           M+++ L V ++S A+    SAQAAD   R +     + P           +   G     
Sbjct: 1   MKRILLGVLLASTAM----SAQAADLAPRPYTKAPPMAPVYDWTGLYLGVNAGLGVGRNR 56

Query: 58  AGLSALYNGSFGEEAHHNAGGSIFAGYNVE----DSCIMYGVEGDVRYTVPVLADNIHSL 113
           A                 A G    GYN +       I++GVE D++             
Sbjct: 57  AVHDFGPLAISTHLQPLGAVGGGQIGYNWQTNSFFGPIVFGVEADLQGADMTDNRTNFIG 116

Query: 114 -------HGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYET----GKAGEITPIAIGGT 162
                      G+ R R G  V+  ++ Y T G        T    G          G T
Sbjct: 117 ALQYNQRLNWFGTARGRVG-LVNGPMMTYLTGGWAYGNVGTTVIQGGVPSAFGGGRSGWT 175

Query: 163 AGVGVEVGGLSESLVARLEYRASKYSKVEGFY-----------NTISLGVGMK 204
            G GVE   L  +   ++EY          F            N    G+  +
Sbjct: 176 WGSGVE-AALGGNWTGKIEYLYLDLGNRTDFIGGQALHSELRENIFRAGLNYR 227



 Score = 77.5 bits (189), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 29/174 (16%), Positives = 50/174 (28%), Gaps = 39/174 (22%)

Query: 70  EEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVL-----------ADNIHSLHGIGG 118
             A +   G    GYN +   I++G+E D + +               + + +S     G
Sbjct: 273 NLAPNGFVGGGQIGYNWQAGNIVFGLETDFQGSTLEDNKACFFCVPGASVDFNSKLQWFG 332

Query: 119 SLRIRGGYEVSDSLLLYATVGPDVAQKY----ETGKAGEITPIAIGGTAGVGVEV----- 169
           ++R R GY V +S + YAT G                   +    G   G G+E      
Sbjct: 333 TVRGRLGYAVGNS-MFYATGGFAYGNVQTALNTPLNNFSFSNTRTGYAVGGGIETPLPLV 391

Query: 170 -----GGLSESLVARLEYRASKYSKVEGFY-------------NTISLGVGMKF 205
                     +  +  EY      +                  +    G+   F
Sbjct: 392 NLFGGPLFGPNWTSTTEYLYVDLGRSSFNIGGGPNVLTTGAQEHIFRTGLNYHF 445


>gi|319408047|emb|CBI81701.1| Hemin binding protein C [Bartonella schoenbuchensis R1]
          Length = 289

 Score = 89.5 bits (220), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 48/291 (16%), Positives = 82/291 (28%), Gaps = 101/291 (34%)

Query: 8   VGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGS 67
           +  S  AL S  +AQAAD   +           +A          + G Y G       S
Sbjct: 7   ITASIFALVSASAAQAADMPVQERPTTVLPQVVVAPA------FSWTGFYLGGQIGGFSS 60

Query: 68  FGEEAH----------------------HNAGGSIFAGYNVEDSC-IMYGVEGDVRYTVP 104
                                           G ++AG NV+     + GV+ D+ ++  
Sbjct: 61  NSSSKRIYQGVSKGKEDILVDNKAFPKFSGFVGGLYAGSNVDFGNGFVLGVDTDIVWSGD 120

Query: 105 VL-----------------------------------------ADNIHSLHGIGGSLRIR 123
                                                        N+       G+ R+R
Sbjct: 121 KAKTSKSYDLPQTSDVQEVATRAEVSTGVPTLVEGADNNASRVTRNVTFSDKWSGATRVR 180

Query: 124 GGYEVSDSLLLYATVGPDVAQKYETGKAGE--------------------ITPIAIGGTA 163
            G    D ++ Y   G   +Q   + +  +                     +   +G T 
Sbjct: 181 LGAAF-DRIMPYVAGGVAYSQLKASVENAKASGAQKAEGTSVEKPLEGLSDSKTMVGYTL 239

Query: 164 GVGVEVGGLSESLVARLEYRASKYSK---------VEGFYNTISLGVGMKF 205
           G GV+   ++++++ R EYR S + K         V+   N   +GV  KF
Sbjct: 240 GAGVDF-AMTDTVMLRAEYRYSDFGKKTFVKDKVEVDLKTNDFRVGVAYKF 289


>gi|90419518|ref|ZP_01227428.1| possible outer membrane protein [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90336455|gb|EAS50196.1| possible outer membrane protein [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 273

 Score = 89.5 bits (220), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 40/236 (16%), Positives = 70/236 (29%), Gaps = 44/236 (18%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+   L++  +S AL     AQAAD +         +  +   + +  I     G  A  
Sbjct: 1   MRTYLLSILTASTALTFASYAQAADVIYEEPMAPAPMEISPVASGWTGIYLGVQGGGAFN 60

Query: 61  ---------------------SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDV 99
                                   +  +F      +  G    GY+ +   +++GV  D+
Sbjct: 61  PQDPDNVDLRTNGFAFGGSAVQTAFGSNFDSNVDSSFLGGAHIGYDYQMDSVVFGVLADI 120

Query: 100 RYTVPVLADNIHS----------LHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETG 149
                  + N  S               G++R R GY V+   L Y T G        + 
Sbjct: 121 NAIDLTRSSNADSNAPAYYRTDRELNYLGTVRARVGYLVTPDALAYVTGGLAYGDVDYSF 180

Query: 150 KAG------------EITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGF 193
                               + G T G G+EV   ++++    EY  +        
Sbjct: 181 STNSPAVTGATPAVVSEDEDSFGYTVGGGMEV-KFTDNMSFGAEYLYTNLGGSGYT 235


>gi|49475066|ref|YP_033107.1| hemin binding protein c [Bartonella henselae str. Houston-1]
 gi|49237871|emb|CAF27067.1| Hemin binding protein c [Bartonella henselae str. Houston-1]
          Length = 276

 Score = 89.5 bits (220), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 48/280 (17%), Positives = 82/280 (29%), Gaps = 92/280 (32%)

Query: 9   GVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSF 68
            +++ A      AQAAD V           PT      V     + G Y G       S 
Sbjct: 6   LITASAFTFVSVAQAADIVV-------PPSPTPVAPVIVAPTFSWTGFYIGGQIGGFSSK 58

Query: 69  GEEA-----------------HHNAGGSIFAGYNVEDSC-IMYGVEGDVRYTVPVLADNI 110
            +                        G ++AG NV+    ++ GV+ D+ +T       +
Sbjct: 59  TKMDILSKGKTIPVSDDFLPKLSGFMGGLYAGSNVDLGNGLILGVDTDIIWTDKDDTKTV 118

Query: 111 ----------------------------------------HSLHGIGGSLRIRGGYEVSD 130
                                                          G+ R+R G+  ++
Sbjct: 119 PPYEIAENHVNYVNKMLKDAGINIGDNKLEAGKYTRALGFTFKEKWAGATRVRIGFA-AE 177

Query: 131 SLLLYATVGPDVAQKYE----------------TGKAGEITPIAIGGTAGVGVEVGGLSE 174
            ++ Y   G    Q  +                +G   + T   +G T G GV+   ++ 
Sbjct: 178 RIMPYVAGGIAYTQLQDITSISITKKETGKVIASGNLSDETKTLVGYTLGAGVD-LAMTN 236

Query: 175 SLVARLEYRASKYSKVEGFY---------NTISLGVGMKF 205
           +++ R EYR S + K +            N   +GV  KF
Sbjct: 237 NVIVRAEYRYSDFGKKKFSNDKYETSYKTNDFRVGVAYKF 276


>gi|194450606|ref|YP_002045072.1| outer membrane protein A [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL476]
 gi|197265555|ref|ZP_03165629.1| outer membrane protein A [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA23]
 gi|194408910|gb|ACF69129.1| outer membrane protein A [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL476]
 gi|197243810|gb|EDY26430.1| outer membrane protein A [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA23]
 gi|321223685|gb|EFX48748.1| Outer membrane protein A precursor [Salmonella enterica subsp.
           enterica serovar Typhimurium str. TN061786]
 gi|326622756|gb|EGE29101.1| outer membrane protein A [Salmonella enterica subsp. enterica
           serovar Dublin str. 3246]
          Length = 358

 Score = 89.5 bits (220), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 36/219 (16%), Positives = 71/219 (32%), Gaps = 38/219 (17%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K  +A+ V+         AQAA                     Y   +  ++  +   
Sbjct: 9   MKKTAIAIAVALA--GFATVAQAA---------------PKDNTWYAGAKLGWSQYHDT- 50

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGG-- 118
              +  + G    +  G   F GY V       G E    +   +     +         
Sbjct: 51  --GFIHNDGPTHENQLGAGAFGGYQV---NPYVGFEMGYDWLGRMPYKGDNINGAYKAQG 105

Query: 119 -SLRIRGGYEVSDSLLLYATVGPDVAQKYET-----GKAGEITPIAIGGTAGVGVEVGGL 172
             L  + GY ++D L +Y  +G  V +         G + +     +      G+E   +
Sbjct: 106 VQLTAKLGYPITDDLDVYTRLGGMVWRADTKSNVPGGPSTKDHDTGVSPVFAGGIEY-AI 164

Query: 173 SESLVARLEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
           +  +  RLEY+ +      + +    +   +S+GV  +F
Sbjct: 165 TPEIATRLEYQWTNNIGDANTIGTRPDNGLLSVGVSYRF 203


>gi|161614736|ref|YP_001588701.1| outer membrane protein A [Salmonella enterica subsp. enterica
           serovar Paratyphi B str. SPB7]
 gi|168821824|ref|ZP_02833824.1| outer membrane protein A [Salmonella enterica subsp. enterica
           serovar Weltevreden str. HI_N05-537]
 gi|238911107|ref|ZP_04654944.1| outer membrane protein A [Salmonella enterica subsp. enterica
           serovar Tennessee str. CDC07-0191]
 gi|161364100|gb|ABX67868.1| hypothetical protein SPAB_02488 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|205341689|gb|EDZ28453.1| outer membrane protein A [Salmonella enterica subsp. enterica
           serovar Weltevreden str. HI_N05-537]
 gi|320085284|emb|CBY95068.1| Outer membrane protein A Flags: Precursor [Salmonella enterica
           subsp. enterica serovar Weltevreden str. 2007-60-3289-1]
          Length = 369

 Score = 89.1 bits (219), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 36/219 (16%), Positives = 71/219 (32%), Gaps = 38/219 (17%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K  +A+ V+         AQAA                     Y   +  ++  +   
Sbjct: 20  MKKTAIAIAVALA--GFATVAQAA---------------PKDNTWYAGAKLGWSQYHDT- 61

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGG-- 118
              +  + G    +  G   F GY V       G E    +   +     +         
Sbjct: 62  --GFINNDGPTHENQLGAGAFGGYQV---NPYVGFEMGYDWLGRMPYKGDNINGAYKAQG 116

Query: 119 -SLRIRGGYEVSDSLLLYATVGPDVAQKYET-----GKAGEITPIAIGGTAGVGVEVGGL 172
             L  + GY ++D L +Y  +G  V +         G + +     +      G+E   +
Sbjct: 117 VQLTAKLGYPITDDLDVYTRLGGMVWRADTKSNVPGGPSTKDHDTGVSPVFAGGIEY-AI 175

Query: 173 SESLVARLEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
           +  +  RLEY+ +      + +    +   +S+GV  +F
Sbjct: 176 TPEIATRLEYQWTNNIGDANTIGTRPDNGLLSVGVSYRF 214


>gi|195874240|ref|ZP_02701347.2| outer membrane protein A [Salmonella enterica subsp. enterica
           serovar Newport str. SL317]
 gi|195630051|gb|EDX48703.1| outer membrane protein A [Salmonella enterica subsp. enterica
           serovar Newport str. SL317]
          Length = 358

 Score = 89.1 bits (219), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 36/219 (16%), Positives = 71/219 (32%), Gaps = 38/219 (17%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K  +A+ V+         AQAA                     Y   +  ++  +   
Sbjct: 9   MKKTAIAIAVALA--GFATVAQAA---------------PKDNTWYAGAKLGWSQYHDT- 50

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGG-- 118
              +  + G    +  G   F GY V       G E    +   +     +         
Sbjct: 51  --GFINNDGPTDENQLGAGAFGGYQV---NPYVGFEMGYDWLGRMPYKGDNINGAYKAQG 105

Query: 119 -SLRIRGGYEVSDSLLLYATVGPDVAQKYET-----GKAGEITPIAIGGTAGVGVEVGGL 172
             L  + GY ++D L +Y  +G  V +         G + +     +      G+E   +
Sbjct: 106 VQLTAKLGYPITDDLDVYTRLGGMVWRADTKSNVPGGPSTKDHDTGVSPVFAGGIEY-AI 164

Query: 173 SESLVARLEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
           +  +  RLEY+ +      + +    +   +S+GV  +F
Sbjct: 165 TPEIATRLEYQWTNNIGDANTIGTRPDNGLLSVGVSYRF 203


>gi|16759951|ref|NP_455568.1| outer membrane protein A [Salmonella enterica subsp. enterica
           serovar Typhi str. CT18]
 gi|29142277|ref|NP_805619.1| outer membrane protein A [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
 gi|68052784|sp|Q8Z7S0|OMPA_SALTI RecName: Full=Outer membrane protein A; Flags: Precursor
 gi|25298549|pir||AI0626 outer membrane protein A STY1091 [imported] - Salmonella enterica
           subsp. enterica serovar Typhi (strain CT18)
 gi|16502245|emb|CAD08196.1| outer membrane protein A [Salmonella enterica subsp. enterica
           serovar Typhi]
 gi|29137907|gb|AAO69468.1| outer membrane protein A [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
          Length = 350

 Score = 88.7 bits (218), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 35/216 (16%), Positives = 70/216 (32%), Gaps = 32/216 (14%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K  +A+ V+         AQAA                     Y   +  ++  +   
Sbjct: 1   MKKTAIAIAVALA--GFATVAQAA---------------PKDNTWYAGAKLGWSQYHDT- 42

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGSL 120
              +  + G    +  G   F GY V            +        +   +    G  L
Sbjct: 43  --GFIHNDGPTHENQLGAGAFGGYQVNPYVGFEMGYDWLGRMPYKGDNTNGAYKAQGVQL 100

Query: 121 RIRGGYEVSDSLLLYATVGPDVAQKYET-----GKAGEITPIAIGGTAGVGVEVGGLSES 175
             + GY ++D L +Y  +G  V +         G + +     +      G+E   ++  
Sbjct: 101 TAKLGYPITDDLDVYTRLGGMVWRADTKSNVPGGASTKDHDTGVSPVFAGGIEY-AITPE 159

Query: 176 LVARLEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
           +  RLEY+ +      + +    +   +S+GV  +F
Sbjct: 160 IATRLEYQWTNNIGDANTIGTRPDNGLLSVGVSYRF 195


>gi|224584423|ref|YP_002638221.1| outer membrane protein A [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
 gi|224468950|gb|ACN46780.1| outer membrane protein A [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
          Length = 358

 Score = 88.7 bits (218), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 36/219 (16%), Positives = 71/219 (32%), Gaps = 38/219 (17%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K  +A+ V+         AQAA                     Y   +  ++  +   
Sbjct: 9   MKKTAIAIAVALA--GFATVAQAA---------------PKDNTWYAGAKLGWSQYHDT- 50

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGG-- 118
              +  + G    +  G   F GY V       G E    +   +     +         
Sbjct: 51  --GFINNDGPTHENQLGAGAFGGYQV---NPYVGFEMGYDWLGRMPYKGDNINGAYKAQG 105

Query: 119 -SLRIRGGYEVSDSLLLYATVGPDVAQKYET-----GKAGEITPIAIGGTAGVGVEVGGL 172
             L  + GY ++D L +Y  +G  V +         G + +     +      G+E   +
Sbjct: 106 VQLTAKLGYPITDDLDVYTRLGGMVWRADTKSNVPGGPSTKDHDTGVSPVFAGGIEY-AI 164

Query: 173 SESLVARLEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
           +  +  RLEY+ +      + +    +   +S+GV  +F
Sbjct: 165 TPEIATRLEYQWTNNIGDANTIGTRPDNGLLSVGVSYRF 203


>gi|194443312|ref|YP_002040273.1| outer membrane protein A [Salmonella enterica subsp. enterica
           serovar Newport str. SL254]
 gi|200390100|ref|ZP_03216711.1| outer membrane protein A [Salmonella enterica subsp. enterica
           serovar Virchow str. SL491]
 gi|205357270|ref|ZP_02346426.2| outer membrane protein A [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA29]
 gi|194401975|gb|ACF62197.1| outer membrane protein A [Salmonella enterica subsp. enterica
           serovar Newport str. SL254]
 gi|199602545|gb|EDZ01091.1| outer membrane protein A [Salmonella enterica subsp. enterica
           serovar Virchow str. SL491]
 gi|205322778|gb|EDZ10617.1| outer membrane protein A [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA29]
          Length = 358

 Score = 88.7 bits (218), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 36/219 (16%), Positives = 71/219 (32%), Gaps = 38/219 (17%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K  +A+ V+         AQAA                     Y   +  ++  +   
Sbjct: 9   MKKTAIAIAVALA--GFATVAQAA---------------PKDNTWYAGAKLGWSQYHDT- 50

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGG-- 118
              +  + G    +  G   F GY V       G E    +   +     +         
Sbjct: 51  --GFINNDGPTHENQLGAGAFGGYQV---NPYVGFEMGYDWLGRMPYKGDNINGAYKAQG 105

Query: 119 -SLRIRGGYEVSDSLLLYATVGPDVAQKYET-----GKAGEITPIAIGGTAGVGVEVGGL 172
             L  + GY ++D L +Y  +G  V +         G + +     +      G+E   +
Sbjct: 106 VQLTAKLGYPITDDLDVYTRLGGMVWRADTKSNVPGGPSTKDHDTGVSPVFAGGIEY-AI 164

Query: 173 SESLVARLEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
           +  +  RLEY+ +      + +    +   +S+GV  +F
Sbjct: 165 TPEIATRLEYQWTNNIGDANTIGTRPDNGLLSVGVSYRF 203


>gi|758341|emb|CAA26037.1| outer membrane protein (ompA) [Salmonella enterica subsp. enterica
           serovar Typhimurium]
          Length = 350

 Score = 88.7 bits (218), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 36/219 (16%), Positives = 70/219 (31%), Gaps = 38/219 (17%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K  +A+ V+         AQAA                     Y   +  ++  +   
Sbjct: 1   MKKTAIAIAVALA--GFATVAQAA---------------PKDNTWYAGAKLGWSQYHDT- 42

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGG-- 118
              +  + G    +  G   F GY V       G E    +   +     +         
Sbjct: 43  --GFIHNDGPTHENQLGAGAFGGYQV---NPYVGFEMGYDWLGRMPYKGDNINGAYKAQG 97

Query: 119 -SLRIRGGYEVSDSLLLYATVGPDVAQKYET-----GKAGEITPIAIGGTAGVGVEVGGL 172
             L  + GY ++D L  Y  +G  V +         G + +     +      G+E   +
Sbjct: 98  VQLTAKLGYPITDDLDFYTRLGGMVWRADTKSNVPGGPSTKDHDTGVSPVFAGGIEY-AI 156

Query: 173 SESLVARLEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
           +  +  RLEY+ +      + +    +   +S+GV  +F
Sbjct: 157 TPEIATRLEYQWTNNIGDANTIGTRPDNGLLSVGVSYRF 195


>gi|15888468|ref|NP_354149.1| outer membrane protein [Agrobacterium tumefaciens str. C58]
 gi|18139945|gb|AAL60203.1|AF445083_1 outer membrane protein [Agrobacterium tumefaciens str. C58]
 gi|15156164|gb|AAK86934.1| outer membrane protein [Agrobacterium tumefaciens str. C58]
          Length = 218

 Score = 88.7 bits (218), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 58/222 (26%), Positives = 92/222 (41%), Gaps = 21/222 (9%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+     +  S++A A F +A AAD V              A   +          Y   
Sbjct: 1   MRIFVATLMASTMAAAGFSAAYAADAVNEVPQAPVAYDQPAAVKDWSGAYLGGTVNYDWG 60

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADN------IHSLH 114
              ++ S         GG ++ GYN++   I+YG E DV       +        +    
Sbjct: 61  R--FSSSNDGRDAKGFGGGVYGGYNMQSGQIVYGAEADVNMGDEKGSAGTVAGRAVEGKQ 118

Query: 115 GIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSE 174
           G+ GSLR R GY+++   LLY T G  V+         + +  A+G T G GVE   +++
Sbjct: 119 GVNGSLRGRVGYDMNP-FLLYGTAGLAVSDNKVRDGVNKDSATALGYTVGAGVE-AMVTD 176

Query: 175 SLVARLEYRASKYSKVE-----------GFYNTISLGVGMKF 205
           ++ ARLEYR S Y K +              +++  G+G+KF
Sbjct: 177 NITARLEYRYSDYQKKDYTLGNDAFSRGFDDHSVKAGIGVKF 218


>gi|148255739|ref|YP_001240324.1| putative outer-membrane protein [Bradyrhizobium sp. BTAi1]
 gi|146407912|gb|ABQ36418.1| putative outer-membrane protein [Bradyrhizobium sp. BTAi1]
          Length = 245

 Score = 88.7 bits (218), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 44/241 (18%), Positives = 79/241 (32%), Gaps = 40/241 (16%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDF------- 53
           M+KL + +  + + +A+   A AAD   R +     VV  I +   +             
Sbjct: 1   MKKLLV-ITTALVGIAAAMPASAADLAARPYTKAPPVVVPILSWSGIYAGIQGGGGWGTS 59

Query: 54  --NGPYAGLSALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVL----- 106
                    +  + G+     +    G +  GYN +   ++ G+EGD  ++         
Sbjct: 60  KETFIGRFNAPGFLGTQNYNTNGGFVGGV-IGYNWQFDNLVVGLEGDYHWSDINGRSAVI 118

Query: 107 ----ADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQK-----YETGKAGEITPI 157
                D   +     G ++ R GY V    L + + G  V +         G        
Sbjct: 119 NAGVGDTYFTKLTSFGDIKGRLGYAVGP-ALFFVSGGAAVGELQHRYDRAAGVFFGQNTT 177

Query: 158 AIGGTAGVGVEVGGLSESLVARLEYRASKYSKV-------------EGFYNTISLGVGMK 204
             G T G G E    + +  A+LEY    + K              +   +T+  G+   
Sbjct: 178 RWGYTVGAGAEY-MFAPNWSAKLEYNYLDFGKSTLQYVGVPGRSEWKDSVHTVKAGLNYH 236

Query: 205 F 205
           F
Sbjct: 237 F 237


>gi|222087507|ref|YP_002546044.1| outer membrane protein [Agrobacterium radiobacter K84]
 gi|221724955|gb|ACM28111.1| outer membrane protein [Agrobacterium radiobacter K84]
          Length = 204

 Score = 88.3 bits (217), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 46/207 (22%), Positives = 79/207 (38%), Gaps = 12/207 (5%)

Query: 8   VGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGS 67
           + + +L   +  SA AAD                 +  Y+ +     G     +  +   
Sbjct: 1   MLIPALLALASTSAVAADLTEEPVAAAAPASVFTWSGPYLGVHGG--GAITKGNFKFGSG 58

Query: 68  FGEEAHHNAGGSIFAGYNVEDSCIMYGVEG--DVRYTVPVLADNIHSLHGIGGSLRIRGG 125
              E         F GYN +   ++ GV+G  D  +    +A+         G++R R G
Sbjct: 59  DQSEDFKGGFLGNFFGYNYQFDKVVVGVDGNIDYNWNNKAVANASSVGTDWSGAVRGRVG 118

Query: 126 YEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRAS 185
           Y   + L+  A          +   +G+   +  G TAG GV+    + ++ AR EYR S
Sbjct: 119 YAFDNLLIYGAAGWTAARGFADVSGSGDGKVVFSGWTAGTGVDY-AFTNNIFARAEYRYS 177

Query: 186 KYS-------KVEGFYNTISLGVGMKF 205
            +        K +    +I+LGVG+KF
Sbjct: 178 DFGSKELQGVKSDLTEQSINLGVGLKF 204


>gi|16764429|ref|NP_460044.1| outer membrane protein A [Salmonella enterica subsp. enterica
           serovar Typhimurium str. LT2]
 gi|205352225|ref|YP_002226026.1| outer membrane protein A [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|207856415|ref|YP_002243066.1| outer membrane protein A [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|20141670|sp|P02936|OMPA_SALTY RecName: Full=Outer membrane protein A; AltName: Full=Outer
           membrane major heat-modifiable protein; AltName:
           Full=Outer membrane protein 33K; Flags: Precursor
 gi|16419585|gb|AAL20003.1| putative membrane component hydrogenase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. LT2]
 gi|146760785|gb|ABQ44512.1| outer membrane protein A [Salmonella enterica subsp. enterica
           serovar Typhimurium]
 gi|205272006|emb|CAR36850.1| outer membrane protein A [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|206708218|emb|CAR32518.1| outer membrane protein A [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|261246287|emb|CBG24095.1| outer membrane protein A [Salmonella enterica subsp. enterica
           serovar Typhimurium str. D23580]
 gi|267992822|gb|ACY87707.1| outer membrane protein A [Salmonella enterica subsp. enterica
           serovar Typhimurium str. 14028S]
 gi|301157614|emb|CBW17106.1| outer membrane protein A [Salmonella enterica subsp. enterica
           serovar Typhimurium str. SL1344]
 gi|332987964|gb|AEF06947.1| outer membrane protein A [Salmonella enterica subsp. enterica
           serovar Typhimurium str. UK-1]
          Length = 350

 Score = 88.3 bits (217), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 36/219 (16%), Positives = 71/219 (32%), Gaps = 38/219 (17%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K  +A+ V+         AQAA                     Y   +  ++  +   
Sbjct: 1   MKKTAIAIAVALA--GFATVAQAA---------------PKDNTWYAGAKLGWSQYHDT- 42

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGG-- 118
              +  + G    +  G   F GY V       G E    +   +     +         
Sbjct: 43  --GFIHNDGPTHENQLGAGAFGGYQV---NPYVGFEMGYDWLGRMPYKGDNINGAYKAQG 97

Query: 119 -SLRIRGGYEVSDSLLLYATVGPDVAQKYET-----GKAGEITPIAIGGTAGVGVEVGGL 172
             L  + GY ++D L +Y  +G  V +         G + +     +      G+E   +
Sbjct: 98  VQLTAKLGYPITDDLDVYTRLGGMVWRADTKSNVPGGPSTKDHDTGVSPVFAGGIEY-AI 156

Query: 173 SESLVARLEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
           +  +  RLEY+ +      + +    +   +S+GV  +F
Sbjct: 157 TPEIATRLEYQWTNNIGDANTIGTRPDNGLLSVGVSYRF 195


>gi|27378846|ref|NP_770375.1| outer-membrane immunogenic protein [Bradyrhizobium japonicum USDA
           110]
 gi|27351995|dbj|BAC49000.1| bll3735 [Bradyrhizobium japonicum USDA 110]
          Length = 223

 Score = 88.3 bits (217), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 49/218 (22%), Positives = 79/218 (36%), Gaps = 33/218 (15%)

Query: 9   GVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSF 68
            +   A+ +  SA AAD   R                     + + G YAG +A Y  S 
Sbjct: 14  ALPFAAVFAAGSACAADLSPRYAAPASAYTAPQP-------VYSWTGLYAGFNAGYAESG 66

Query: 69  GEEAHHNAGGS----------IFAGYNVEDSC-IMYGVEGDVRYTVPVLADNIHS---LH 114
            +  ++ AG +          +  GYN + S   + G+E D         D ++S     
Sbjct: 67  DDAFNNLAGATGGKVKGAVGGVQIGYNYQLSPMFVVGIENDFEGGDIKNHDALNSAAVSL 126

Query: 115 GIGGSLRIRGGYEVSD-SLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLS 173
               + R R G    D  LL + T G    +  +    G I  + +G TAG GVE     
Sbjct: 127 PWYMTGRARAGIATMDSRLLFFGTAGLAAGEFKD----GPINKMKMGWTAGGGVE-WAFL 181

Query: 174 ESLVARLEYRASKYSKVE------GFYNTISLGVGMKF 205
               A+ EY  +++   +        ++T  +GV   F
Sbjct: 182 PKWSAKAEYLYTEFKHDDLPDWNAAKFHTFRVGVNYHF 219


>gi|254510731|ref|ZP_05122798.1| conserved hypothetical protein [Rhodobacteraceae bacterium KLH11]
 gi|221534442|gb|EEE37430.1| conserved hypothetical protein [Rhodobacteraceae bacterium KLH11]
          Length = 228

 Score = 88.3 bits (217), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 31/173 (17%), Positives = 54/173 (31%), Gaps = 18/173 (10%)

Query: 41  IATNRYVPIRHDFNGPYAGLSALYNGSFGEEAH---HNAGGSIFAGYNVEDSCIMYGVEG 97
            A         ++ G Y G    Y       +        G I  GY+ +    + G   
Sbjct: 66  AAGPALAQSSGNWTGFYGGAQIGYADIDTNVSGVDGDGLIGGIILGYDYDLGDWVVGGGF 125

Query: 98  DVRYTVPVLADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPI 157
           D  ++   L+            ++ R GY+V+   LLY T G   A              
Sbjct: 126 DYDWSDVDLSSAATVESVW--RIKARAGYKVNPQGLLYGTAGYADADTD-------NLGS 176

Query: 158 AIGGTAGVGVEVGGLSESLVARLEYRASKYSK-----VEGFYNTISLGVGMKF 205
             G   G G E   ++ ++    E    ++       V+    T+ + V  +F
Sbjct: 177 DNGWFIGAGYEQ-IVAPNISVGGELLYHEFDDFNSTGVDVDATTLQVRVAYRF 228


>gi|312115998|ref|YP_004013594.1| porin [Rhodomicrobium vannielii ATCC 17100]
 gi|311221127|gb|ADP72495.1| porin [Rhodomicrobium vannielii ATCC 17100]
          Length = 203

 Score = 88.3 bits (217), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 49/212 (23%), Positives = 84/212 (39%), Gaps = 25/212 (11%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+ L    G++  ++ +  SA +AD         RG          V     + G YAGL
Sbjct: 1   MKLLSGIAGLTLASVVAIASANSADL-------YRGQAGGYKDGPIVAPVATWTGFYAGL 53

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVE----DSCIMYGVEGDVRYTVPVLADNIHSLHGI 116
           +  Y  +  +       G    GYN +     S ++ GVE D++ +     ++       
Sbjct: 54  NVGYGWND-DADADGIIGGGQIGYNWQGAFGTSPLVLGVETDIQGSDIKNDNDD--KLNY 110

Query: 117 GGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESL 176
            G++R R GY + +S L+YAT G    +             + G T G GVE    + +L
Sbjct: 111 FGTVRGRLGYALGNS-LVYATGGFAYGEFD------GADKTSTGYTVGGGVE-HKFTPNL 162

Query: 177 VARLEYRASKYSKVEG---FYNTISLGVGMKF 205
             + EY  +     +     +NT+ +G+   F
Sbjct: 163 SVKAEYLYTDLGDNDSDNADFNTVRVGLNYHF 194


>gi|325292505|ref|YP_004278369.1| outer membrane protein [Agrobacterium sp. H13-3]
 gi|325060358|gb|ADY64049.1| outer membrane protein [Agrobacterium sp. H13-3]
          Length = 218

 Score = 88.3 bits (217), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 59/222 (26%), Positives = 93/222 (41%), Gaps = 21/222 (9%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+     +  S++A A F +A AAD V                  +          Y   
Sbjct: 1   MRIFVATIMASTIAAAGFSAAHAADAVNDVPQAPVAYDQPAPVKNWTGAYLGGTANYDWG 60

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDV------RYTVPVLADNIHSLH 114
              ++ S        AGG I+ GYN+++  I+YG E DV           V  + +    
Sbjct: 61  R--FSSSNDGRDAKGAGGGIYGGYNMQNGQIVYGAEADVNLGRERGSAGTVGGNAVEGKQ 118

Query: 115 GIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSE 174
           G+ GSLR R GY+++   LLY T G   +         + +  A+G T G GVE   +++
Sbjct: 119 GVNGSLRARVGYDMNP-FLLYGTAGLAASDNKVRDATSKDSATALGYTVGAGVE-AMVTD 176

Query: 175 SLVARLEYRASKYSKVE-----------GFYNTISLGVGMKF 205
           ++ ARLEYR S Y K +              +++  G+G+KF
Sbjct: 177 NITARLEYRYSDYQKKDYSLDSGAFSRGFDDHSVKAGIGVKF 218


>gi|158425586|ref|YP_001526878.1| outer membrane protein, 31 kDa precursor [Azorhizobium caulinodans
           ORS 571]
 gi|158332475|dbj|BAF89960.1| outer membrane protein, 31 kDa precursor [Azorhizobium caulinodans
           ORS 571]
          Length = 232

 Score = 88.3 bits (217), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 45/229 (19%), Positives = 69/229 (30%), Gaps = 32/229 (13%)

Query: 7   AVGVSSLALASFCSAQAADPVRRAHHGGRGVVPT------IATNRYVPIRHDFNGPYAGL 60
             GVS+LAL    +A AAD   +        V              V         +   
Sbjct: 6   LAGVSALALLGCGAASAADLATKYPVKAIAPVVPVFSWTGFYIGANVGYAWGSTDFHGNT 65

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVED-SCIMYGVEGDVRYTVPVLAD----------N 109
                 S+      +  G    GYN +  + ++ G+E D+ +T    +            
Sbjct: 66  RTGLPYSYSVGGQDDWLGGGQIGYNYQFANNVVVGIEADIDWTGIGSSGVAVNGPLAGQT 125

Query: 110 IHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAG-EITPIAIGGTAGVGVE 168
           I+      G++R R GY   D  L Y T G            G   +    G T G G E
Sbjct: 126 INGSLDYFGTVRARLGYAF-DKFLPYITGGAAWGHVDYGNIYGVGTSSTNWGWTIGAGFE 184

Query: 169 VGGLSESLVARLEYRASKYS------------KVEGFYNTISLGVGMKF 205
              ++ ++ A LEY                        + +   V  KF
Sbjct: 185 Y-AVTNNITAGLEYLYVDLGGNNYLFPNLTSLDTSFNMSVLRARVNYKF 232


>gi|291085616|ref|ZP_06353500.2| outer membrane protein A [Citrobacter youngae ATCC 29220]
 gi|291070418|gb|EFE08527.1| outer membrane protein A [Citrobacter youngae ATCC 29220]
          Length = 360

 Score = 88.3 bits (217), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 41/218 (18%), Positives = 70/218 (32%), Gaps = 34/218 (15%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K   A+ ++         AQAA                     Y   +  ++  +   
Sbjct: 9   MKKT--AIAIAVALAGFATVAQAA---------------PKDNTWYAGAKLGWSQYHDIG 51

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYN------VEDSCIMYGVEGDVRYTVPVLADNIHSLH 114
           +   N + G       G   F GY        E      G      YT     +      
Sbjct: 52  NNQIN-NAGPTHESQLGAGAFGGYQVNPYVGFEMGYDWLGRMPYKGYTDETHNNGAFKAQ 110

Query: 115 GIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGE-ITPIAIGGTAGVGVEVGGLS 173
           G+   L  + GY ++D L +Y  +G  V +       G       +      GVE   ++
Sbjct: 111 GVQ--LTAKLGYPITDDLDVYTRLGGMVWRADAKNNTGFKDHDTGVSPVFAGGVEY-AIT 167

Query: 174 ESLVARLEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
             +  RLEY+ +      + V G  +   +S+GV  +F
Sbjct: 168 PEIATRLEYQWTNNIGDANTVGGRPDNGLLSVGVSYRF 205


>gi|121602149|ref|YP_989467.1| omp25/ropB family outer membrane protein [Bartonella bacilliformis
           KC583]
 gi|120614326|gb|ABM44927.1| outer membrane protein, omp25/ropB family [Bartonella bacilliformis
           KC583]
          Length = 281

 Score = 87.9 bits (216), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 50/283 (17%), Positives = 81/283 (28%), Gaps = 80/283 (28%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M K  + + +  +A++S    QAAD V  +    +      A +        + G Y G+
Sbjct: 1   MNKKNVLLSLCVVAVSSPSLVQAADTVVVSRAVSKTQTAQNAMSVVDHSDLSWGGLYFGV 60

Query: 61  SALYNGSFGEEAH-----------------HNAGGSIFAGYNVEDSC-IMYGVEGDVRYT 102
                                             G  + G NVE    ++ GV+ DV ++
Sbjct: 61  QVGGISGNLSLNRKAVSGEDKSSSETLPKLSGFIGGFYLGSNVEFGGGLVVGVDTDVVWS 120

Query: 103 -------------------------------------VPVLADNIHSLHGIGGSLRIRGG 125
                                                   +A N+       G+ RIR G
Sbjct: 121 NQKYKQLSDPIHVDEEVLKLHQALMSDYGHNSNSLKIGDKIAYNVTRKTNWIGATRIRFG 180

Query: 126 YEVSDSLLLYATVGPDVAQKYETGKAG--------------EITPIAIGGTAGVGVEVGG 171
               + ++ Y   G    Q   T                        +G T G G E   
Sbjct: 181 LA-GERMMPYVAGGIAYTQLQVTPWFEVTPTKGEVSSIDFMNDKKTMVGYTLGAGFEFLM 239

Query: 172 LSESLVARLEYRASKYS---------KVEGFYNTISLGVGMKF 205
            ++ ++ R EYR S +          KV    N + +GV  KF
Sbjct: 240 -TDDVILRTEYRHSDFGKKNFLKDTSKVSYKTNDVRIGVAYKF 281


>gi|168237123|ref|ZP_02662181.1| outer membrane protein A [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. SL480]
 gi|194734413|ref|YP_002114070.1| outer membrane protein A [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. CVM19633]
 gi|194709915|gb|ACF89136.1| outer membrane protein A [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. CVM19633]
 gi|197289811|gb|EDY29172.1| outer membrane protein A [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. SL480]
 gi|322616444|gb|EFY13353.1| outer membrane protein A [Salmonella enterica subsp. enterica
           serovar Montevideo str. 315996572]
 gi|322619695|gb|EFY16570.1| outer membrane protein A [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-1]
 gi|322622609|gb|EFY19454.1| outer membrane protein A [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-3]
 gi|322629758|gb|EFY26533.1| outer membrane protein A [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-4]
 gi|322632520|gb|EFY29266.1| outer membrane protein A [Salmonella enterica subsp. enterica
           serovar Montevideo str. 515920-1]
 gi|322636985|gb|EFY33688.1| outer membrane protein A [Salmonella enterica subsp. enterica
           serovar Montevideo str. 515920-2]
 gi|322641475|gb|EFY38113.1| outer membrane protein A [Salmonella enterica subsp. enterica
           serovar Montevideo str. 531954]
 gi|322646058|gb|EFY42574.1| outer membrane protein A [Salmonella enterica subsp. enterica
           serovar Montevideo str. NC_MB110209-0054]
 gi|322649640|gb|EFY46071.1| outer membrane protein A [Salmonella enterica subsp. enterica
           serovar Montevideo str. OH_2009072675]
 gi|322654059|gb|EFY50382.1| outer membrane protein A [Salmonella enterica subsp. enterica
           serovar Montevideo str. CASC_09SCPH15965]
 gi|322658591|gb|EFY54853.1| outer membrane protein A [Salmonella enterica subsp. enterica
           serovar Montevideo str. 19N]
 gi|322663448|gb|EFY59650.1| outer membrane protein A [Salmonella enterica subsp. enterica
           serovar Montevideo str. 81038-01]
 gi|322670184|gb|EFY66324.1| outer membrane protein A [Salmonella enterica subsp. enterica
           serovar Montevideo str. MD_MDA09249507]
 gi|322671420|gb|EFY67542.1| outer membrane protein A [Salmonella enterica subsp. enterica
           serovar Montevideo str. 414877]
 gi|322676776|gb|EFY72843.1| outer membrane protein A [Salmonella enterica subsp. enterica
           serovar Montevideo str. 366867]
 gi|322682700|gb|EFY78719.1| outer membrane protein A [Salmonella enterica subsp. enterica
           serovar Montevideo str. 413180]
 gi|322686380|gb|EFY82362.1| outer membrane protein A [Salmonella enterica subsp. enterica
           serovar Montevideo str. 446600]
 gi|323195127|gb|EFZ80309.1| outer membrane protein A [Salmonella enterica subsp. enterica
           serovar Montevideo str. 609458-1]
 gi|323199809|gb|EFZ84898.1| outer membrane protein A [Salmonella enterica subsp. enterica
           serovar Montevideo str. 556150-1]
 gi|323202802|gb|EFZ87838.1| outer membrane protein A [Salmonella enterica subsp. enterica
           serovar Montevideo str. 609460]
 gi|323209073|gb|EFZ94010.1| outer membrane protein A [Salmonella enterica subsp. enterica
           serovar Montevideo str. 507440-20]
 gi|323213664|gb|EFZ98452.1| outer membrane protein A [Salmonella enterica subsp. enterica
           serovar Montevideo str. 556152]
 gi|323217967|gb|EGA02682.1| outer membrane protein A [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB101509-0077]
 gi|323221999|gb|EGA06386.1| outer membrane protein A [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB102109-0047]
 gi|323226572|gb|EGA10777.1| outer membrane protein A [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB110209-0055]
 gi|323229768|gb|EGA13891.1| outer membrane protein A [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB111609-0052]
 gi|323232993|gb|EGA17089.1| outer membrane protein A [Salmonella enterica subsp. enterica
           serovar Montevideo str. 2009083312]
 gi|323240728|gb|EGA24770.1| outer membrane protein A [Salmonella enterica subsp. enterica
           serovar Montevideo str. 2009085258]
 gi|323243044|gb|EGA27065.1| outer membrane protein A [Salmonella enterica subsp. enterica
           serovar Montevideo str. 315731156]
 gi|323249793|gb|EGA33695.1| outer membrane protein A [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2009159199]
 gi|323252735|gb|EGA36573.1| outer membrane protein A [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008282]
 gi|323259149|gb|EGA42793.1| outer membrane protein A [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008283]
 gi|323259972|gb|EGA43600.1| outer membrane protein A [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008284]
 gi|323268028|gb|EGA51507.1| outer membrane protein A [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008285]
 gi|323269876|gb|EGA53325.1| outer membrane protein A [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008287]
          Length = 369

 Score = 87.9 bits (216), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 36/219 (16%), Positives = 71/219 (32%), Gaps = 38/219 (17%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K  +A+ V+         AQAA                     Y   +  ++  +   
Sbjct: 20  MKKTAIAIAVALA--GFATVAQAA---------------PKDNTWYAGAKLGWSQYHDT- 61

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGG-- 118
              +  + G    +  G   F GY V       G E    +   +     +         
Sbjct: 62  --GFINNDGPTHENQLGAGAFGGYQV---NPYVGFEMGYDWLGRMPYKGDNINGAYKAQG 116

Query: 119 -SLRIRGGYEVSDSLLLYATVGPDVAQKYET-----GKAGEITPIAIGGTAGVGVEVGGL 172
             L  + GY ++D L +Y  +G  V +         G + +     +      G+E   +
Sbjct: 117 VQLTAKLGYPITDDLDVYTRLGGMVWRADTKSNVPGGASTKDHDTGVSPVFAGGIEY-AI 175

Query: 173 SESLVARLEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
           +  +  RLEY+ +      + +    +   +S+GV  +F
Sbjct: 176 TPEIATRLEYQWTNNIGDANTIGTRPDNGLLSVGVSYRF 214


>gi|27383307|ref|NP_774836.1| outer-membrane immunogenic protein [Bradyrhizobium japonicum USDA
           110]
 gi|27356481|dbj|BAC53461.1| bll8196 [Bradyrhizobium japonicum USDA 110]
          Length = 278

 Score = 87.9 bits (216), Expect = 8e-16,   Method: Composition-based stats.
 Identities = 42/252 (16%), Positives = 67/252 (26%), Gaps = 69/252 (27%)

Query: 2   QKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLS 61
           ++L LA  ++   +A    + AAD            V  +           + G Y G S
Sbjct: 5   KQLSLASIIAFGTIAFGSGSLAADLPAAPVVKAPAPVYPL---------FSWTGGYIGGS 55

Query: 62  ALYNGSFGEEAH----------------------------------HNAGGSIFAGYNVE 87
                   +                                     +   G + AGYN +
Sbjct: 56  VGSGWGTSQTDLAVGNTFIGAPVNQTVNQLIGGTADLNVPLPQVQLNGFLGGVQAGYNFQ 115

Query: 88  DSCIMYGVEGDVRYTVPVLAD------NIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPD 141
              ++YGVE D  ++            N  +       +  R G  V D  L+Y   G  
Sbjct: 116 SGVMVYGVESDFLWSGIKGRTGCFVVLNCTNDTKWIADITGRVGVTVGDRGLVYIKGGAA 175

Query: 142 VAQKYETGKAGE-------------------ITPIAIGGTAGVGVEVGGLSESLVARLEY 182
            A                              T    GGT G G+E   L     A++EY
Sbjct: 176 WADSSIGINQSFAVTSNLGAGFAANGAADGRATKNIFGGTLGAGIEYAFL-PGWSAKVEY 234

Query: 183 RASKYSKVEGFY 194
               + + +   
Sbjct: 235 DYFDFGRQDVKL 246


>gi|92115870|ref|YP_575599.1| putative outer membrane protein [Nitrobacter hamburgensis X14]
 gi|91798764|gb|ABE61139.1| putative outer membrane protein [Nitrobacter hamburgensis X14]
          Length = 452

 Score = 87.9 bits (216), Expect = 8e-16,   Method: Composition-based stats.
 Identities = 37/208 (17%), Positives = 56/208 (26%), Gaps = 35/208 (16%)

Query: 32  HGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSFGEEAHHNAGGSIFAGYNVEDSCI 91
                          V      +       A    +    A     G + AGYN +   I
Sbjct: 238 PVATANWNGFYLGGNVGSGTGRDRTTVTNLATGESAAFNLAPDGFIGGVQAGYNWQAGNI 297

Query: 92  MYGVEGDVRYTVPVLAD-----------NIHSLHGIGGSLRIRGGYEVSDSLLLYATVGP 140
           +YG+E D + +                 N ++     G++R R GY V  S L YAT G 
Sbjct: 298 VYGLETDFQGSTMEDNKTCIGCEPGASLNFNAKLQWLGTVRGRLGYAVGPS-LFYATGGF 356

Query: 141 DVAQKYETGKAGEITPIAIGGTAGVGVE-----VGGLSESLVARLEYRASKYSKVEGFY- 194
                         +    G T G G+E      G    +  +  EY      K    + 
Sbjct: 357 AYGNVKTAINEVNFSDTRTGWTVGGGIETPFTLFGLFGPNWTSTTEYLYVDLGKSTNGFT 416

Query: 195 -----------------NTISLGVGMKF 205
                            +    G+   F
Sbjct: 417 LANTTGEPGALQTGVQEHIFRTGLNYHF 444



 Score = 87.5 bits (215), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 45/235 (19%), Positives = 70/235 (29%), Gaps = 37/235 (15%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPY--- 57
           M+++ L V ++  A+    SAQAAD   R +     + P      +    +   G     
Sbjct: 1   MKRILLGVLLAGTAM----SAQAADLAPRPYTKAPVMAPVYDWTGFYLGVNAGLGLGRDR 56

Query: 58  -AGLSALYNGSFGEEAHHNAGGSIFAGYNVEDSCI----MYGVEGDVRYTVPVLADN--- 109
                    G+        A G    GYN + +      + GVE D++            
Sbjct: 57  TVNDFGDGTGNSTYLQPLGAIGGGQIGYNWQTNSFLGPLVLGVEADIQGADMTDNRTNIN 116

Query: 110 ---IHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYE----TGKAGEITPIAIGGT 162
               +      G+ R R G  V+   L Y T G             G     +    G T
Sbjct: 117 GVQYNQKLDWFGTARGRIG-LVNGPTLTYLTGGYAYGNVSTRGVADGVPFAFSGNRSGWT 175

Query: 163 AGVGVEVGGLSESLVARLEYRASKYSK-------------VEGFYNTISLGVGMK 204
            G GVE   L  +   ++EY                     E   N    G+  +
Sbjct: 176 WGSGVE-AALGGNWTGKIEYLYVDLGNRTDVFDGGAQALHSELRENIFRAGLNYR 229


>gi|154246285|ref|YP_001417243.1| porin [Xanthobacter autotrophicus Py2]
 gi|154160370|gb|ABS67586.1| porin [Xanthobacter autotrophicus Py2]
          Length = 207

 Score = 87.9 bits (216), Expect = 8e-16,   Method: Composition-based stats.
 Identities = 46/218 (21%), Positives = 64/218 (29%), Gaps = 24/218 (11%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+   LA       +     A AAD   R                       + G Y G 
Sbjct: 1   MRSRLLASTALLAGVVLAAPAVAADLSGRYPAPYAQPYVQPV------AAFTWTGFYIGA 54

Query: 61  SALYNGSFG-EEAHHNAGGSIFAGYNVEDSC-IMYGVEGDVRYTVPVLADNIHSLHGIGG 118
           +A Y              G   AGYN + +   + GVE D  ++               G
Sbjct: 55  NAGYGWGSTVNSDPGGFIGGFQAGYNYQFASPFVLGVETDFNFSGLSAGGY---SLDYLG 111

Query: 119 SLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVA 178
           ++R R G+   D +L+Y T G    Q          +    G T G G EV     +  A
Sbjct: 112 TVRARLGWSF-DRVLVYGTGGFAYGQGSLDVLGLSSSSTQTGWTIGAGAEV-AFDRNWSA 169

Query: 179 RLEYRASKYS-----------KVEGFYNTISLGVGMKF 205
           R EY                       N +  GV  +F
Sbjct: 170 RAEYLYVDLGSATYPTVIGPVDSGINANILRAGVNYRF 207


>gi|62179592|ref|YP_216009.1| outer membrane protein A [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. SC-B67]
 gi|62127225|gb|AAX64928.1| putative hydrogenase, membrane component [Salmonella enterica
           subsp. enterica serovar Choleraesuis str. SC-B67]
 gi|322714061|gb|EFZ05632.1| outer membrane protein A [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. A50]
          Length = 350

 Score = 87.5 bits (215), Expect = 9e-16,   Method: Composition-based stats.
 Identities = 36/219 (16%), Positives = 71/219 (32%), Gaps = 38/219 (17%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K  +A+ V+         AQAA                     Y   +  ++  +   
Sbjct: 1   MKKTAIAIAVALA--GFATVAQAA---------------PKDNTWYAGAKLGWSQYHDT- 42

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGG-- 118
              +  + G    +  G   F GY V       G E    +   +     +         
Sbjct: 43  --GFINNDGPTHENQLGAGAFGGYQV---NPYVGFEMGYDWLGRMPYKGDNINGAYKAQG 97

Query: 119 -SLRIRGGYEVSDSLLLYATVGPDVAQKYET-----GKAGEITPIAIGGTAGVGVEVGGL 172
             L  + GY ++D L +Y  +G  V +         G + +     +      G+E   +
Sbjct: 98  VQLTAKLGYPITDDLDVYTRLGGMVWRADTKSNVPGGPSTKDHDTGVSPVFAGGIEY-AI 156

Query: 173 SESLVARLEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
           +  +  RLEY+ +      + +    +   +S+GV  +F
Sbjct: 157 TPEIATRLEYQWTNNIGDANTIGTRPDNGLLSVGVSYRF 195


>gi|56413933|ref|YP_151008.1| outer membrane protein A [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|197362856|ref|YP_002142493.1| outer membrane protein A [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
 gi|56128190|gb|AAV77696.1| outer membrane protein A [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|197094333|emb|CAR59845.1| outer membrane protein A [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
          Length = 350

 Score = 87.5 bits (215), Expect = 9e-16,   Method: Composition-based stats.
 Identities = 36/219 (16%), Positives = 71/219 (32%), Gaps = 38/219 (17%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K  +A+ V+         AQAA                     Y   +  ++  +   
Sbjct: 1   MKKTAIAIAVALA--GFATVAQAA---------------PKDNTWYAGAKLGWSQYHDT- 42

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGG-- 118
              +  + G    +  G   F GY V       G E    +   +     +         
Sbjct: 43  --GFINNDGPTHENQLGAGAFGGYQV---NPYVGFEMGYDWLGRMPYKGDNINGAYKAQG 97

Query: 119 -SLRIRGGYEVSDSLLLYATVGPDVAQKYET-----GKAGEITPIAIGGTAGVGVEVGGL 172
             L  + GY ++D L +Y  +G  V +         G + +     +      G+E   +
Sbjct: 98  VQLTAKLGYPITDDLDVYTRLGGMVWRADTKSNVPGGPSTKDHDTGVSPVFAGGIEY-AI 156

Query: 173 SESLVARLEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
           +  +  RLEY+ +      + +    +   +S+GV  +F
Sbjct: 157 TPEIATRLEYQWTNNIGDANTIGTRPDNGLLSVGVSYRF 195


>gi|319957414|ref|YP_004168677.1| porin [Nitratifractor salsuginis DSM 16511]
 gi|319419818|gb|ADV46928.1| porin [Nitratifractor salsuginis DSM 16511]
          Length = 220

 Score = 87.5 bits (215), Expect = 9e-16,   Method: Composition-based stats.
 Identities = 39/228 (17%), Positives = 69/228 (30%), Gaps = 31/228 (13%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+++  ++     A+A    A A   +                                 
Sbjct: 1   MRRVIFSLTT---AVALSSFAMAGGDIVPVAPAPADSWSGFYVGLQAGGIWGNADVNIPA 57

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGV---------EGDVRYTVPVLADNIH 111
                 S         GG ++AGYN                     D   +  +  +   
Sbjct: 58  YP----SNFSLDPDGFGGGVYAGYNWLLENDFLIGLEVAGNFISADDEGLSGGMGGEKYK 113

Query: 112 SLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYE----TGKAGEITPIAIGGTAGVGV 167
                  ++ +R G  + D+ + Y T G    +        G  G       G T G GV
Sbjct: 114 VEQNWDAAILLRIGKVIDDTWMPYVTGGVAWTELETSYIPDGGWGSKKDTVNGWTIGAGV 173

Query: 168 EVGGLSESLVARLEYRASKY----------SKVEGFYNTISLGVGMKF 205
           E+  L+ ++ AR+EYR + Y          S V+   N + +G+  +F
Sbjct: 174 EM-KLTTNIHARIEYRYTDYDTAQFVHAGPSNVDYNDNRVMVGISYRF 220


>gi|319408049|emb|CBI81703.1| Hemin binding protein C [Bartonella schoenbuchensis R1]
          Length = 274

 Score = 87.5 bits (215), Expect = 9e-16,   Method: Composition-based stats.
 Identities = 47/276 (17%), Positives = 81/276 (29%), Gaps = 86/276 (31%)

Query: 8   VGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGS 67
           +  S  AL S  +AQAAD   +           +A          + G Y G       S
Sbjct: 7   ITASIFALVSASAAQAADMPVQERPTTVLPQVVVAPA------FSWTGFYLGGQIGGFSS 60

Query: 68  FGE------------------EAHHNAGGSIFAGYNVEDSC-IMYGVEGDVRYTVPVL-- 106
                                       G ++AG NV+     + GV+ D+ ++      
Sbjct: 61  NSSWVRTSGDIQGILGHNKAFPKFSGFVGGLYAGSNVDFGNGFVLGVDTDIVWSGAKAKA 120

Query: 107 -------------------------------------ADNIHSLHGIGGSLRIRGGYEVS 129
                                                 +++       G+ R+R G+   
Sbjct: 121 SRSSLRTGNGARLAARAGVSTRAPALFEGTDNNASRVTESVTFSDKWSGATRVRLGFAF- 179

Query: 130 DSLLLYATVGPDVAQKYETGKAGEI-----------TPIAIGGTAGVGVEVGGLSESLVA 178
           D ++ Y   G   +Q                     +   +G T G GV+   +++S++ 
Sbjct: 180 DRIMPYVAGGIAYSQIKAVVAEERQGVETVIEQLSGSKTLVGYTLGAGVDF-AMTDSVIL 238

Query: 179 RLEYRASKYSK---------VEGFYNTISLGVGMKF 205
           R EYR S + K         ++   N   +GV  KF
Sbjct: 239 RAEYRYSDFGKKSFISNNAEIDLKTNDFRVGVAYKF 274


>gi|90407045|ref|ZP_01215235.1| outer membrane protein [Psychromonas sp. CNPT3]
 gi|90311916|gb|EAS40011.1| outer membrane protein [Psychromonas sp. CNPT3]
          Length = 383

 Score = 87.5 bits (215), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 37/200 (18%), Positives = 63/200 (31%), Gaps = 9/200 (4%)

Query: 11  SSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSFGE 70
           SS+       A A        H       T   N +  +     G Y   +   + +  E
Sbjct: 51  SSVLFLLAVPAYAQ-VENSTSHEFSDYSDTRQNNAHAYVGLRGGGTYFEGAC--SSNGSE 107

Query: 71  EAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGSLRIRGGYEVSD 130
              +  G  ++ GY       + G                 S   +G  L     Y++S+
Sbjct: 108 CNDNTFGYGLYGGYQFISWFALEGAVTHYGTPDASYGLKNISAEVLGSELTGVFSYDLSE 167

Query: 131 SLLLYATVGPDVAQKYETGKAGEI-TPIAIGGTAGVGVEVGGLSESLVARLEYRASK-YS 188
           S   YA VG       +    G   T    G  + +GV+   +S++   R EY+      
Sbjct: 168 SFDAYARVGVAYQNIEKNSTGGSELTSNEWGMLSALGVDY-RVSQNWSLRGEYQFIDGIG 226

Query: 189 KV---EGFYNTISLGVGMKF 205
                +   + +SLG+   F
Sbjct: 227 NSELMKSDMHFLSLGLTYHF 246


>gi|110634908|ref|YP_675116.1| hypothetical protein Meso_2567 [Mesorhizobium sp. BNC1]
 gi|110285892|gb|ABG63951.1| outer membrane protein, hypothetical [Chelativorans sp. BNC1]
          Length = 234

 Score = 87.5 bits (215), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 43/237 (18%), Positives = 81/237 (34%), Gaps = 44/237 (18%)

Query: 7   AVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNG 66
            + ++ + L    +  AAD + +                     +D++G Y G+   Y  
Sbjct: 4   ILSLAFIGLFGTSAGFAADAIIQRDDPVPVAP----VVAAPAKSYDWSGIYLGVDGGYKW 59

Query: 67  SFGEEAHHNAG----------------GSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNI 110
           +  +   ++                  G ++ GYN +    + G EGD +          
Sbjct: 60  NSLKFDPNSVAKKAGIKGDAFKMNSTFGGVYLGYNYQIDNWVIGAEGDAQLYFGGKDKAA 119

Query: 111 HSLHG------IGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAG-----EITPIAI 159
            S +G        GS R+R GY + D  L Y T G        + K             +
Sbjct: 120 ASGNGRFAASRGFGSARVRLGYAM-DRFLPYVTGGAAFENLEISSKKDGKVVARDNKTRV 178

Query: 160 GGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFY-----------NTISLGVGMKF 205
           G T G G++   ++E  + ++EY+   + K                +T+ +G+  KF
Sbjct: 179 GYTLGAGLDY-AITEKWIGKVEYQFMDFGKKSYDLDIGSADLSSHSHTMRVGLSYKF 234


>gi|254719331|ref|ZP_05181142.1| 22 kDa outer membrane protein precursor [Brucella sp. 83/13]
 gi|265984332|ref|ZP_06097067.1| outer membrane protein 22 [Brucella sp. 83/13]
 gi|306839106|ref|ZP_07471923.1| 22 kDa outer membrane protein precursor [Brucella sp. NF 2653]
 gi|264662924|gb|EEZ33185.1| outer membrane protein 22 [Brucella sp. 83/13]
 gi|306405653|gb|EFM61915.1| 22 kDa outer membrane protein precursor [Brucella sp. NF 2653]
          Length = 212

 Score = 87.2 bits (214), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 44/220 (20%), Positives = 77/220 (35%), Gaps = 26/220 (11%)

Query: 2   QKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLS 61
           ++   A    +  +A   SA AAD +    +           +      HD++G Y G  
Sbjct: 3   KRSITAAAFGTAVMAFAGSAFAADMMGGTDYT--------YNDPVAAGPHDWSGNYVGAQ 54

Query: 62  ALYNGSFGEE---AHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVP--VLADNIHSLHGI 116
              + S       +   A G I  G N+++  I++G E +  +      +          
Sbjct: 55  VGGSSSKFPSPFASRTGALGGIVVGKNMQNGNIVFGAELEGNFAEAEHRIGHGGTLQQSW 114

Query: 117 GGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESL 176
            G+ + + GY   D  L+Y T G  V +               G   G GVE   LS  L
Sbjct: 115 NGNAKGKVGYAF-DKTLVYGTAGYGVTRFKAKENTTSAPGWEGGVLIGAGVEQ-ALSGPL 172

Query: 177 VARLEYRASKYSKVEG-----------FYNTISLGVGMKF 205
             + EY   +++ V+              ++I  G+  +F
Sbjct: 173 SVKAEYDFQRFNDVKSQVNGIEQRNNLKNHSIKAGLNYRF 212


>gi|168233443|ref|ZP_02658501.1| outer membrane protein A [Salmonella enterica subsp. enterica
           serovar Kentucky str. CDC 191]
 gi|194472870|ref|ZP_03078854.1| outer membrane protein A [Salmonella enterica subsp. enterica
           serovar Kentucky str. CVM29188]
 gi|197248715|ref|YP_002145940.1| outer membrane protein A [Salmonella enterica subsp. enterica
           serovar Agona str. SL483]
 gi|194459234|gb|EDX48073.1| outer membrane protein A [Salmonella enterica subsp. enterica
           serovar Kentucky str. CVM29188]
 gi|197212418|gb|ACH49815.1| outer membrane protein A [Salmonella enterica subsp. enterica
           serovar Agona str. SL483]
 gi|205332492|gb|EDZ19256.1| outer membrane protein A [Salmonella enterica subsp. enterica
           serovar Kentucky str. CDC 191]
          Length = 371

 Score = 87.2 bits (214), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 36/221 (16%), Positives = 71/221 (32%), Gaps = 40/221 (18%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K  +A+ V+         AQAA                     Y   +  ++  +   
Sbjct: 20  MKKTAIAIAVALA--GFATVAQAA---------------PKDNTWYAGAKLGWSQYHDT- 61

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGG-- 118
              +  + G    +  G   F GY V       G E    +   +     +         
Sbjct: 62  --GFINNDGPTHENQLGAGAFGGYQV---NPYVGFEMGYDWLGRMPYKGDNINGAYKAQG 116

Query: 119 -SLRIRGGYEVSDSLLLYATVGPDVAQKYET-------GKAGEITPIAIGGTAGVGVEVG 170
             L  + GY ++D L +Y  +G  V +           G + +     +      G+E  
Sbjct: 117 VQLTAKLGYPITDDLDVYTRLGGMVWRADTKSNVPGPGGASNKDHDTGVSPVFAGGIEY- 175

Query: 171 GLSESLVARLEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
            ++  +  RLEY+ +      + +    +   +S+GV  +F
Sbjct: 176 AITPEIATRLEYQWTNNIGDANTIGTRPDNGLLSVGVSYRF 216


>gi|240851183|ref|YP_002972586.1| hemin binding protein C [Bartonella grahamii as4aup]
 gi|240268306|gb|ACS51894.1| hemin binding protein C [Bartonella grahamii as4aup]
          Length = 296

 Score = 87.2 bits (214), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 45/299 (15%), Positives = 83/299 (27%), Gaps = 97/299 (32%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRG----VVPTIATNRYVPIRHDFNGP 56
           M+   L + +S     +  +AQAAD V       +        +  T   V     ++G 
Sbjct: 1   MKTKCL-IALSIFTFITTSTAQAADTVIFEQSKPKVSLQNDSSSRITPVTVSAPFSWSGF 59

Query: 57  YAGLSALYNGSFGEEA--------------------HHNAGGSIFAGYNVEDSC-IMYGV 95
           Y G    Y  S                                ++AG N++    +++G 
Sbjct: 60  YFGGQIGYFSSKNTLDYAQEARDGKWAWVDRNLSPKPSGLRAGLYAGSNIDLGDDLVFGF 119

Query: 96  EGDVRYTVPVLADNIHSL------------------------------------------ 113
           + D+ ++        +                                            
Sbjct: 120 DTDIVWSGRKSTQTDNGKKILNELDSINIAFKEAGIPIIKPAAQDETIPNYGDIVVSSVT 179

Query: 114 --HGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYE----------------TGKAGEIT 155
                 G+ R R G+  S  L+ Y   G    Q                   +G   + T
Sbjct: 180 LKEKWSGAARARIGFA-SHRLMPYIAGGIAYTQMQYIMSLLSKSQEDSTVFASGNVLDKT 238

Query: 156 PIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVE---------GFYNTISLGVGMKF 205
               G T G G +   ++++++ R EYR S + K +            + +  G+  KF
Sbjct: 239 KTLFGYTVGGGFD-LAMTDNIIMRTEYRYSDFFKKKFANDDLKISSQTHDVRFGIAYKF 296


>gi|92116045|ref|YP_575774.1| carbohydrate-selective porin OprB [Nitrobacter hamburgensis X14]
 gi|91798939|gb|ABE61314.1| Carbohydrate-selective porin OprB [Nitrobacter hamburgensis X14]
          Length = 692

 Score = 87.2 bits (214), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 50/233 (21%), Positives = 82/233 (35%), Gaps = 33/233 (14%)

Query: 3   KLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLS- 61
           +  +  GV+  ALA   SA AAD             P I         H   G     + 
Sbjct: 34  RHVVLAGVALSALALGGSAVAADVGASLLPTKAMPRPVIDWTGLYFGAHAGFGGGRSTAT 93

Query: 62  -ALYNGSFGEEAHHNAGGSIFAGYNVEDSC-IMYGVEGDVRYTVPVLADNIHSLH----- 114
                 + G   +      + AGYN++    ++ G+E D+ +   + +++  S       
Sbjct: 94  LVDPASTTGRNDYGGIISGVQAGYNIQLPSGLLLGLEADISFPNYIESNSDVSKLATARS 153

Query: 115 ------GIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYE-----TGKAGEITPIAIGGTA 163
                    GS R R GY      L YA+ G   A +       +G   +   + +G  A
Sbjct: 154 AVTQQWDFIGSARGRIGYATGP-WLTYASGGLAFAGERYLNDLPSGDQEKALDMRLGWAA 212

Query: 164 GVGVEVGGLSESLVARLEYRASKYSKVEG------------FYNTISLGVGMK 204
           G G+E    + S  ARLEY   ++ K                 ++I +G+  K
Sbjct: 213 GAGLEY-AFTPSWSARLEYLYYRFDKTNVQFPSAAQYAATMDMHSIRVGLNRK 264


>gi|91210052|ref|YP_540038.1| outer membrane protein A [Escherichia coli UTI89]
 gi|237707059|ref|ZP_04537540.1| outer membrane protein A [Escherichia sp. 3_2_53FAA]
 gi|91071626|gb|ABE06507.1| outer membrane protein A precursor [Escherichia coli UTI89]
 gi|226898269|gb|EEH84528.1| outer membrane protein A [Escherichia sp. 3_2_53FAA]
          Length = 375

 Score = 87.2 bits (214), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 37/212 (17%), Positives = 69/212 (32%), Gaps = 28/212 (13%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K  +A+ V+         AQAA                     Y   +  ++  +   
Sbjct: 30  MKKTAIAIAVALA--GFATVAQAA---------------PKDNTWYTGAKLGWSQYHDT- 71

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGSL 120
              +  + G    +  G   F GY V            +       +    +    G  L
Sbjct: 72  --GFINNNGPTHENQLGAGAFGGYQVNPYVGFEMGYDWLGRMPYKGSVENGAYKAQGVQL 129

Query: 121 RIRGGYEVSDSLLLYATVGPDVAQKYE-TGKAGEITPIAIGGTAGVGVEVGGLSESLVAR 179
             + GY ++D L +Y  +G  V +    +   G+     +      GVE   ++  +  R
Sbjct: 130 TAKLGYPITDDLDVYTRLGGMVWRADTKSNVYGKNHDTGVSPVFAGGVEY-AITPEIATR 188

Query: 180 LEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
           LEY+ +        +    +   +SLGV  +F
Sbjct: 189 LEYQWTNNIGDAHTIGTRPDNGMLSLGVSYRF 220


>gi|237730913|ref|ZP_04561394.1| outer membrane protein A [Citrobacter sp. 30_2]
 gi|226906452|gb|EEH92370.1| outer membrane protein A [Citrobacter sp. 30_2]
          Length = 356

 Score = 86.8 bits (213), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 38/212 (17%), Positives = 69/212 (32%), Gaps = 26/212 (12%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K  +A+ V+         AQAA                     Y   +  ++  +   
Sbjct: 9   MKKTAIAIAVALA--GFATVAQAA---------------PKDNTWYTGAKLGWSQFHDIG 51

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGSL 120
           +     + G       G   F GY V            +       ++   +    G  L
Sbjct: 52  NN-RIDNNGPTHESQLGAGAFGGYQVNPYVGFEMGYDWLGRMPYKGSEQNGAFKAQGVQL 110

Query: 121 RIRGGYEVSDSLLLYATVGPDVAQKYETGKAGE-ITPIAIGGTAGVGVEVGGLSESLVAR 179
             + GY ++D L +Y  +G  V +       G       +      GVE   ++  +  R
Sbjct: 111 TAKLGYPITDDLDVYTRLGGMVWRADAKNNDGFKDHDTGVSPVFAGGVEY-AITPEIATR 169

Query: 180 LEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
           LEY+ +      + V G  +   +S+GV  +F
Sbjct: 170 LEYQWTNNIGDANTVGGRPDNGLLSVGVSYRF 201


>gi|7514148|pir||JC6528 31K major protein, Pap31 - Bartonella henselae phage
          Length = 281

 Score = 86.8 bits (213), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 51/284 (17%), Positives = 84/284 (29%), Gaps = 93/284 (32%)

Query: 7   AVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNG 66
            +  S +AL S  +AQAAD +         +     +           G Y G       
Sbjct: 6   LMTTSVIALISASAAQAADVIVPHEVAPTVISAPAFS-------WTGTGFYIGGQVGNFS 58

Query: 67  SFGEEAH----------------HNAGGSIFAGYNVEDSC-IMYGVEGDVRYTV------ 103
           S  E                       G I+AG N++    ++ GVE D  +        
Sbjct: 59  SKVEITDPNKKDKLFSKDDTPKPSGFMGGIYAGSNMDLGNNMILGVETDAVWADREDAKT 118

Query: 104 -------------------------------------PVLADNIHSLHGIGGSLRIRGGY 126
                                                    D++       G+ R+R G+
Sbjct: 119 SSAEAIGQDELETFRDSLKKANAAFAQGKTSDNVAAVDKHTDSLALKEKWSGATRVRIGF 178

Query: 127 EVSDSLLLYATVGPDVAQKY----------------ETGKAGEITPIAIGGTAGVGVEVG 170
             +D ++ Y   G   AQ                   T +  + T   +G T G GV+  
Sbjct: 179 TAADRIMPYVAGGVSYAQVQAVSSTKVTQAADDAEIATAQLFDKTKTLVGFTLGGGVDF- 237

Query: 171 GLSESLVARLEYRASKYSKVEG---------FYNTISLGVGMKF 205
            ++++++ R EYR S + K +            N   +GV  KF
Sbjct: 238 AMTDNVLLRAEYRYSDFGKKKFEKEGSEFSYKTNDFRVGVAYKF 281


>gi|49475276|ref|YP_033317.1| hemin binding protein d [Bartonella henselae str. Houston-1]
 gi|49238082|emb|CAF27289.1| Hemin binding protein d [Bartonella henselae str. Houston-1]
          Length = 274

 Score = 86.8 bits (213), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 44/267 (16%), Positives = 76/267 (28%), Gaps = 94/267 (35%)

Query: 21  AQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSFGEEAH------- 73
           AQAAD +          VP             + G Y G       S    ++       
Sbjct: 20  AQAADVI----------VPEQPVPVVAVPAFSWAGFYLGGQVGNFSSKTALSYLGDEKTG 69

Query: 74  -------------HNAGGSIFAGYNVEDSC-IMYGVEGDVRYTVPV-------------- 105
                            G I+AG N + +   + G++ DV ++                 
Sbjct: 70  KWTPVKKEFVPKLSGFVGGIYAGSNFDINNGFIIGIDTDVMWSGKKNTKIITWPEVPPEV 129

Query: 106 -----------------------LADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDV 142
                                   A +        G+ R++ G+ V D ++ Y   G   
Sbjct: 130 SSEKKVERVSVGTNQDTSAEVTNGALSHTLKQKWFGATRVKVGFVV-DRMMPYIAGGVAY 188

Query: 143 AQ---------------KYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKY 187
            Q                  +    +     +G T G G++   ++++++ R EYR S Y
Sbjct: 189 TQLQNIFEKEADKTKKAIDISNVIHDEKKTMVGYTLGGGIDF-AMTDNVIVRAEYRYSDY 247

Query: 188 SKVEG---------FYNTISLGVGMKF 205
            K +            N   +GV  KF
Sbjct: 248 GKKKFADEKIEMRYKTNDFRVGVAYKF 274


>gi|225853091|ref|YP_002733324.1| outer membrane protein Omp31 [Brucella melitensis ATCC 23457]
 gi|256263422|ref|ZP_05465954.1| Omp31b [Brucella melitensis bv. 2 str. 63/9]
 gi|260565169|ref|ZP_05835653.1| outer membrane protein 31b [Brucella melitensis bv. 1 str. 16M]
 gi|265991667|ref|ZP_06104224.1| outer membrane protein 31b [Brucella melitensis bv. 1 str. Rev.1]
 gi|265995505|ref|ZP_06108062.1| outer membrane protein 31b [Brucella melitensis bv. 3 str. Ether]
 gi|225641456|gb|ACO01370.1| outer membrane protein Omp31 [Brucella melitensis ATCC 23457]
 gi|260151237|gb|EEW86331.1| outer membrane protein 31b [Brucella melitensis bv. 1 str. 16M]
 gi|262766618|gb|EEZ12407.1| outer membrane protein 31b [Brucella melitensis bv. 3 str. Ether]
 gi|263002451|gb|EEZ15026.1| outer membrane protein 31b [Brucella melitensis bv. 1 str. Rev.1]
 gi|263093434|gb|EEZ17484.1| Omp31b [Brucella melitensis bv. 2 str. 63/9]
 gi|326409637|gb|ADZ66702.1| outer membrane protein Omp31 [Brucella melitensis M28]
 gi|326539339|gb|ADZ87554.1| outer membrane protein Omp31 [Brucella melitensis M5-90]
          Length = 202

 Score = 86.4 bits (212), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 31/186 (16%), Positives = 63/186 (33%), Gaps = 47/186 (25%)

Query: 66  GSFGEEAHHNAGGSIFAGYNVEDSC-IMYGVEGDVRYTVPVL------------------ 106
               +       G + AGYN + +  ++ G E D + +                      
Sbjct: 18  SGSLDVTASGFVGGVQAGYNWQLANGLVLGGEADFQGSTVKSKLVDNGDLSDIGVAGNLS 77

Query: 107 ---ADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEI--------T 155
              +  + +     G++R R G+  ++ L++Y T G    +   +  A +         +
Sbjct: 78  GDESFGLETKVQWFGTVRARLGFTPTERLMVYGTGGLAYGKVKTSLSAYDDGESFSAGNS 137

Query: 156 PIAIGGTAGVGVEVGGLSESLVARLEYRASKYSK----------------VEGFYNTISL 199
               G T G GVE   ++ +   + EY  +   K                 +  ++T+ L
Sbjct: 138 KTKAGWTLGAGVEY-AVTNNWTLKSEYLYTDLGKRSFNYIDEENVNINMENKVNFHTVRL 196

Query: 200 GVGMKF 205
           G+  KF
Sbjct: 197 GLNYKF 202


>gi|260545348|ref|ZP_05821089.1| LOW QUALITY PROTEIN: outer membrane protein [Brucella abortus NCTC
           8038]
 gi|260754712|ref|ZP_05867060.1| LOW QUALITY PROTEIN: outer membrane protein 25b [Brucella abortus
           bv. 6 str. 870]
 gi|260757935|ref|ZP_05870283.1| LOW QUALITY PROTEIN: outer membrane protein 25b [Brucella abortus
           bv. 4 str. 292]
 gi|260761758|ref|ZP_05874101.1| LOW QUALITY PROTEIN: outer membrane protein 25b [Brucella abortus
           bv. 2 str. 86/8/59]
 gi|260883735|ref|ZP_05895349.1| LOW QUALITY PROTEIN: outer membrane protein 25b [Brucella abortus
           bv. 9 str. C68]
 gi|260096755|gb|EEW80630.1| LOW QUALITY PROTEIN: outer membrane protein [Brucella abortus NCTC
           8038]
 gi|260668253|gb|EEX55193.1| LOW QUALITY PROTEIN: outer membrane protein 25b [Brucella abortus
           bv. 4 str. 292]
 gi|260672190|gb|EEX59011.1| LOW QUALITY PROTEIN: outer membrane protein 25b [Brucella abortus
           bv. 2 str. 86/8/59]
 gi|260674820|gb|EEX61641.1| LOW QUALITY PROTEIN: outer membrane protein 25b [Brucella abortus
           bv. 6 str. 870]
 gi|260873263|gb|EEX80332.1| LOW QUALITY PROTEIN: outer membrane protein 25b [Brucella abortus
           bv. 9 str. C68]
          Length = 173

 Score = 86.4 bits (212), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 35/168 (20%), Positives = 59/168 (35%), Gaps = 37/168 (22%)

Query: 73  HHNAGGSIFAGYNVEDSC-IMYGVEGDVRYTVPVLA-----------DNIHSLHGIGGSL 120
                G ++AGYN +     + GV+GD+ Y     +             + S     G++
Sbjct: 8   PDGFLGGLYAGYNFDMGNNFVLGVDGDITYNDLDASHSDTDPDLDLTTGVDSKLRWSGAV 67

Query: 121 RIRGGYEVSDSLLLYATVGPDVAQKYETGKAGE--------ITPIAIGGTAGVGVEVGGL 172
           R R G  + D  + Y   G        +    +         +    G  AG GV+    
Sbjct: 68  RARMGVAM-DRWMPYIAGGVAFGNVKNSVSLTDGIESIGVSQSKTMTGWAAGAGVDYAA- 125

Query: 173 SESLVARLEYRASKYSKVEGFY---------------NTISLGVGMKF 205
           +++++ RLEYR + Y   +                  + I LGV  KF
Sbjct: 126 TDNVIVRLEYRYTDYGHKDFSVVDGDLSVEARNKFKTHDIRLGVAYKF 173


>gi|117623167|ref|YP_852080.1| outer membrane protein A [Escherichia coli APEC O1]
 gi|115512291|gb|ABJ00366.1| OmpA [Escherichia coli APEC O1]
          Length = 370

 Score = 86.4 bits (212), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 37/212 (17%), Positives = 69/212 (32%), Gaps = 28/212 (13%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K  +A+ V+         AQAA                     Y   +  ++  +   
Sbjct: 25  MKKTAIAIAVALA--GFATVAQAA---------------PKDNTWYTGAKLGWSQYHDT- 66

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGSL 120
              +  + G    +  G   F GY V            +       +    +    G  L
Sbjct: 67  --GFINNNGPTHENQLGAGAFGGYQVNPYVGFEMGYDWLGRMPYKGSVENGAYKAQGVQL 124

Query: 121 RIRGGYEVSDSLLLYATVGPDVAQKYE-TGKAGEITPIAIGGTAGVGVEVGGLSESLVAR 179
             + GY ++D L +Y  +G  V +    +   G+     +      GVE   ++  +  R
Sbjct: 125 TAKLGYPITDDLDVYTRLGGMVWRADTKSNVYGKNHDTGVSPVFAGGVEY-AITPEIATR 183

Query: 180 LEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
           LEY+ +        +    +   +SLGV  +F
Sbjct: 184 LEYQWTNNIGDAHTIGTRPDNGMLSLGVSYRF 215


>gi|296448558|ref|ZP_06890432.1| TonB-dependent receptor [Methylosinus trichosporium OB3b]
 gi|296253924|gb|EFH01077.1| TonB-dependent receptor [Methylosinus trichosporium OB3b]
          Length = 482

 Score = 86.4 bits (212), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 45/230 (19%), Positives = 75/230 (32%), Gaps = 32/230 (13%)

Query: 3   KLFLAVGVSSLALASFCSAQAADPVRR-AHHGGRGVVPTIATNRYVPIRHDFNGPYAGLS 61
           K   A G  +   ++  S+   D   +    G R     +     V      +      S
Sbjct: 255 KFPSAAGAPAFLASALPSS---DLPSKKGPPGSRYDWRGVYVGFDVGHAWGHDRFVPYYS 311

Query: 62  ALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLA------DNIHSLHG 115
               G+          G + AGYN + + ++ GVE +   T             + S   
Sbjct: 312 VPNVGAPQSFDLTGVIGGLHAGYNWQLASVVLGVETEFDATSLNRTVQQDAVTTLRSSSA 371

Query: 116 IGGSLRIRGGYEVSDSLLLYATVGPDVAQKY----ETGKAGEITPIAIGGTAGVGVEVGG 171
           + GS+R R G+   D LL++ T G   A         G     +        G G+E   
Sbjct: 372 LQGSIRARFGWAF-DRLLVFGTGGSQWAGVQNAYHIRGLGDSYSTNHHSWVVGGGIEY-A 429

Query: 172 LSESLVARLEYRASKYSK----------------VEGFYNTISLGVGMKF 205
           L++  + R EYR S + K                     + ++ G+  KF
Sbjct: 430 LTDHWLGRAEYRFSDFGKNLDGNGPIIWPLSFQSHHWKEDRLTAGLSWKF 479


>gi|260597356|ref|YP_003209927.1| outer membrane protein A [Cronobacter turicensis z3032]
 gi|260216533|emb|CBA29736.1| Outer membrane protein A [Cronobacter turicensis z3032]
          Length = 355

 Score = 86.4 bits (212), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 38/212 (17%), Positives = 65/212 (30%), Gaps = 28/212 (13%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K  +A+ V+         AQAA                     Y   +  ++  +   
Sbjct: 9   MKKTAIAIAVALA--GFATVAQAA---------------PKDNTWYAGGKLGWSQFHDT- 50

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGSL 120
              +  + G       G   F GY V            +            +    G  L
Sbjct: 51  --GFIPNDGPTHESQLGAGAFGGYQVNPYVGFEMGYDWLGRMPYKGDTVNGAFKAQGVQL 108

Query: 121 RIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEIT-PIAIGGTAGVGVEVGGLSESLVAR 179
             + GY V+D L +Y  +G  V +   +   G       +      GVE   ++  +  R
Sbjct: 109 TAKLGYPVTDDLDVYTRLGGMVWRADSSSNIGGDDHDTGVSPVFAGGVE-WAMTRDIATR 167

Query: 180 LEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
           LEY+          V    +   +S+GV  +F
Sbjct: 168 LEYQWVNNIGDAQTVGARPDNGMLSVGVSYRF 199


>gi|331672486|ref|ZP_08373276.1| outer membrane protein A [Escherichia coli TA280]
 gi|331070392|gb|EGI41757.1| outer membrane protein A [Escherichia coli TA280]
          Length = 370

 Score = 86.4 bits (212), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 37/212 (17%), Positives = 69/212 (32%), Gaps = 28/212 (13%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K  +A+ V+         AQAA                     Y   +  ++  +   
Sbjct: 25  MKKTAIAIAVALA--GFATVAQAA---------------PKDNTWYTGAKLGWSQYHDT- 66

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGSL 120
              +  + G    +  G   F GY V            +       +    +    G  L
Sbjct: 67  --GFINNNGPTHENQLGAGAFGGYQVNPYVGFEMGYDWLGRMPYKGSVENGAYKAQGVQL 124

Query: 121 RIRGGYEVSDSLLLYATVGPDVAQKYE-TGKAGEITPIAIGGTAGVGVEVGGLSESLVAR 179
             + GY ++D L +Y  +G  V +    +   G+     +      GVE   ++  +  R
Sbjct: 125 TAKLGYPITDDLDVYTRLGGMVWRADTKSNFDGKNHDTGVSPVFAGGVEY-AITPEIATR 183

Query: 180 LEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
           LEY+ +        +    +   +SLGV  +F
Sbjct: 184 LEYQWTNNIGDAHTIGTRPDNGMLSLGVSYRF 215


>gi|90424594|ref|YP_532964.1| OmpA-like transmembrane region [Rhodopseudomonas palustris BisB18]
 gi|90106608|gb|ABD88645.1| OmpA-like transmembrane region [Rhodopseudomonas palustris BisB18]
          Length = 236

 Score = 86.4 bits (212), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 37/238 (15%), Positives = 68/238 (28%), Gaps = 45/238 (18%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+KL L    ++  +     A AAD     +                 + +++ G Y G 
Sbjct: 1   MRKLLLG---TAALMVLAAPAFAADLPAPTYTKAPAYTAPE-------VVYNWTGFYIGG 50

Query: 61  SALYNGSFGEE---AHHNAGGSIFAGYNVED-SCIMYGVEGDVRYTVPVLADN------- 109
                 +             G +  G + +     + G+E    +               
Sbjct: 51  HVGGAFAGDNNISGNDGQFLGGVQIGADYQFTRNWVVGLEAQYSWLPSNDNGGLAFPGGS 110

Query: 110 -IHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYET-------GKAGEITPIAIGG 161
            +   +   GS+  R GY    +LL YA  G                           G 
Sbjct: 111 LVTQDNRGLGSVTGRLGYTWGPALL-YAKGGYAFRDSSLDLSNTGVGVPFTTSGNHRDGY 169

Query: 162 TAGVGVEVGGLSESLVARLEYRASKYSK--------------VEGFYNTISLGVGMKF 205
           T G G+E    + +  A++EY+   +                V    +T+  G+  +F
Sbjct: 170 TVGAGLEY-MFAPNWSAKVEYQYYDFGNTTFTGGPPDVLGASVRNDEHTVKAGLNYRF 226


>gi|306812596|ref|ZP_07446789.1| outer membrane protein A [Escherichia coli NC101]
 gi|305853359|gb|EFM53798.1| outer membrane protein A [Escherichia coli NC101]
          Length = 365

 Score = 86.4 bits (212), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 37/212 (17%), Positives = 69/212 (32%), Gaps = 28/212 (13%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K  +A+ V+         AQAA                     Y   +  ++  +   
Sbjct: 20  MKKTAIAIAVALA--GFATVAQAA---------------PKDNTWYTGAKLGWSQYHDT- 61

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGSL 120
              +  + G    +  G   F GY V            +       +    +    G  L
Sbjct: 62  --GFIDNNGPTHENQLGAGAFGGYQVNPYVGFEMGYDWLGRMPYKGSVENGAYKAQGVQL 119

Query: 121 RIRGGYEVSDSLLLYATVGPDVAQKYE-TGKAGEITPIAIGGTAGVGVEVGGLSESLVAR 179
             + GY ++D L +Y  +G  V +    +   G+     +      GVE   ++  +  R
Sbjct: 120 TAKLGYPITDDLDVYTRLGGMVWRADTKSNFDGKNHDTGVSPVFAGGVEY-AITPEIATR 178

Query: 180 LEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
           LEY+ +        +    +   +SLGV  +F
Sbjct: 179 LEYQWTNNIGDAHTIGTRPDNGMLSLGVSYRF 210


>gi|312945470|gb|ADR26297.1| outer membrane protein A [Escherichia coli O83:H1 str. NRG 857C]
          Length = 365

 Score = 86.4 bits (212), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 37/212 (17%), Positives = 69/212 (32%), Gaps = 28/212 (13%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K  +A+ V+         AQAA                     Y   +  ++  +   
Sbjct: 20  MKKTAIAIAVALA--GFATVAQAA---------------PKDNTWYTGAKLGWSQYHDT- 61

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGSL 120
              +  + G    +  G   F GY V            +       +    +    G  L
Sbjct: 62  --GFINNNGPTHENQLGAGAFGGYQVNPYVGFEMGYDWLGRMPYKGSVENGAYKAQGVQL 119

Query: 121 RIRGGYEVSDSLLLYATVGPDVAQKYE-TGKAGEITPIAIGGTAGVGVEVGGLSESLVAR 179
             + GY ++D L +Y  +G  V +    +   G+     +      GVE   ++  +  R
Sbjct: 120 TAKLGYPITDDLDVYTRLGGMVWRADTKSNFDGKNHDTGVSPVFAGGVEY-AITPEIATR 178

Query: 180 LEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
           LEY+ +        +    +   +SLGV  +F
Sbjct: 179 LEYQWTNNIGDAHTIGTRPDNGMLSLGVSYRF 210


>gi|331641486|ref|ZP_08342621.1| outer membrane protein A [Escherichia coli H736]
 gi|331038284|gb|EGI10504.1| outer membrane protein A [Escherichia coli H736]
          Length = 370

 Score = 86.0 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 37/212 (17%), Positives = 69/212 (32%), Gaps = 28/212 (13%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K  +A+ V+         AQAA                     Y   +  ++  +   
Sbjct: 25  MKKTAIAIAVALA--GFATVAQAA---------------PKDNTWYTGAKLGWSQYHDT- 66

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGSL 120
              +  + G    +  G   F GY V            +       +    +    G  L
Sbjct: 67  --GFINNNGPTHENQLGAGAFGGYQVNPYVGFEMGYDWLGRMPYKGSVENGAYKAQGVQL 124

Query: 121 RIRGGYEVSDSLLLYATVGPDVAQKYE-TGKAGEITPIAIGGTAGVGVEVGGLSESLVAR 179
             + GY ++D L +Y  +G  V +    +   G+     +      GVE   ++  +  R
Sbjct: 125 TAKLGYPITDDLDIYTRLGGMVWRADTKSNVYGKNHDTGVSPVFAGGVEY-AITPEIATR 183

Query: 180 LEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
           LEY+ +        +    +   +SLGV  +F
Sbjct: 184 LEYQWTNNIGDAHTIGTRPDNGMLSLGVSYRF 215


>gi|156934557|ref|YP_001438473.1| outer membrane protein A [Cronobacter sakazakii ATCC BAA-894]
 gi|156532811|gb|ABU77637.1| hypothetical protein ESA_02391 [Cronobacter sakazakii ATCC BAA-894]
          Length = 358

 Score = 86.0 bits (211), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 37/212 (17%), Positives = 64/212 (30%), Gaps = 28/212 (13%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K   A+ ++         AQAA                     Y   +  ++  +   
Sbjct: 12  MKKT--AIAIAVALAGFATVAQAA---------------PKDNTWYAGGKLGWSQFHDT- 53

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGSL 120
              +  + G       G   F GY V            +            +    G  L
Sbjct: 54  --GFIPNDGPTHESQLGAGAFGGYQVNPYVGFEMGYDWLGRMPYKGDTVNGAFKAQGVQL 111

Query: 121 RIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEIT-PIAIGGTAGVGVEVGGLSESLVAR 179
             + GY V+D L +Y  +G  V +   +   G       +      GVE   ++  +  R
Sbjct: 112 TAKLGYPVTDDLDVYTRLGGMVWRADSSSNIGGDDHDTGVSPVFAGGVE-WAMTRDIATR 170

Query: 180 LEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
           LEY+          V    +   +S+GV  +F
Sbjct: 171 LEYQWVNNIGDAQTVGARPDNGMLSVGVSYRF 202


>gi|17986685|ref|NP_539319.1| 31 kDa outer-membrane immunogenic protein precursor [Brucella
           melitensis bv. 1 str. 16M]
 gi|256045237|ref|ZP_05448134.1| outer membrane protein Omp31 [Brucella melitensis bv. 1 str. Rev.1]
 gi|256114189|ref|ZP_05454943.1| outer membrane protein Omp31 [Brucella melitensis bv. 3 str. Ether]
 gi|17982306|gb|AAL51583.1| 31 kDa outer-membrane immunogenic protein precursor [Brucella
           melitensis bv. 1 str. 16M]
          Length = 201

 Score = 86.0 bits (211), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 31/186 (16%), Positives = 63/186 (33%), Gaps = 47/186 (25%)

Query: 66  GSFGEEAHHNAGGSIFAGYNVEDSC-IMYGVEGDVRYTVPVL------------------ 106
               +       G + AGYN + +  ++ G E D + +                      
Sbjct: 17  SGSLDVTASGFVGGVQAGYNWQLANGLVLGGEADFQGSTVKSKLVDNGDLSDIGVAGNLS 76

Query: 107 ---ADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEI--------T 155
              +  + +     G++R R G+  ++ L++Y T G    +   +  A +         +
Sbjct: 77  GDESFGLETKVQWFGTVRARLGFTPTERLMVYGTGGLAYGKVKTSLSAYDDGESFSAGNS 136

Query: 156 PIAIGGTAGVGVEVGGLSESLVARLEYRASKYSK----------------VEGFYNTISL 199
               G T G GVE   ++ +   + EY  +   K                 +  ++T+ L
Sbjct: 137 KTKAGWTLGAGVEY-AVTNNWTLKSEYLYTDLGKRSFNYIDEENVNINMENKVNFHTVRL 195

Query: 200 GVGMKF 205
           G+  KF
Sbjct: 196 GLNYKF 201


>gi|307627623|gb|ADN71927.1| outer membrane protein A [Escherichia coli UM146]
          Length = 365

 Score = 86.0 bits (211), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 37/212 (17%), Positives = 69/212 (32%), Gaps = 28/212 (13%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K  +A+ V+         AQAA                     Y   +  ++  +   
Sbjct: 20  MKKTAIAIAVALA--GFATVAQAA---------------PKDNTWYTGAKLGWSQYHDT- 61

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGSL 120
              +  + G    +  G   F GY V            +       +    +    G  L
Sbjct: 62  --GFINNNGPTHENQLGAGAFGGYQVNPYVGFEMGYDWLGRMPYKGSVENGAYKAQGVQL 119

Query: 121 RIRGGYEVSDSLLLYATVGPDVAQKYE-TGKAGEITPIAIGGTAGVGVEVGGLSESLVAR 179
             + GY ++D L +Y  +G  V +    +   G+     +      GVE   ++  +  R
Sbjct: 120 TAKLGYPITDDLDVYTRLGGMVWRADTKSNVYGKNHDTGVSPVFAGGVEY-AITPEIATR 178

Query: 180 LEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
           LEY+ +        +    +   +SLGV  +F
Sbjct: 179 LEYQWTNNIGDAHTIGTRPDNGMLSLGVSYRF 210


>gi|300819200|ref|ZP_07099401.1| outer membrane protein A [Escherichia coli MS 107-1]
 gi|300528219|gb|EFK49281.1| outer membrane protein A [Escherichia coli MS 107-1]
          Length = 353

 Score = 86.0 bits (211), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 37/212 (17%), Positives = 69/212 (32%), Gaps = 28/212 (13%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K  +A+ V+         AQAA                     Y   +  ++  +   
Sbjct: 8   MKKTAIAIAVALA--GFATVAQAA---------------PKDNTWYTGAKLGWSQYHDT- 49

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGSL 120
              +  + G    +  G   F GY V            +       +    +    G  L
Sbjct: 50  --GFINNNGPTHENQLGAGAFGGYQVNPYVGFEMGYDWLGRMPYKGSVENGAYKAQGVQL 107

Query: 121 RIRGGYEVSDSLLLYATVGPDVAQKYE-TGKAGEITPIAIGGTAGVGVEVGGLSESLVAR 179
             + GY ++D L +Y  +G  V +    +   G+     +      GVE   ++  +  R
Sbjct: 108 TAKLGYPITDDLDIYTRLGGMVWRADTKSNVYGKNHDTGVSPVFAGGVEY-AITPEIATR 166

Query: 180 LEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
           LEY+ +        +    +   +SLGV  +F
Sbjct: 167 LEYQWTNNIGDAHTIGTRPDNGMLSLGVSYRF 198


>gi|240849917|ref|YP_002971306.1| hemin binding protein A [Bartonella grahamii as4aup]
 gi|240267040|gb|ACS50628.1| hemin binding protein A [Bartonella grahamii as4aup]
          Length = 296

 Score = 85.6 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 51/306 (16%), Positives = 84/306 (27%), Gaps = 111/306 (36%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M   +L +  S   L S  +AQAAD +         +               + G Y G 
Sbjct: 1   MNTKYL-IATSVATLISASAAQAADVMIPHEVAPAVIA--------AAPSFSWTGFYLGG 51

Query: 61  SALYNGSFGEE----------------AHHNAGGSIFAGYNVEDSC-IMYGVEGDVRYTV 103
                 S  +                 +     G I+AG NV+    ++ GVE D  +  
Sbjct: 52  QVGNFSSKTKVTIPGEERELFKKDNIPSPSGFMGGIYAGSNVDLGNGLILGVETDAVWAD 111

Query: 104 ----------------------------------------PVLADNIHSLHGIGGSLRIR 123
                                                     + +         G+ R+R
Sbjct: 112 REESKKARELTLTEKNAADFNAALEKAKVELKDQQQFQKDDKVTETHSYKEKWSGATRVR 171

Query: 124 GGYEVSDSLLLYATVGPDVAQKY-----------------------------------ET 148
            G+   D ++ Y   G   AQ                                       
Sbjct: 172 IGFAAVDRIMPYVAGGIAYAQVQGIQSVAGKGERAKVEQKAGGDEIVPEAGAKQSIDLTG 231

Query: 149 GKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFYNT---------ISL 199
           G   + T   +G T G GV+   ++++++ R EYR S + K +   +T           +
Sbjct: 232 GTWADDTKTMLGFTIGGGVDF-AMTDNVLLRAEYRYSDFGKKKFANDTREFNYKTNDFRV 290

Query: 200 GVGMKF 205
           GV  KF
Sbjct: 291 GVAYKF 296


>gi|170020642|ref|YP_001725596.1| outer membrane protein A [Escherichia coli ATCC 8739]
 gi|256023341|ref|ZP_05437206.1| outer membrane protein A [Escherichia sp. 4_1_40B]
 gi|307137587|ref|ZP_07496943.1| outer membrane protein A [Escherichia coli H736]
 gi|169755570|gb|ACA78269.1| OmpA domain protein transmembrane region-containing protein
           [Escherichia coli ATCC 8739]
 gi|320637825|gb|EFX07617.1| outer membrane protein A [Escherichia coli O157:H7 str. G5101]
 gi|320642950|gb|EFX12151.1| outer membrane protein A [Escherichia coli O157:H- str. 493-89]
 gi|320653723|gb|EFX21797.1| outer membrane protein A [Escherichia coli O55:H7 str. 3256-97 TW
           07815]
          Length = 365

 Score = 85.6 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 37/212 (17%), Positives = 69/212 (32%), Gaps = 28/212 (13%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K  +A+ V+         AQAA                     Y   +  ++  +   
Sbjct: 20  MKKTAIAIAVALA--GFATVAQAA---------------PKDNTWYTGAKLGWSQYHDT- 61

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGSL 120
              +  + G    +  G   F GY V            +       +    +    G  L
Sbjct: 62  --GFINNNGPTHENQLGAGAFGGYQVNPYVGFEMGYDWLGRMPYKGSVENGAYKAQGVQL 119

Query: 121 RIRGGYEVSDSLLLYATVGPDVAQKYE-TGKAGEITPIAIGGTAGVGVEVGGLSESLVAR 179
             + GY ++D L +Y  +G  V +    +   G+     +      GVE   ++  +  R
Sbjct: 120 TAKLGYPITDDLDIYTRLGGMVWRADTKSNVYGKNHDTGVSPVFAGGVEY-AITPEIATR 178

Query: 180 LEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
           LEY+ +        +    +   +SLGV  +F
Sbjct: 179 LEYQWTNNIGDAHTIGTRPDNGMLSLGVSYRF 210


>gi|300982950|ref|ZP_07176384.1| outer membrane protein A [Escherichia coli MS 200-1]
 gi|300307039|gb|EFJ61559.1| outer membrane protein A [Escherichia coli MS 200-1]
 gi|315296266|gb|EFU55573.1| outer membrane protein A [Escherichia coli MS 16-3]
 gi|324012909|gb|EGB82128.1| outer membrane protein A [Escherichia coli MS 60-1]
          Length = 354

 Score = 85.6 bits (210), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 37/212 (17%), Positives = 69/212 (32%), Gaps = 28/212 (13%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K  +A+ V+         AQAA                     Y   +  ++  +   
Sbjct: 9   MKKTAIAIAVALA--GFATVAQAA---------------PKDNTWYTGAKLGWSQYHDT- 50

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGSL 120
              +  + G    +  G   F GY V            +       +    +    G  L
Sbjct: 51  --GFINNNGPTHENQLGAGAFGGYQVNPYVGFEMGYDWLGRMPYKGSVENGAYKAQGVQL 108

Query: 121 RIRGGYEVSDSLLLYATVGPDVAQKYE-TGKAGEITPIAIGGTAGVGVEVGGLSESLVAR 179
             + GY ++D L +Y  +G  V +    +   G+     +      GVE   ++  +  R
Sbjct: 109 TAKLGYPITDDLDVYTRLGGMVWRADTKSNFDGKNHDTGVSPVFAGGVEY-AITPEIATR 167

Query: 180 LEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
           LEY+ +        +    +   +SLGV  +F
Sbjct: 168 LEYQWTNNIGDAHTIGTRPDNGMLSLGVSYRF 199


>gi|319408782|emb|CBI82439.1| Hemin binding protein c [Bartonella schoenbuchensis R1]
          Length = 275

 Score = 85.6 bits (210), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 48/284 (16%), Positives = 83/284 (29%), Gaps = 88/284 (30%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M   +L +  S   L +   AQA                ++     V     + G Y G 
Sbjct: 1   MNTKYL-ITASIFTLVASSVAQA------ESGRISQESMSVVLPNVVAPSFSWTGFYFGG 53

Query: 61  SALYNGSFGEEAHH---------------------NAGGSIFAGYNVEDSC-IMYGVEGD 98
                 S  +   +                        G ++AG N + +  ++ GV+ D
Sbjct: 54  QIGGFSSKTDLNLNLKGVGSTKLSSIEKDLLPKLSGFMGGLYAGANFDLNNSLVLGVDTD 113

Query: 99  VRYTVPVLAD---------------------------------------NIHSLHGIGGS 119
           V ++                                             +        G+
Sbjct: 114 VIWSDKKDTKVIRHSGYKTKDGGHGVQRQHHLQEAVSSDELLEKFIVTVSHTLKQKWAGA 173

Query: 120 LRIRGGYEVSDSLLLYATVGPDVAQKYE---------TGKAGEITPIAIGGTAGVGVEVG 170
            R+R G+ V D ++ Y   G    Q  +           K  + T   IG T G G++  
Sbjct: 174 TRMRVGFAV-DHIMPYIAGGVAYTQLQDILLVSTGIKKDKIVDETKAMIGYTFGGGIDFA 232

Query: 171 GLSESLVARLEYRASKYSK---------VEGFYNTISLGVGMKF 205
            +++ L+ R EYR S + K         ++   N   +GV  KF
Sbjct: 233 MMND-LILRAEYRFSNFGKKKFIKDKFEIDYKTNDFRVGVSYKF 275


>gi|296103033|ref|YP_003613179.1| putative outer membrane lipoprotein [Enterobacter cloacae subsp.
           cloacae ATCC 13047]
 gi|295057492|gb|ADF62230.1| putative outer membrane lipoprotein [Enterobacter cloacae subsp.
           cloacae ATCC 13047]
          Length = 359

 Score = 85.6 bits (210), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 38/213 (17%), Positives = 64/213 (30%), Gaps = 26/213 (12%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAG- 59
           M+K  +A+ V+         AQAA                     Y   +  ++  +   
Sbjct: 9   MKKTAIAIAVALA--GFATVAQAA---------------PKDNTWYAGGKLGWSQFHDTG 51

Query: 60  LSALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGS 119
                N + G       G   F GY V            +        +   +    G  
Sbjct: 52  WYNSANNNDGPTHESQLGAGAFGGYQVNPYVGFEMGYDWLGRMPYKGNETNGAFKAQGVQ 111

Query: 120 LRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEIT-PIAIGGTAGVGVEVGGLSESLVA 178
           L  + GY V+D L +Y  +G  V +   +           +      GVE   ++  +  
Sbjct: 112 LTAKLGYPVTDDLDVYTRLGGMVWRADSSNSNAGDDHDTGVSPVFAGGVE-WAMTRDIAT 170

Query: 179 RLEYRASK------YSKVEGFYNTISLGVGMKF 205
           RLEY+            V      +S+GV  +F
Sbjct: 171 RLEYQWVNNIGDGATVGVRPDNGMLSVGVSYRF 203


>gi|148559641|ref|YP_001259198.1| hypothetical protein BOV_1247 [Brucella ovis ATCC 25840]
 gi|46251263|gb|AAS84602.1| Omp22 [Brucella ovis]
 gi|148370898|gb|ABQ60877.1| putative membrane protein [Brucella ovis ATCC 25840]
          Length = 212

 Score = 85.6 bits (210), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 46/220 (20%), Positives = 79/220 (35%), Gaps = 26/220 (11%)

Query: 2   QKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLS 61
           ++   A  + +  +A   SA AAD + R  +           +      HD++G Y G  
Sbjct: 3   KRSITAAALGAAVMAFAGSAFAADMMGRTDYT--------YNDPVAAGPHDWSGNYVGTQ 54

Query: 62  ALYNGSFGEE---AHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVP--VLADNIHSLHGI 116
              + S       +   A G I  G N+++  I++G E +  +      +          
Sbjct: 55  VGGSSSKFPSPFASRTGALGGIVVGKNMQNGNIVFGAELEGNFAEAEHRIGHGGTLQQSW 114

Query: 117 GGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESL 176
            G+ + + GY   D  L+Y T G  V +               G   G GVE   LS  L
Sbjct: 115 NGNAKGKVGYAF-DKTLVYGTAGYGVTRFKAKDNTTSAPGWEGGVLIGAGVEQ-ALSGPL 172

Query: 177 VARLEYRASKYSKVEG-----------FYNTISLGVGMKF 205
             + EY   +++ V+              ++I  G+  KF
Sbjct: 173 SVKAEYDFQRFNDVKSQVNGIEQRNNLKNHSIKAGLNYKF 212


>gi|312270717|gb|ADQ55759.1| OmpA [Haemophilus parasuis]
          Length = 365

 Score = 85.6 bits (210), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 44/228 (19%), Positives = 84/228 (36%), Gaps = 31/228 (13%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATN-RYVPIRHDFNGPYAG 59
           M+K  +A+ VS LA+AS   A AA      + G +    T   +   +  ++  +  YA 
Sbjct: 1   MKKSLIALAVSGLAVASV--ANAAPQADSFYVGAKAGWATFHNDINQLNSKYKNDARYAT 58

Query: 60  LSALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGS 119
            +  Y         ++    +F GY + D+  +               +     H   G+
Sbjct: 59  SANGYG-----INRNSVTYGVFGGYQIIDNLAVELGYDYFGRVRGNKQEFREFKHSAHGT 113

Query: 120 -LRIRGGYEVSDSLLLYATVGPDVAQKYE-----TGKAGEITPIAIGGTAGVGVEVGGLS 173
            L ++  YEV + L +Y  VG  + +        T +  +   +      G GVE   + 
Sbjct: 114 HLSLKPSYEVLNGLDVYGKVGAALVRNDYKRYFQTREPVKSHNLKTSLIVGAGVEY-AIL 172

Query: 174 ESLVARLEYRAS----KYSKVEG------------FYNTISLGVGMKF 205
             L  R+EY+       ++K E               ++++ G+  +F
Sbjct: 173 PELAFRVEYQWLSNVGNFTKAEVKENRRATYNYSPDSHSVTAGISYRF 220


>gi|148256482|ref|YP_001241067.1| putative outer-membrane immunogenic protein [Bradyrhizobium sp.
           BTAi1]
 gi|146408655|gb|ABQ37161.1| putative outer-membrane immunogenic protein precursor
           [Bradyrhizobium sp. BTAi1]
          Length = 236

 Score = 85.6 bits (210), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 39/239 (16%), Positives = 71/239 (29%), Gaps = 46/239 (19%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+++FL+   +         A AAD   R +       P  A        +++ G Y G 
Sbjct: 1   MKRVFLS---AVALTVLAAPAFAADMPARTYTKAPVYTPPQA-------IYNWTGFYIGG 50

Query: 61  SALYNGSFGE---EAHHNAGGSIFAGYNVED-SCIMYGVEGDVRYTVPVLAD-------- 108
                 +        +    G +  G++ +     + G+E    +      +        
Sbjct: 51  HLGGAFAGNNSLEGNNGRFLGGVQGGFDYQFAPNWVLGIEAQYSWMDRNTTNFGFPGATV 110

Query: 109 NIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKY--------ETGKAGEITPIAIG 160
              +     GS+  R GY    +LL YA  G                            G
Sbjct: 111 VSSTGANQLGSVTGRLGYTWGPALL-YAKGGYAWRDGNALGVNVAGVPAGFTTSGNTKDG 169

Query: 161 GTAGVGVEVGGLSESLVARLEYRASKYSKV--------------EGFYNTISLGVGMKF 205
            T G G+E    + +  A+ EY+   +                     +T+ +GV  +F
Sbjct: 170 YTVGGGLEY-MFAPNWSAKAEYQYYNFGNTTFTGGPAPVVGSRFNSDEHTVKVGVNYRF 227


>gi|315287600|gb|EFU47006.1| outer membrane protein A [Escherichia coli MS 110-3]
          Length = 354

 Score = 85.6 bits (210), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 37/212 (17%), Positives = 69/212 (32%), Gaps = 28/212 (13%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K  +A+ V+         AQAA                     Y   +  ++  +   
Sbjct: 9   MKKTAIAIAVALA--GFATVAQAA---------------PKDNTWYTGAKLGWSQYHDT- 50

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGSL 120
              +  + G    +  G   F GY V            +       +    +    G  L
Sbjct: 51  --GFINNNGPTHENQLGAGAFGGYQVNPYVGFEMGYDWLGRMPYKGSVENGAYKAQGVQL 108

Query: 121 RIRGGYEVSDSLLLYATVGPDVAQKYE-TGKAGEITPIAIGGTAGVGVEVGGLSESLVAR 179
             + GY ++D L +Y  +G  V +    +   G+     +      GVE   ++  +  R
Sbjct: 109 TAKLGYPITDDLDVYTRLGGMVWRADTKSNVYGKNHDTGVSPVFAGGVEY-AITPEIATR 167

Query: 180 LEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
           LEY+ +        +    +   +SLGV  +F
Sbjct: 168 LEYQWTNNIGDAHTIGTRPDNGMLSLGVSYRF 199


>gi|158536383|gb|ABW72716.1| outer membrane protein A [Escherichia coli]
          Length = 354

 Score = 85.6 bits (210), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 37/212 (17%), Positives = 69/212 (32%), Gaps = 28/212 (13%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K  +A+ V+         AQAA                     Y   +  ++  +   
Sbjct: 9   MKKTAIAIAVALA--GFATVAQAA---------------PKDNTWYTGAKLGWSQYHDT- 50

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGSL 120
              +  + G    +  G   F GY V            +       +    +    G  L
Sbjct: 51  --GFINNNGPTHENQLGAGAFGGYQVNPYVGFEMGYDWLGRMPYKGSVENGAYKAQGVQL 108

Query: 121 RIRGGYEVSDSLLLYATVGPDVAQKYE-TGKAGEITPIAIGGTAGVGVEVGGLSESLVAR 179
             + GY ++D L +Y  +G  V +    +   G+     +      GVE   ++  +  R
Sbjct: 109 TAKLGYPITDDLDVYTRLGGMVWRADTKSNFDGKNHDTGVSPVFAGGVEY-AITPEIATR 167

Query: 180 LEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
           LEY+ +        +    +   +SLGV  +F
Sbjct: 168 LEYQWTNNIGDAHTIGTRPDNGMLSLGVSYRF 199


>gi|283484404|gb|ADB23432.1| OmpA [Cronobacter sakazakii]
          Length = 347

 Score = 85.2 bits (209), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 38/212 (17%), Positives = 65/212 (30%), Gaps = 28/212 (13%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K  +A+ V+         AQAA                     Y   +  ++  +   
Sbjct: 1   MKKTAIAIAVALA--GFATVAQAA---------------PKDNTWYAGGKLGWSQFHDT- 42

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGSL 120
              +  + G       G   F GY V            +            +    G  L
Sbjct: 43  --GFIPNDGPTHESQLGAGAFGGYQVNPYVGFEMGYDWLGRMPYKGDTVNGAFKAQGVQL 100

Query: 121 RIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEIT-PIAIGGTAGVGVEVGGLSESLVAR 179
             + GY V+D L +Y  +G  V +   +   G       +      GVE   ++  +  R
Sbjct: 101 TAKLGYPVTDDLDVYTRLGGMVWRADSSSNIGGDDHDTGVSPVFAGGVE-WAMTRDIATR 159

Query: 180 LEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
           LEY+          V    +   +S+GV  +F
Sbjct: 160 LEYQWVNNIGDAQTVGARPDNGMLSVGVSYRF 191


>gi|121602865|ref|YP_989466.1| omp25/ropB family outer membrane protein [Bartonella bacilliformis
           KC583]
 gi|120615042|gb|ABM45643.1| outer membrane protein, omp25/ropB family [Bartonella bacilliformis
           KC583]
          Length = 300

 Score = 85.2 bits (209), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 46/297 (15%), Positives = 84/297 (28%), Gaps = 100/297 (33%)

Query: 7   AVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRY--VPIRHDFNGPYAGLSAL- 63
            V  S  AL S  +AQAAD +           PT +             +G +   +   
Sbjct: 6   LVTASVCALISASAAQAADVMIPQEISPIISAPTFSWTGLYLGGQIGGLSGKHDFKAIGK 65

Query: 64  ---YNGSFGEEAHHNAGGSIFAGYNVEDSC-IMYGVEGDVRYTVPVL------------- 106
              +  +  +       G ++AG N++    ++ GV+ D+ +                  
Sbjct: 66  DSEWPFANKDLKVSGFVGGLYAGSNIDLGSGLVLGVDTDIVWVDKEGKLSSNHKAETQDD 125

Query: 107 -----------------------ADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVA 143
                                    N        G+ R+R G+  +D ++ Y + G    
Sbjct: 126 ADAFKQIFDENKIEVAKGQIKELTQNFSLKEKWAGATRVRIGFG-ADRIMPYVSGGVAYT 184

Query: 144 QKYE----------------------------------------------TGKAGEITPI 157
           Q                                                 +G   +    
Sbjct: 185 QVQAIGSAILKGTKDTGTEGGGGTEGGGGTEGGGGSASKAVRSEALDVLASGTITDEKKT 244

Query: 158 AIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEG---------FYNTISLGVGMKF 205
            +G T G GV+   ++++++ R EYR S + K +            N   +GV  KF
Sbjct: 245 LLGYTLGAGVDF-AMTDNVILRTEYRYSDFGKKKFVKDAIETNYKTNDFRVGVAYKF 300


>gi|300896337|ref|ZP_07114879.1| outer membrane protein A [Escherichia coli MS 198-1]
 gi|300359748|gb|EFJ75618.1| outer membrane protein A [Escherichia coli MS 198-1]
          Length = 354

 Score = 85.2 bits (209), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 36/212 (16%), Positives = 68/212 (32%), Gaps = 28/212 (13%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K   A+ ++         AQAA                     Y   +  ++  +   
Sbjct: 9   MKKT--AIAIAVALAGFATVAQAA---------------PKDNTWYTGAKLGWSQYHDT- 50

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGSL 120
              +  + G    +  G   F GY V            +       +    +    G  L
Sbjct: 51  --GFINNNGPTHENQLGAGAFGGYQVNPYVGFEMGYDWLGRMPYKGSVENGAYKAQGVQL 108

Query: 121 RIRGGYEVSDSLLLYATVGPDVAQKYE-TGKAGEITPIAIGGTAGVGVEVGGLSESLVAR 179
             + GY ++D L +Y  +G  V +    +   G+     +      GVE   ++  +  R
Sbjct: 109 TAKLGYPITDDLDVYTRLGGMVWRADTKSNVYGKNHDTGVSPVFAGGVEY-AITPEIATR 167

Query: 180 LEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
           LEY+ +        +    +   +SLGV  +F
Sbjct: 168 LEYQWTNNIGDAHTIGTRPDNGMLSLGVSYRF 199


>gi|189010293|ref|ZP_02805910.2| outer membrane protein A [Escherichia coli O157:H7 str. EC4076]
 gi|208815928|ref|ZP_03257107.1| outer membrane protein A [Escherichia coli O157:H7 str. EC4045]
 gi|208822372|ref|ZP_03262691.1| outer membrane protein A [Escherichia coli O157:H7 str. EC4042]
 gi|209397392|ref|YP_002269625.1| outer membrane protein A [Escherichia coli O157:H7 str. EC4115]
 gi|217325746|ref|ZP_03441830.1| outer membrane protein A [Escherichia coli O157:H7 str. TW14588]
 gi|291281957|ref|YP_003498775.1| OmpA domain protein transmembrane region-containing protein
           precursor [Escherichia coli O55:H7 str. CB9615]
 gi|293433254|ref|ZP_06661682.1| OOP family OmpA-OmpF porin [Escherichia coli B088]
 gi|300929657|ref|ZP_07145117.1| outer membrane protein A [Escherichia coli MS 187-1]
 gi|300949672|ref|ZP_07163655.1| outer membrane protein A [Escherichia coli MS 116-1]
 gi|300955388|ref|ZP_07167765.1| outer membrane protein A [Escherichia coli MS 175-1]
 gi|301022508|ref|ZP_07186383.1| outer membrane protein A [Escherichia coli MS 196-1]
 gi|301643481|ref|ZP_07243528.1| outer membrane protein A [Escherichia coli MS 146-1]
 gi|189001311|gb|EDU70297.1| outer membrane protein A [Escherichia coli O157:H7 str. EC4076]
 gi|208732576|gb|EDZ81264.1| outer membrane protein A [Escherichia coli O157:H7 str. EC4045]
 gi|208737857|gb|EDZ85540.1| outer membrane protein A [Escherichia coli O157:H7 str. EC4042]
 gi|209158792|gb|ACI36225.1| outer membrane protein A [Escherichia coli O157:H7 str. EC4115]
 gi|217321967|gb|EEC30391.1| outer membrane protein A [Escherichia coli O157:H7 str. TW14588]
 gi|290761830|gb|ADD55791.1| OmpA domain protein transmembrane region-containing protein
           precursor [Escherichia coli O55:H7 str. CB9615]
 gi|291324073|gb|EFE63495.1| OOP family OmpA-OmpF porin [Escherichia coli B088]
 gi|299881205|gb|EFI89416.1| outer membrane protein A [Escherichia coli MS 196-1]
 gi|300317723|gb|EFJ67507.1| outer membrane protein A [Escherichia coli MS 175-1]
 gi|300450941|gb|EFK14561.1| outer membrane protein A [Escherichia coli MS 116-1]
 gi|300462395|gb|EFK25888.1| outer membrane protein A [Escherichia coli MS 187-1]
 gi|301078120|gb|EFK92926.1| outer membrane protein A [Escherichia coli MS 146-1]
 gi|320187167|gb|EFW61868.1| Outer membrane protein A precursor [Shigella flexneri CDC 796-83]
 gi|324019104|gb|EGB88323.1| outer membrane protein A [Escherichia coli MS 117-3]
 gi|326338147|gb|EGD61976.1| Outer membrane protein A precursor [Escherichia coli O157:H7 str.
           1125]
          Length = 354

 Score = 85.2 bits (209), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 37/212 (17%), Positives = 69/212 (32%), Gaps = 28/212 (13%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K  +A+ V+         AQAA                     Y   +  ++  +   
Sbjct: 9   MKKTAIAIAVALA--GFATVAQAA---------------PKDNTWYTGAKLGWSQYHDT- 50

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGSL 120
              +  + G    +  G   F GY V            +       +    +    G  L
Sbjct: 51  --GFINNNGPTHENQLGAGAFGGYQVNPYVGFEMGYDWLGRMPYKGSVENGAYKAQGVQL 108

Query: 121 RIRGGYEVSDSLLLYATVGPDVAQKYE-TGKAGEITPIAIGGTAGVGVEVGGLSESLVAR 179
             + GY ++D L +Y  +G  V +    +   G+     +      GVE   ++  +  R
Sbjct: 109 TAKLGYPITDDLDIYTRLGGMVWRADTKSNVYGKNHDTGVSPVFAGGVEY-AITPEIATR 167

Query: 180 LEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
           LEY+ +        +    +   +SLGV  +F
Sbjct: 168 LEYQWTNNIGDAHTIGTRPDNGMLSLGVSYRF 199


>gi|161503852|ref|YP_001570964.1| outer membrane protein A [Salmonella enterica subsp. arizonae
           serovar 62:z4,z23:-- str. RSK2980]
 gi|160865199|gb|ABX21822.1| hypothetical protein SARI_01940 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 358

 Score = 85.2 bits (209), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 36/219 (16%), Positives = 70/219 (31%), Gaps = 38/219 (17%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K  +A+ V+         AQAA                     Y   +  ++  +   
Sbjct: 9   MKKTAIAIAVALA--GFATVAQAA---------------PKDNTWYTGAKLGWSQYHDT- 50

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGG-- 118
              +  + G    +  G   F GY V       G E    +   +     +         
Sbjct: 51  --GFIPNNGPTHENQLGAGAFGGYQV---NPYVGFEMGYDWLGRMPYKGDNINGAYKAQG 105

Query: 119 -SLRIRGGYEVSDSLLLYATVGPDVAQKYET-----GKAGEITPIAIGGTAGVGVEVGGL 172
             L  + GY ++D L +Y  +G  V +         G + +     +      G+E   +
Sbjct: 106 VQLTAKLGYPITDDLDVYTRLGGMVWRADTKSNTPGGASYKDHDTGVSPVFAGGIEY-AI 164

Query: 173 SESLVARLEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
           +  +  RLEY+ +        +    +   +S+GV  +F
Sbjct: 165 TPEIATRLEYQWTNNIGDAHTIGTRPDNGLLSVGVSYRF 203


>gi|217977075|ref|YP_002361222.1| porin [Methylocella silvestris BL2]
 gi|217502451|gb|ACK49860.1| porin [Methylocella silvestris BL2]
          Length = 255

 Score = 85.2 bits (209), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 56/255 (21%), Positives = 84/255 (32%), Gaps = 63/255 (24%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M +  L   V ++ALA   +A AAD   RA                      + G Y G 
Sbjct: 1   MLRRVLLASVGAIALAG--TALAADLPSRA---------PPPVYVPPAPIFTWTGVYIGG 49

Query: 61  SALYNGSFGE--------------EAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVL 106
              Y    G                + +   G    GYN++ +  + G+EG V  T    
Sbjct: 50  QIGYAWGNGSANFGDANGNFVNFGNSGNGVIGGAHVGYNLQLNQFVVGLEGSVDGTSLSK 109

Query: 107 A--------------DNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYET---- 148
                           N+H+   I GS+R R GY   D +L+YAT G   A    +    
Sbjct: 110 TYSGTAFVPGFGVAGINLHTSADIQGSIRGRVGYAW-DRVLVYATGGVAFAGVKASLSTP 168

Query: 149 GKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKV------------------ 190
                 +   +G T G G+E   ++ +   R EYR S +                     
Sbjct: 169 FSYDSSSTTKVGWTVGGGLEY-AVTNNWSIRAEYRYSNFGNATLYPASLAGVDAGPFVNR 227

Query: 191 EGFYNTISLGVGMKF 205
           +   N + +G   KF
Sbjct: 228 KFNINQVQVGFSYKF 242


>gi|304397112|ref|ZP_07378991.1| OmpA domain protein transmembrane region-containing protein
           [Pantoea sp. aB]
 gi|304355261|gb|EFM19629.1| OmpA domain protein transmembrane region-containing protein
           [Pantoea sp. aB]
          Length = 356

 Score = 84.8 bits (208), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 36/218 (16%), Positives = 64/218 (29%), Gaps = 31/218 (14%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K   A+ ++         AQAA                     Y   +  ++  +   
Sbjct: 1   MKKT--AIAIAVALAGFATVAQAA---------------PKDNTWYTGAKLGWSQYHDTG 43

Query: 61  SALYNG--SFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGG 118
              +    + G       G   F GY              +            +    G 
Sbjct: 44  YYGHGYENNDGPTHESQLGAGAFVGYQANPYLGFEMGYDWLGRMPNKGNVTNGAFKAQGV 103

Query: 119 SLRIRGGYEVSDSLLLYATVGPDVAQKYE-----TGKAGEITPIAIGGTAGVGVEVGGLS 173
            L  +  Y ++D L +Y  +G  V +        T          +   A VGVE   L+
Sbjct: 104 QLAAKLSYPINDDLDVYTRLGGMVWRADATQTNQTTGRISDHDTGVSPLAAVGVEY-ALT 162

Query: 174 ESLVARLEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
           ++   RL+Y+          V    +   +S+GV  +F
Sbjct: 163 QNWATRLDYQWVNNIGDAQTVGARPDNGMLSVGVSYRF 200


>gi|76885942|gb|ABA60112.1| pap31-like protein [Bartonella bacilliformis]
          Length = 300

 Score = 84.8 bits (208), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 46/297 (15%), Positives = 84/297 (28%), Gaps = 100/297 (33%)

Query: 7   AVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRY--VPIRHDFNGPYAGLSAL- 63
            V  S  AL S  +AQAAD +           PT +             +G +   +   
Sbjct: 6   LVTASVCALISASAAQAADVMIPQEISPIISAPTFSWTGLYLGGQIGGLSGKHDFKAIGK 65

Query: 64  ---YNGSFGEEAHHNAGGSIFAGYNVEDSC-IMYGVEGDVRYTVPVL------------- 106
              +  +  +       G ++AG N++    ++ GV+ D+ +                  
Sbjct: 66  DSEWPFANKDLKVSGFVGGLYAGSNIDLGSGLVLGVDTDIVWVDKEGKLFSNHRAETQDD 125

Query: 107 -----------------------ADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVA 143
                                    N        G+ R+R G+  +D ++ Y + G    
Sbjct: 126 ADAFKQIFDENKIEVAKGQIKELTQNFSLKEKWAGATRVRIGFG-ADRIMPYVSGGVAYT 184

Query: 144 QKYE----------------------------------------------TGKAGEITPI 157
           Q                                                 +G   +    
Sbjct: 185 QVQAIGSAILKGTKDTGTEGGGGTEGGGGTEGGGGSASKAVRSEALDVLASGTITDEKKT 244

Query: 158 AIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEG---------FYNTISLGVGMKF 205
            +G T G GV+   ++++++ R EYR S + K +            N   +GV  KF
Sbjct: 245 LLGYTLGAGVDF-AMTDNVILRTEYRYSDFGKKKFVKDAIETNYKTNDFRVGVAYKF 300


>gi|115522754|ref|YP_779665.1| porin [Rhodopseudomonas palustris BisA53]
 gi|115516701|gb|ABJ04685.1| porin [Rhodopseudomonas palustris BisA53]
          Length = 446

 Score = 84.8 bits (208), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 42/237 (17%), Positives = 71/237 (29%), Gaps = 39/237 (16%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+++   V +    + +  SAQAAD   +A +    +V       +    +   G    L
Sbjct: 1   MKRILAGVAL----VGTAVSAQAADLAVKAPYLKAPIVAVYDWTGFYIGVNAGVGLGRDL 56

Query: 61  SAL----YNGSFGEEAHHNAGGSIFAGYNVEDSCI----MYGVEGDVRYTVPVLADN--- 109
           +         +        A G    GYN + +      + G+E D++ T          
Sbjct: 57  ATHNITPAAFATTYLQPQGALGGGQVGYNWQTNSFLGPLVLGLEADIQGTGMSDDRTNLF 116

Query: 110 -----IHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITP----IAIG 160
                        G+ R R G      +L Y T G        T   G  +        G
Sbjct: 117 GNVAAYSQKLDWFGTARGRIGLAKGP-VLSYFTGGFAYGNVKTTVTEGLASDSINRTQTG 175

Query: 161 GTAGVGVEVGGLSESLVARLEYRASKYSKVE-------------GFYNTISLGVGMK 204
            T G GVE   L  +   ++EY        +                N   +G+  +
Sbjct: 176 WTIGSGVE-AALGGNWTGKIEYLYVNLGNKDDVLFLGTQPIRTEIRENIFRVGLNYR 231



 Score = 84.1 bits (206), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 35/201 (17%), Positives = 57/201 (28%), Gaps = 42/201 (20%)

Query: 46  YVPIRHDFNGPYAGLSALYNGSFG------------EEAHHNAGGSIFAGYNVEDSCIMY 93
                 ++ G Y G +     +                A     G    GYN + +  ++
Sbjct: 239 APAPVANWAGFYLGGNFGSGTARERTTATRVATEQFNLAPDGFIGGGQIGYNWQAANWVF 298

Query: 94  GVEGDVRYTVPVLA--------DNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQK 145
           G E D + +             D+  +      ++R R GY V  S L Y T G  V   
Sbjct: 299 GGEADFQGSTQRDNRTIVQGGVDSYDAKLPWLATVRGRLGYSVG-STLFYGTGGYAVGSV 357

Query: 146 YET----GKAGEITPIAIGGTAGVGVE-----VGGLSESLVARLEYRASKYSKVEGFY-- 194
             +          T    G TAG G+E           +  ++ EY       V   +  
Sbjct: 358 KTSIATPAFTETFTKTKSGWTAGAGIETPFTLFNLFGPNWTSKTEYLYVDLGSVNNTFAS 417

Query: 195 ----------NTISLGVGMKF 205
                     +    G+   F
Sbjct: 418 GLVTSSKVTEHVFRTGINYHF 438


>gi|90424253|ref|YP_532623.1| putative outer membrane protein [Rhodopseudomonas palustris BisB18]
 gi|90106267|gb|ABD88304.1| putative outer membrane protein [Rhodopseudomonas palustris BisB18]
          Length = 247

 Score = 84.8 bits (208), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 45/224 (20%), Positives = 71/224 (31%), Gaps = 40/224 (17%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K  L   V  +AL     A AAD   R +              YV   +D++G Y G 
Sbjct: 1   MKKFLLG-TVGVVALGLAAPAVAADLPARTYTKAPA---------YVAAVYDWSGFYIGA 50

Query: 61  SALYNGSF------------GEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVL-- 106
           +A +  S             G      A      GY  +    ++G+E    +       
Sbjct: 51  NAGWGNSRDSRFDETFGLDLGAHDADGAVAGGQIGYRWQTGTWVFGLEAQGDWADLSGNH 110

Query: 107 ------ADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEIT----- 155
                  + + S     G    + GY  +++LL Y   G  V  +               
Sbjct: 111 LNPLVFDNRLSSKTDAFGLFTGQIGYAWNNALL-YVKGGAAVTDRKYDFTVDSTGAPISS 169

Query: 156 ---PIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFYNT 196
                   GT GVG+E G  + +    +EY     S+    + T
Sbjct: 170 TGYKTRWSGTVGVGLEYGF-APNWSFGVEYDHIFESRYTVAFTT 212


>gi|307132015|ref|YP_003884031.1| outer membrane protein A (3a;II*;G;d) [Dickeya dadantii 3937]
 gi|306529544|gb|ADM99474.1| outer membrane protein A (3a;II*;G;d) [Dickeya dadantii 3937]
          Length = 353

 Score = 84.8 bits (208), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 41/214 (19%), Positives = 73/214 (34%), Gaps = 30/214 (14%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K  +A+ V+         AQAA                     Y   +  ++  +   
Sbjct: 1   MKKTAIAIAVALA--GFATVAQAA---------------PNDNTWYAGAKLGWSQYHDTG 43

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLH--GIGG 118
                 +    A +  G   F GY V       G E    +   +  +  +       G 
Sbjct: 44  LTGNGYNVTNAAQNQLGAGAFGGYQV---NPYLGFEMGYDWLGRMKYNGGNQGSFKAQGV 100

Query: 119 SLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAG-EITPIAIGGTAGVGVEVGGLSESLV 177
            L  +  Y + D L +Y  +G  V++      +G       +   A VGVE   ++++  
Sbjct: 101 QLSAKLSYPIVDDLDIYTRLGGFVSRTDSHDNSGLNDHDTGVSPLAAVGVEY-AITKNWA 159

Query: 178 ARLEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
            RL+Y+        S V G  +   +S+GV  +F
Sbjct: 160 TRLDYQWVNNIGDASTVGGRPDNGLLSVGVSYRF 193


>gi|218548466|ref|YP_002382257.1| outer membrane protein A [Escherichia fergusonii ATCC 35469]
 gi|218356007|emb|CAQ88623.1| outer membrane protein A (3a;II*;G;d) [Escherichia fergusonii ATCC
           35469]
          Length = 375

 Score = 84.8 bits (208), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 38/217 (17%), Positives = 72/217 (33%), Gaps = 33/217 (15%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K  +A+ V+         AQAA                     Y   +  ++  +   
Sbjct: 25  MKKTAIAIAVALA--GFATVAQAA---------------PKDNTWYTGAKLGWSQYHDT- 66

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGSL 120
              +  + G    +  G   F GY V            +       +    +    G  L
Sbjct: 67  --GFIDNNGPTHENQLGAGAFGGYQVNPYVGFEMGYDWLGRMPYKGSVENGAYKAQGVQL 124

Query: 121 RIRGGYEVSDSLLLYATVGPDVAQKYE------TGKAGEITPIAIGGTAGVGVEVGGLSE 174
             + GY ++D L +Y  +G  V +         TG++ +     +      GVE   ++ 
Sbjct: 125 TAKLGYPITDDLDIYTRLGGMVWRADTKAHNNVTGESEKNHDTGVSPVFAGGVE-WAITP 183

Query: 175 SLVARLEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
            +  RLEY+ +      + +    +   +SLGV  +F
Sbjct: 184 EIATRLEYQWTNNIGDANTIGTRPDNGLLSLGVSYRF 220


>gi|209968926|gb|ACJ02824.1| outer membrane protein P5 [Haemophilus parasuis]
 gi|224714285|gb|ACN62137.1| outer membrane protein A [Haemophilus parasuis]
          Length = 365

 Score = 84.8 bits (208), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 44/228 (19%), Positives = 84/228 (36%), Gaps = 31/228 (13%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATN-RYVPIRHDFNGPYAG 59
           M+K  +A+ VS LA+AS   AQAA      + G +    T   +   +  ++  +  Y  
Sbjct: 1   MKKSLIALAVSGLAVASV--AQAAPQANTFYVGAKAGWATFHNDINQIDSKYANDARYDA 58

Query: 60  LSALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGS 119
            +  Y       + ++    +F GY + D+  +               +     H   G+
Sbjct: 59  TNLKYG-----ISRNSVTYGVFGGYQIIDNLAVELGYDYFGRVRGNKQEFREFKHSAHGT 113

Query: 120 -LRIRGGYEVSDSLLLYATVGPD-----VAQKYETGKAGEITPIAIGGTAGVGVEVGGLS 173
            L ++  YEV + L +Y  VG         +   T +  +   +      G GVE   + 
Sbjct: 114 HLSLKPSYEVLNGLDVYGKVGAALVRNDYKRYSTTIEPVKSHNLKTSLIVGAGVEY-AIL 172

Query: 174 ESLVARLEYRAS----KYSKVEG------------FYNTISLGVGMKF 205
             L  R+EY+       ++K E               ++++ G+  +F
Sbjct: 173 PELAFRVEYQWLSNVGNFTKAEAKENRRATYNYSPDSHSVTAGISYRF 220


>gi|218553544|ref|YP_002386457.1| outer membrane protein A [Escherichia coli IAI1]
 gi|331676747|ref|ZP_08377443.1| outer membrane protein A [Escherichia coli H591]
 gi|218360312|emb|CAQ97862.1| outer membrane protein A (3a;II*;G;d) [Escherichia coli IAI1]
 gi|331075436|gb|EGI46734.1| outer membrane protein A [Escherichia coli H591]
          Length = 374

 Score = 84.8 bits (208), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 38/219 (17%), Positives = 71/219 (32%), Gaps = 38/219 (17%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K  +A+ V+         AQAA                     Y   +  ++  +   
Sbjct: 25  MKKTAIAIAVALA--GFATVAQAA---------------PKDNTWYTGAKLGWSQYHDT- 66

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGG-- 118
              +  + G    +  G   F GY V       G E    +   +     +         
Sbjct: 67  --GFIPNNGPTHENQLGAGAFGGYQV---NPYVGFEMGYDWLGRMPYKGDNINGAYKAQG 121

Query: 119 -SLRIRGGYEVSDSLLLYATVGPDVAQKYET-----GKAGEITPIAIGGTAGVGVEVGGL 172
             L  + GY ++D L +Y  +G  V +         G + +     +      GVE   +
Sbjct: 122 VQLTAKLGYPITDDLDVYTRLGGMVWRADTKANVPGGASFKDHDTGVSPVFAGGVEY-AI 180

Query: 173 SESLVARLEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
           +  +  RLEY+ +      + +    +   +SLGV  +F
Sbjct: 181 TPEIATRLEYQWTNNIGDANTIGTRPDNGLLSLGVSYRF 219


>gi|327393374|dbj|BAK10796.1| outer membrane protein A precursor OmpA [Pantoea ananatis AJ13355]
          Length = 363

 Score = 84.8 bits (208), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 42/222 (18%), Positives = 69/222 (31%), Gaps = 38/222 (17%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K  +A+ V+         AQAA                     Y   +  ++  +   
Sbjct: 7   MKKTAIAIAVALA--GFATVAQAA---------------PKDNTWYTGAKLGWSQYHDTG 49

Query: 61  SAL--YNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGG 118
                Y  + G       G   FAGY    +    G E    +   +             
Sbjct: 50  YYGHNYQNNDGPTHESQLGAGAFAGYQ---ANPYLGFELGYDWLGRMPNKGNQINGAFKA 106

Query: 119 ---SLRIRGGYEVSDSLLLYATVGPDVAQKYE------TGKAGEITPIAIGGTAGVGVEV 169
               L  +  Y ++D L +Y  +G  V +         TG         +   A VGVE 
Sbjct: 107 QGIQLAAKLSYPIADDLDIYTRLGGMVWRADSTQQNLATGTRISDHDTGVSPLAAVGVEY 166

Query: 170 GGLSESLVARLEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
             L+++   RL+Y+          V    +   +SLGV  +F
Sbjct: 167 -ALTKNWATRLDYQWVNNIGDAQTVGARPDNGMLSLGVSYRF 207


>gi|170769190|ref|ZP_02903643.1| outer membrane protein A [Escherichia albertii TW07627]
 gi|170121842|gb|EDS90773.1| outer membrane protein A [Escherichia albertii TW07627]
          Length = 358

 Score = 84.8 bits (208), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 37/219 (16%), Positives = 69/219 (31%), Gaps = 38/219 (17%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K   A+ ++         AQAA                     Y   +  ++  +   
Sbjct: 9   MKKT--AIAIAVALAGFATVAQAA---------------PKDNTWYTGAKLGWSQFHDT- 50

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGG-- 118
              +  + G    +  G   F GY V       G E    +   +     +         
Sbjct: 51  --GFIDNNGPTHENQLGAGAFGGYQV---NPYVGFEMGYDWLGRMPYKGDNINGAYKAQG 105

Query: 119 -SLRIRGGYEVSDSLLLYATVGPDVAQKYET-----GKAGEITPIAIGGTAGVGVEVGGL 172
             L  + GY ++D L +Y  +G  V +         G + +     +      GVE   +
Sbjct: 106 VQLTAKLGYPITDDLDVYTRLGGMVWRADTKANVPGGASFKDHDTGVSPVFAGGVEY-AI 164

Query: 173 SESLVARLEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
           +  +  RLEY+ +        +    +   +SLGV  +F
Sbjct: 165 TPEIATRLEYQWTNNIGDAHTIGTRPDNGLLSLGVSYRF 203


>gi|299773231|gb|ADJ38690.1| outer membrane protein P5 [Haemophilus parasuis]
          Length = 370

 Score = 84.8 bits (208), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 41/228 (17%), Positives = 82/228 (35%), Gaps = 29/228 (12%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATN-RYVPIRHDFNGPYAG 59
           M+K  +A+ VS  ++ S  S+ AA      + G +    T   +   +  ++  +  YA 
Sbjct: 1   MKKSLIALAVSVSSVRSCISSNAAPQADSFYVGAKAGWATFHNDINQLNSKYKNDARYAT 60

Query: 60  LSALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGS 119
            +  Y         ++    +F GY + D+  +               +     H   G+
Sbjct: 61  SANGYG-----INRNSVTYGVFGGYQIIDNLAVELGYDYFGRVRGNKQEFREFKHSAHGT 115

Query: 120 -LRIRGGYEVSDSLLLYATVGPDVAQKYE-----TGKAGEITPIAIGGTAGVGVEVGGLS 173
            L ++  YEV   L +Y  VG  + +        T +  +   +      G GVE   + 
Sbjct: 116 HLSLKPSYEVLSGLDVYGKVGAALVRNDYKRYFQTREPVKSHNLKTSLIVGAGVEY-AIL 174

Query: 174 ESLVARLEYRAS----KYSKVEG------------FYNTISLGVGMKF 205
             L  R+EY+       ++K E               ++++ G+  +F
Sbjct: 175 PELAFRVEYQWLSNVGNFTKAEMKENRRATYNYSPDSHSVTAGISYRF 222


>gi|110641146|ref|YP_668876.1| outer membrane protein A [Escherichia coli 536]
 gi|331657022|ref|ZP_08357984.1| outer membrane protein A [Escherichia coli TA206]
 gi|110342738|gb|ABG68975.1| outer membrane protein A [Escherichia coli 536]
 gi|222032681|emb|CAP75420.1| Outer membrane protein A [Escherichia coli LF82]
 gi|331055270|gb|EGI27279.1| outer membrane protein A [Escherichia coli TA206]
          Length = 346

 Score = 84.8 bits (208), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 36/212 (16%), Positives = 68/212 (32%), Gaps = 28/212 (13%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K   A+ ++         AQAA                     Y   +  ++  +   
Sbjct: 1   MKKT--AIAIAVALAGFATVAQAA---------------PKDNTWYTGAKLGWSQYHDT- 42

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGSL 120
              +  + G    +  G   F GY V            +       +    +    G  L
Sbjct: 43  --GFINNNGPTHENQLGAGAFGGYQVNPYVGFEMGYDWLGRMPYKGSVENGAYKAQGVQL 100

Query: 121 RIRGGYEVSDSLLLYATVGPDVAQKYE-TGKAGEITPIAIGGTAGVGVEVGGLSESLVAR 179
             + GY ++D L +Y  +G  V +    +   G+     +      GVE   ++  +  R
Sbjct: 101 TAKLGYPITDDLDVYTRLGGMVWRADTKSNFDGKNHDTGVSPVFAGGVEY-AITPEIATR 159

Query: 180 LEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
           LEY+ +        +    +   +SLGV  +F
Sbjct: 160 LEYQWTNNIGDAHTIGTRPDNGMLSLGVSYRF 191


>gi|91975275|ref|YP_567934.1| putative outer membrane protein [Rhodopseudomonas palustris BisB5]
 gi|91681731|gb|ABE38033.1| putative outer membrane protein [Rhodopseudomonas palustris BisB5]
          Length = 454

 Score = 84.8 bits (208), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 36/215 (16%), Positives = 58/215 (26%), Gaps = 36/215 (16%)

Query: 26  PVRRAHHGGRGVVPTIATNRYVPIRHDFNGP-----YAGLSALYNGSFGEEAHHNAGGSI 80
              R    G  + P  A    + I  +F G          +          +     G  
Sbjct: 233 LNYRIGGTGAYIAPPPANWAGLYIGGNFGGSATARNRTTATIGGFTEQFNLSPEGFIGGG 292

Query: 81  FAGYNVEDSCIMYGVEGDVRYTVPVLADN--------IHSLHGIGGSLRIRGGYEVSDSL 132
             GYN + +  ++G E D + +                +      G+ R R GY V  +L
Sbjct: 293 QIGYNWQAANWVFGAEADFQGSTQKDDRTAVFGSTVAYNQKLPWFGTARARLGYSVGSTL 352

Query: 133 LLYATVGPDVAQKYETGKAGEITPI----AIGGTAGVGVEVGG-----LSESLVARLEYR 183
           L YAT G                        G   G GVE+       L  +  ++ EY 
Sbjct: 353 L-YATGGYAYGNVKTNIVTPLSNETSNRSRSGYAVGGGVEMPFSLFGLLGPNWTSKTEYL 411

Query: 184 ASKYSK-------------VEGFYNTISLGVGMKF 205
                               +   + +  G+   F
Sbjct: 412 YVDLGSTTDVFAGGLGVSTSKVTEHMVRTGINYHF 446



 Score = 72.5 bits (176), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 44/242 (18%), Positives = 70/242 (28%), Gaps = 44/242 (18%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+KL     V +  + S  SAQAAD   RA +    V        +    +   G    L
Sbjct: 1   MKKLL----VGAALVGSAVSAQAADLAVRAPYVKAPVAAIYDWTGFYIGGNVGVGVGRNL 56

Query: 61  S-----ALYNGSFGEEAHHNAGGSIFAGYNVE----DSCIMYGVEGDVRYTVPV------ 105
                 A    +          G    GYN +       ++ GVE D++ +         
Sbjct: 57  QSHVFPAGGVANSSYLQPQGVIGGGQIGYNWQTNSVFGPLLIGVEADIQGSGMSDGRTTL 116

Query: 106 -------LADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGK-----AGE 153
                     N +       ++R R G      ++ Y T G        T          
Sbjct: 117 NTLNGVLGTVNYNQKLDWFTTVRGRIGIARGP-VVSYFTGGFAAGDVKTTVTEVGLVPFN 175

Query: 154 ITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSK-----------VEGFYNTISLGVG 202
           ++    G   G GVE   L  +   ++EY                   E   N   +G+ 
Sbjct: 176 LSGTRTGWVIGSGVE-AALGGNWTGKIEYLYLDLGNRTDVFGTQSLRTELRENIFRVGLN 234

Query: 203 MK 204
            +
Sbjct: 235 YR 236


>gi|324009900|gb|EGB79119.1| outer membrane protein A [Escherichia coli MS 57-2]
          Length = 354

 Score = 84.5 bits (207), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 37/212 (17%), Positives = 69/212 (32%), Gaps = 28/212 (13%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K  +A+ V+         AQAA                     Y   +  ++  +   
Sbjct: 9   MKKTAIAIAVALA--GFATVAQAA---------------PKDNTWYTGAKLGWSQYHDT- 50

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGSL 120
              +  + G    +  G   F GY V            +       +    +    G  L
Sbjct: 51  --GFIDNNGPTHENQLGAGAFGGYQVNPYVGFEMGYDWLGRMPYKGSVENGAYKAQGVQL 108

Query: 121 RIRGGYEVSDSLLLYATVGPDVAQKYE-TGKAGEITPIAIGGTAGVGVEVGGLSESLVAR 179
             + GY ++D L +Y  +G  V +    +   G+     +      GVE   ++  +  R
Sbjct: 109 TAKLGYPITDDLDVYTRLGGMVWRADTKSNVYGKNHDTGVSPVFAGGVEY-AITPEIATR 167

Query: 180 LEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
           LEY+ +        +    +   +SLGV  +F
Sbjct: 168 LEYQWTNNIGDAHTIGTRPDNGMLSLGVSYRF 199


>gi|291616946|ref|YP_003519688.1| OmpA [Pantoea ananatis LMG 20103]
 gi|291151976|gb|ADD76560.1| OmpA [Pantoea ananatis LMG 20103]
          Length = 367

 Score = 84.5 bits (207), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 41/219 (18%), Positives = 67/219 (30%), Gaps = 32/219 (14%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K  +A+ V+         AQAA                     Y   +  ++  +   
Sbjct: 11  MKKTAIAIAVALA--GFATVAQAA---------------PKDNTWYTGAKLGWSQYHDTG 53

Query: 61  SAL--YNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGG 118
                Y  + G       G   FAGY              +            +    G 
Sbjct: 54  YYGNGYQNNDGPTHESQLGAGAFAGYQANPYLGFELGYDWLGRMPNKGNQVNGAFKAQGI 113

Query: 119 SLRIRGGYEVSDSLLLYATVGPDVAQKYE------TGKAGEITPIAIGGTAGVGVEVGGL 172
            L  +  Y ++D L +Y  +G  V +         TG         +   A VGVE   L
Sbjct: 114 QLAAKLSYPIADDLDIYTRLGGMVWRADSTQQNLATGTRISDHDTGVSPLAAVGVEY-AL 172

Query: 173 SESLVARLEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
           +++   RL+Y+          V    +   +SLGV  +F
Sbjct: 173 TKNWATRLDYQWVNNIGDAQTVGARPDNGMLSLGVSYRF 211


>gi|46812309|gb|AAT02227.1| outer membrane protein A precursor [Shigella boydii]
          Length = 346

 Score = 84.5 bits (207), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 36/212 (16%), Positives = 68/212 (32%), Gaps = 28/212 (13%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K   A+ ++         AQAA                     Y   +  ++  +   
Sbjct: 1   MKKT--AIAIAVALAGFATVAQAA---------------PKDNTWYTGAKLGWSQYHDT- 42

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGSL 120
              +  + G    +  G   F GY V            +       +    +    G  L
Sbjct: 43  --GFINNNGPTHENQLGAGAFGGYQVNPYVGFEMGYDWLGRMPYKGSVENGAYKAQGVQL 100

Query: 121 RIRGGYEVSDSLLLYATVGPDVAQKYE-TGKAGEITPIAIGGTAGVGVEVGGLSESLVAR 179
             + GY ++D L +Y  +G  V +    +   G+     +      GVE   ++  +  R
Sbjct: 101 TAKLGYPITDDLDIYTRLGGMVWRADTKSNVYGKNHDTGVSPVFAGGVEY-AITPEIATR 159

Query: 180 LEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
           LEY+ +        +    +   +SLGV  +F
Sbjct: 160 LEYQWTNNIGDAHTIGTRPDNGMLSLGVSYRF 191


>gi|218557855|ref|YP_002390768.1| outer membrane protein A [Escherichia coli S88]
 gi|7188818|gb|AAF37887.1|AF234269_1 outer membrane protein A [Escherichia coli RS218]
 gi|218364624|emb|CAR02310.1| outer membrane protein A (3a;II*;G;d) [Escherichia coli S88]
 gi|294493105|gb|ADE91861.1| outer membrane protein A [Escherichia coli IHE3034]
 gi|323953341|gb|EGB49207.1| OmpA transmembrane domain-containing protein [Escherichia coli
           H252]
 gi|323958256|gb|EGB53965.1| OmpA transmembrane domain-containing protein [Escherichia coli
           H263]
          Length = 346

 Score = 84.5 bits (207), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 37/212 (17%), Positives = 69/212 (32%), Gaps = 28/212 (13%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K  +A+ V+         AQAA                     Y   +  ++  +   
Sbjct: 1   MKKTAIAIAVALA--GFATVAQAA---------------PKDNTWYTGAKLGWSQYHDT- 42

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGSL 120
              +  + G    +  G   F GY V            +       +    +    G  L
Sbjct: 43  --GFINNNGPTHENQLGAGAFGGYQVNPYVGFEMGYDWLGRMPYKGSVENGAYKAQGVQL 100

Query: 121 RIRGGYEVSDSLLLYATVGPDVAQKYE-TGKAGEITPIAIGGTAGVGVEVGGLSESLVAR 179
             + GY ++D L +Y  +G  V +    +   G+     +      GVE   ++  +  R
Sbjct: 101 TAKLGYPITDDLDVYTRLGGMVWRADTKSNVYGKNHDTGVSPVFAGGVEY-AITPEIATR 159

Query: 180 LEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
           LEY+ +        +    +   +SLGV  +F
Sbjct: 160 LEYQWTNNIGDAHTIGTRPDNGMLSLGVSYRF 191


>gi|331662369|ref|ZP_08363292.1| outer membrane protein A [Escherichia coli TA143]
 gi|331682461|ref|ZP_08383080.1| outer membrane protein A [Escherichia coli H299]
 gi|331060791|gb|EGI32755.1| outer membrane protein A [Escherichia coli TA143]
 gi|331080092|gb|EGI51271.1| outer membrane protein A [Escherichia coli H299]
          Length = 346

 Score = 84.5 bits (207), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 37/212 (17%), Positives = 69/212 (32%), Gaps = 28/212 (13%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K  +A+ V+         AQAA                     Y   +  ++  +   
Sbjct: 1   MKKTAIAIAVALA--GFATVAQAA---------------PKDNTWYTGAKLGWSQYHDT- 42

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGSL 120
              +  + G    +  G   F GY V            +       +    +    G  L
Sbjct: 43  --GFINNNGPTHENQLGAGAFGGYQVNPYVGFEMGYDWLGRMPYKGSVENGAYKAQGVQL 100

Query: 121 RIRGGYEVSDSLLLYATVGPDVAQKYE-TGKAGEITPIAIGGTAGVGVEVGGLSESLVAR 179
             + GY ++D L +Y  +G  V +    +   G+     +      GVE   ++  +  R
Sbjct: 101 TAKLGYPITDDLDVYTRLGGMVWRADTKSNFDGKNHDTGVSPVFAGGVEY-AITPEIATR 159

Query: 180 LEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
           LEY+ +        +    +   +SLGV  +F
Sbjct: 160 LEYQWTNNIGDAHTIGTRPDNGMLSLGVSYRF 191


>gi|154246089|ref|YP_001417047.1| porin [Xanthobacter autotrophicus Py2]
 gi|154160174|gb|ABS67390.1| porin [Xanthobacter autotrophicus Py2]
          Length = 255

 Score = 84.5 bits (207), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 35/201 (17%), Positives = 58/201 (28%), Gaps = 46/201 (22%)

Query: 41  IATNRYVPIRHDFNGPYAGLSALYNGSFGEEAH----------------HNAGGSIFAGY 84
                 V     + G Y G    Y  +    ++                         GY
Sbjct: 30  PVKAAPVAPAFSWTGFYIGAQGGYAWADNSFSNTHDLYNTYANDASYTLDGGLVGGVIGY 89

Query: 85  NVEDSCIMYGVEGDVRYTVPVLADNI-----------------HSLHGIGGSLRIRGGYE 127
           N + + I+ GVE D  +     + ++                  S     G++  R G  
Sbjct: 90  NYQINNIVLGVEADANWADISGSGSVLRAGELATNCIVSNNPCSSKIDALGTITARLGVA 149

Query: 128 VSDSLLLYATVGPDVAQKYETGKAGE-----------ITPIAIGGTAGVGVEVGGLSESL 176
             D +LLYA  G   A    T  + +            +    G T G GVE      + 
Sbjct: 150 F-DRVLLYAKGGAAWANVKHTAGSTDYEYPEFSYSASNSNTRWGWTVGAGVE-WAFFNNW 207

Query: 177 VARLEYRASKYSKVEGFYNTI 197
            A++EY        +  +N +
Sbjct: 208 SAKVEYNYIDLGSNDVTFNFV 228


>gi|86751713|ref|YP_488209.1| outer membrane protein [Rhodopseudomonas palustris HaA2]
 gi|86574741|gb|ABD09298.1| outer membrane protein [Rhodopseudomonas palustris HaA2]
          Length = 449

 Score = 84.5 bits (207), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 35/201 (17%), Positives = 54/201 (26%), Gaps = 43/201 (21%)

Query: 47  VPIRHDFNGPYAGLSALYNGSFG------------EEAHHNAGGSIFAGYNVEDSCIMYG 94
            P   ++ G Y G +     +                +     G    GYN + S  ++G
Sbjct: 242 TPPPANWAGLYLGGNFGGATARNRTTSSVIFSENFNLSPDGFVGGGQIGYNWQASNWVFG 301

Query: 95  VEGDVRYTVPVLADN--------IHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKY 146
            E D + +                +      G+ R R GY V  S L YAT G       
Sbjct: 302 AEADFQGSTQKDDRAAVLSSLLLYNQKLPWFGTARARLGYTVG-STLFYATGGYAYGNVK 360

Query: 147 ETGKAGEITPI----AIGGTAGVGVE-----VGGLSESLVARLEYRASKYSK-------- 189
                            G   G GVE      G L  +  ++ EY               
Sbjct: 361 TNVVTAFSNETFNRSRSGYAVGAGVETPFQLFGLLGPNWTSKTEYLYVDLGSTTDSFLGG 420

Query: 190 -----VEGFYNTISLGVGMKF 205
                 +   + +  G+   F
Sbjct: 421 AAVSTSKVTNHMLRTGINYHF 441



 Score = 73.3 bits (178), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 43/239 (17%), Positives = 74/239 (30%), Gaps = 41/239 (17%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K+ + V +    + S  SAQAAD   +A +    +        +    +   G    L
Sbjct: 1   MKKILVGVAL----IGSAVSAQAADLAVKAPYLKAPIAAVYDWTGFYIGANVGVGLGRDL 56

Query: 61  SAL---YNGSFGEEAHHNAGGSIFAGYNVE-----DSCIMYGVEGDVRYTVPV------- 105
                   G     +     G    GYN +        ++ GVE D++ +          
Sbjct: 57  QTHAVPAGGVASHLSPQGVIGGGQIGYNWQSNTTFLGPLLIGVEADIQGSGMTDGHTTLS 116

Query: 106 ---LADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKA------GEITP 156
               A N +       ++R R G  V   ++ Y T G   A    T            + 
Sbjct: 117 SPLGAANYNQKLDWFTTVRGRVG-LVRGPVVGYFTGGFAAANVKTTVTQIGGIVPFAFSE 175

Query: 157 IAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFYNT-----------ISLGVGMK 204
              G T G GVE   +  +   ++EY           + T             +G+  +
Sbjct: 176 TRTGWTIGSGVE-AAIGGNWTGKIEYLYLDLGNRNDVFGTQALRTEYRESIFRVGLNYR 233


>gi|146342874|ref|YP_001207922.1| putative outer membrane protein [Bradyrhizobium sp. ORS278]
 gi|146195680|emb|CAL79707.1| putative outer membrane protein precursor [Bradyrhizobium sp.
           ORS278]
          Length = 214

 Score = 84.5 bits (207), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 48/203 (23%), Positives = 74/203 (36%), Gaps = 22/203 (10%)

Query: 17  SFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSFGEEA---H 73
              SAQAAD       G    V            + + GPY G +  Y       +    
Sbjct: 20  GSGSAQAADLGYGYGRGAPYTVNQPLNA------YSWAGPYLGGTLGYQWGTVGNSATKP 73

Query: 74  HNAGGSIFAGYNVEDSC-IMYGVEGDVRYTVPVLA-DNIHSLHGIGGSLRIRGGYEVSDS 131
               G + AGYN ++    + G+EGD+  +            +   G+LR R GY  ++ 
Sbjct: 74  SGLVGGVTAGYNWQNGSPWVLGIEGDINLSGANDTFAPWKFSNPWFGTLRGRVGYAFNN- 132

Query: 132 LLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYS--- 188
           +L Y T G  +            +  A+G T GVG E G L+++  A++EY         
Sbjct: 133 ILFYGTGGLALGGLRAETFGLSESHTAVGWTLGVGTEFG-LAQNWTAKIEYLYVDLDSNN 191

Query: 189 ------KVEGFYNTISLGVGMKF 205
                 K +     I  G+   F
Sbjct: 192 FVITGAKNDYRSGMIRAGINFHF 214


>gi|332717162|ref|YP_004444628.1| 25 kDa outer-membrane immunogenic protein [Agrobacterium sp. H13-3]
 gi|325063847|gb|ADY67537.1| 25 kDa outer-membrane immunogenic protein [Agrobacterium sp. H13-3]
          Length = 223

 Score = 84.5 bits (207), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 51/200 (25%), Positives = 76/200 (38%), Gaps = 24/200 (12%)

Query: 28  RRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSF---------GEEAHHNAGG 78
                   G +P       V     ++G Y G SA Y  +           +        
Sbjct: 26  ASVAADAVGDIPAAPVVNDVAPAFSWDGVYVGASAGYGWNRVKSTTFGVTTKHEFDGGRF 85

Query: 79  SIFAGYNVED-SCIMYGVEGDVRYTVPVLA-DNIHSLHGIGGSLRIRGGYEVSDSLLLYA 136
           S FAGYN E    I+ GVEGD+ Y              G+ GS R+R GY + D  L+Y 
Sbjct: 86  SGFAGYNAEVAPSIILGVEGDLGYAWGDKTIVTSEVSAGLNGSARLRAGYAI-DRALIYT 144

Query: 137 TVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKV------ 190
             G            GE + +  G T G GV+    + +L  R+EYR + + K       
Sbjct: 145 AAGYTATDSEVKAPFGEDSKVLHGWTVGAGVDY-AFTNNLFGRVEYRYNDFGKATYHTGP 203

Query: 191 -----EGFYNTISLGVGMKF 205
                +   + + +G+G+KF
Sbjct: 204 ITSTGDVSEHVVKVGLGVKF 223


>gi|27375206|ref|NP_766735.1| hypothetical protein blr0095 [Bradyrhizobium japonicum USDA 110]
 gi|27348342|dbj|BAC45360.1| blr0095 [Bradyrhizobium japonicum USDA 110]
          Length = 675

 Score = 84.1 bits (206), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 49/222 (22%), Positives = 76/222 (34%), Gaps = 45/222 (20%)

Query: 2   QKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLS 61
           + L  A  ++S  +    +++AAD   +A                    +D+ G Y G  
Sbjct: 20  RYLRTAAAIASGVMVLPAASRAADLPLKAPALKTV--------------YDWTGLYIGAH 65

Query: 62  ALYNGSFG------------EEAHHNAGGSIFAGYNVEDSC-IMYGVEGDVRYTVPVLAD 108
                               +     A G + AGYN   +  ++ GVEGD+ +   + ++
Sbjct: 66  VGVTRGTSSATLIDPTLATDDHVFTGATGGVQAGYNWRLNSGLLLGVEGDISFPNYLPSN 125

Query: 109 NIHSLH-----------GIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEIT-- 155
           ++ S                 SLR R GY   +  L YAT G     +         T  
Sbjct: 126 HVVSSAATVLSSAEERWDYVASLRARLGYTTGN-WLFYATGGAAFTGERFLSTPTGGTEE 184

Query: 156 ---PIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFY 194
                  G TAG GVE    +    ARLEY  SK+      +
Sbjct: 185 KVLHTRFGWTAGGGVEY-AFAPHWSARLEYLYSKFDNANVTF 225


>gi|299773229|gb|ADJ38689.1| outer membrane protein P5 [Haemophilus parasuis]
          Length = 365

 Score = 84.1 bits (206), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 44/228 (19%), Positives = 85/228 (37%), Gaps = 31/228 (13%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATN-RYVPIRHDFNGPYAG 59
           M+K  +A+ VS LA+AS   A AA      + G +    T   +   +  +++ +  YA 
Sbjct: 1   MKKSLIALAVSGLAVASV--ANAAPQANSFYVGAKAGWATFHNDINQLNSKYENDARYAT 58

Query: 60  LSALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGS 119
            +  Y         ++    +F GY + D+  +               +     H   G+
Sbjct: 59  SANGYG-----INRNSVTYGVFGGYQIIDNLAVELGYDYFGRVRGNKQEFRAFKHSAHGT 113

Query: 120 -LRIRGGYEVSDSLLLYATVGPDVAQKYE-----TGKAGEITPIAIGGTAGVGVEVGGLS 173
            L ++  YEV + L +Y  VG  + +        T +  +   +      G GVE   + 
Sbjct: 114 HLSLKPSYEVLNGLDVYGKVGAALVRNDYKRYFQTREPVKSHNLKTSLIVGAGVEY-AIL 172

Query: 174 ESLVARLEYRAS----KYSKVEG------------FYNTISLGVGMKF 205
             L  R+EY+       ++K E               ++++ G+  +F
Sbjct: 173 PELAFRVEYQWLSNVGNFTKAEVKENRRATYNYSPDSHSVTAGISYRF 220


>gi|218704380|ref|YP_002411899.1| outer membrane protein A [Escherichia coli UMN026]
 gi|293404256|ref|ZP_06648250.1| outer membrane protein A [Escherichia coli FVEC1412]
 gi|298380040|ref|ZP_06989645.1| outer membrane protein A [Escherichia coli FVEC1302]
 gi|51235574|gb|AAT98588.1| outer membrane protein A [Escherichia coli]
 gi|218431477|emb|CAR12355.1| outer membrane protein A (3a;II*;G;d) [Escherichia coli UMN026]
 gi|291428842|gb|EFF01867.1| outer membrane protein A [Escherichia coli FVEC1412]
 gi|298279738|gb|EFI21246.1| outer membrane protein A [Escherichia coli FVEC1302]
          Length = 346

 Score = 84.1 bits (206), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 37/212 (17%), Positives = 69/212 (32%), Gaps = 28/212 (13%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K  +A+ V+         AQAA                     Y   +  ++  +   
Sbjct: 1   MKKTAIAIAVALA--GFATVAQAA---------------PKDNTWYTGAKLGWSQYHDT- 42

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGSL 120
              +  + G    +  G   F GY V            +       +    +    G  L
Sbjct: 43  --GFINNNGPTHENQLGAGAFGGYQVNPYVGFEMGYDWLGRMPYKGSVENGAYKAQGVQL 100

Query: 121 RIRGGYEVSDSLLLYATVGPDVAQKYE-TGKAGEITPIAIGGTAGVGVEVGGLSESLVAR 179
             + GY ++D L +Y  +G  V +    +   G+     +      GVE   ++  +  R
Sbjct: 101 TAKLGYPITDDLDVYTRLGGMVWRADTKSNVYGKNHDTGVSPVFAGGVEY-AITPEIATR 159

Query: 180 LEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
           LEY+ +        +    +   +SLGV  +F
Sbjct: 160 LEYQWTNNIGDAHTIGTRPDNGMLSLGVSYRF 191


>gi|251788834|ref|YP_003003555.1| outer membrane protein A [Dickeya zeae Ech1591]
 gi|247537455|gb|ACT06076.1| OmpA domain protein transmembrane region-containing protein
           [Dickeya zeae Ech1591]
          Length = 355

 Score = 84.1 bits (206), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 39/214 (18%), Positives = 72/214 (33%), Gaps = 30/214 (14%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K  +A+ V+         AQAA                     Y   +  ++  +   
Sbjct: 1   MKKTAIAIAVALA--GFATVAQAA---------------PNDNTWYAGGKLGWSQYHDSG 43

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLH--GIGG 118
                 +    A +  G   F GY    +    G E    +   +  +  +       G 
Sbjct: 44  LNGNGYNVTNAAQNQLGAGAFGGYQ---ANPYLGFEMGYDWLGRMKYNGGNQGSFKAQGI 100

Query: 119 SLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAG-EITPIAIGGTAGVGVEVGGLSESLV 177
            L  +  Y + D + +Y  +G  V +      +G       +   A VGVE   ++++  
Sbjct: 101 QLAAKLSYPIVDDVDVYTRLGGFVWRADSHDNSGLNDHDTGVSPLAAVGVEY-AITKNWA 159

Query: 178 ARLEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
            RL+Y+        S V G  +   +S+GV  +F
Sbjct: 160 TRLDYQWVNNIGDASTVGGRPDNGLLSVGVSYRF 193


>gi|324113719|gb|EGC07694.1| OmpA transmembrane domain-containing protein [Escherichia
           fergusonii B253]
 gi|325496887|gb|EGC94746.1| outer membrane protein A [Escherichia fergusonii ECD227]
          Length = 359

 Score = 84.1 bits (206), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 38/217 (17%), Positives = 72/217 (33%), Gaps = 33/217 (15%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K  +A+ V+         AQAA                     Y   +  ++  +   
Sbjct: 9   MKKTAIAIAVALA--GFATVAQAA---------------PKDNTWYTGAKLGWSQYHDT- 50

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGSL 120
              +  + G    +  G   F GY V            +       +    +    G  L
Sbjct: 51  --GFIDNNGPTHENQLGAGAFGGYQVNPYVGFEMGYDWLGRMPYKGSVENGAYKAQGVQL 108

Query: 121 RIRGGYEVSDSLLLYATVGPDVAQKYE------TGKAGEITPIAIGGTAGVGVEVGGLSE 174
             + GY ++D L +Y  +G  V +         TG++ +     +      GVE   ++ 
Sbjct: 109 TAKLGYPITDDLDIYTRLGGMVWRADTKAHNNVTGESEKNHDTGVSPVFAGGVE-WAITP 167

Query: 175 SLVARLEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
            +  RLEY+ +      + +    +   +SLGV  +F
Sbjct: 168 EIATRLEYQWTNNIGDANTIGTRPDNGLLSLGVSYRF 204


>gi|91977250|ref|YP_569909.1| hypothetical protein RPD_2780 [Rhodopseudomonas palustris BisB5]
 gi|91683706|gb|ABE40008.1| conserved hypothetical protein [Rhodopseudomonas palustris BisB5]
          Length = 570

 Score = 84.1 bits (206), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 40/223 (17%), Positives = 59/223 (26%), Gaps = 53/223 (23%)

Query: 10  VSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSFG 69
           +S++  AS  +A AAD  R                       ++ G Y G          
Sbjct: 8   LSAVLFASCGTAHAADIAR-------------PPAADPIAALNWTGFYLGAHLGAGFGTT 54

Query: 70  EEAHHN-------------AGGSIFAGYNVEDSC--IMYGVEGDVRYTVPVLAD------ 108
           +  +               A   + AGYN +      + GVE D         D      
Sbjct: 55  KVDNPYGPSIYGDTVRVPKALAGLQAGYNWQAPGTAWVLGVEADASALDADGTDTCLAYS 114

Query: 109 ------NIHSLHGIGGSLRIRGGYEVS--DSLLLYATVGPDVAQKYETGKAGEIT----- 155
                 N      + G+L  R G+        L+Y   G        T     +      
Sbjct: 115 GQFVSANCRVREHVLGTLTGRIGHAFGSQGRSLMYVKGGAAFLTSDLTMTTNAVDYLNRP 174

Query: 156 -----PIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGF 193
                    G T G G+E   LS     R EY  + +      
Sbjct: 175 AAELKETRWGWTVGAGIE-HALSSGWAVRAEYDYADFGTRGID 216


>gi|15800816|ref|NP_286832.1| outer membrane protein A [Escherichia coli O157:H7 EDL933]
 gi|15830295|ref|NP_309068.1| outer membrane protein A [Escherichia coli O157:H7 str. Sakai]
 gi|16128924|ref|NP_415477.1| outer membrane protein A (3a;II*;G;d) [Escherichia coli str. K-12
           substr. MG1655]
 gi|74311514|ref|YP_309933.1| outer membrane protein A [Shigella sonnei Ss046]
 gi|89107807|ref|AP_001587.1| outer membrane protein A (3a;II*;G;d) [Escherichia coli str. K-12
           substr. W3110]
 gi|157160478|ref|YP_001457796.1| outer membrane protein A [Escherichia coli HS]
 gi|170080615|ref|YP_001729935.1| outer membrane protein A (3a;II*;G;d) [Escherichia coli str. K-12
           substr. DH10B]
 gi|187730326|ref|YP_001880845.1| outer membrane protein A [Shigella boydii CDC 3083-94]
 gi|188493530|ref|ZP_03000800.1| outer membrane protein P5 [Escherichia coli 53638]
 gi|209918209|ref|YP_002292293.1| outer membrane protein A [Escherichia coli SE11]
 gi|218694432|ref|YP_002402099.1| outer membrane protein A [Escherichia coli 55989]
 gi|238900215|ref|YP_002926011.1| outer membrane protein A (3a;II*;G;d) [Escherichia coli BW2952]
 gi|253774014|ref|YP_003036845.1| outer membrane protein A [Escherichia coli 'BL21-Gold(DE3)pLysS
           AG']
 gi|254161071|ref|YP_003044179.1| outer membrane protein A [Escherichia coli B str. REL606]
 gi|254792157|ref|YP_003076994.1| outer membrane protein A [Escherichia coli O157:H7 str. TW14359]
 gi|260843206|ref|YP_003220984.1| outer membrane protein A [Escherichia coli O103:H2 str. 12009]
 gi|260854249|ref|YP_003228140.1| outer membrane protein A [Escherichia coli O26:H11 str. 11368]
 gi|260867129|ref|YP_003233531.1| outer membrane protein A [Escherichia coli O111:H- str. 11128]
 gi|261227460|ref|ZP_05941741.1| outer membrane protein A [Escherichia coli O157:H7 str. FRIK2000]
 gi|261256117|ref|ZP_05948650.1| outer membrane protein A [Escherichia coli O157:H7 str. FRIK966]
 gi|307311656|ref|ZP_07591296.1| OmpA domain protein transmembrane region-containing protein
           [Escherichia coli W]
 gi|312971089|ref|ZP_07785268.1| outer membrane protein A [Escherichia coli 1827-70]
 gi|71159604|sp|P0A911|OMPA_ECO57 RecName: Full=Outer membrane protein A; AltName: Full=Outer
           membrane protein II*; Flags: Precursor
 gi|71159605|sp|P0A910|OMPA_ECOLI RecName: Full=Outer membrane protein A; AltName: Full=Outer
           membrane protein II*; Flags: Precursor
 gi|12514142|gb|AAG55443.1|AE005286_2 outer membrane protein 3a (II*;G;d) [Escherichia coli O157:H7 str.
           EDL933]
 gi|42161|emb|CAA23588.1| ompA protein [Escherichia coli]
 gi|1651465|dbj|BAA35715.1| outer membrane protein A (3a;II*;G;d) [Escherichia coli str. K12
           substr. W3110]
 gi|1787191|gb|AAC74043.1| outer membrane protein A (3a;II*;G;d) [Escherichia coli str. K-12
           substr. MG1655]
 gi|13360501|dbj|BAB34464.1| outer membrane protein 3a [Escherichia coli O157:H7 str. Sakai]
 gi|32329155|gb|AAP74759.1| outer membrane protein A precursor [Shigella sonnei]
 gi|73854991|gb|AAZ87698.1| outer membrane protein 3a (II*;G;d) [Shigella sonnei Ss046]
 gi|157066158|gb|ABV05413.1| outer membrane protein A [Escherichia coli HS]
 gi|169888450|gb|ACB02157.1| outer membrane protein A (3a;II*;G;d) [Escherichia coli str. K-12
           substr. DH10B]
 gi|187427318|gb|ACD06592.1| outer membrane protein A [Shigella boydii CDC 3083-94]
 gi|188488729|gb|EDU63832.1| outer membrane protein P5 [Escherichia coli 53638]
 gi|209774438|gb|ACI85531.1| outer membrane protein 3a [Escherichia coli]
 gi|209774440|gb|ACI85532.1| outer membrane protein 3a [Escherichia coli]
 gi|209774442|gb|ACI85533.1| outer membrane protein 3a [Escherichia coli]
 gi|209774444|gb|ACI85534.1| outer membrane protein 3a [Escherichia coli]
 gi|209774446|gb|ACI85535.1| outer membrane protein 3a [Escherichia coli]
 gi|209911468|dbj|BAG76542.1| outer membrane protein OmpA [Escherichia coli SE11]
 gi|218351164|emb|CAU96868.1| outer membrane protein A (3a;II*;G;d) [Escherichia coli 55989]
 gi|238861958|gb|ACR63956.1| outer membrane protein A (3a;II*;G;d) [Escherichia coli BW2952]
 gi|242376772|emb|CAQ31485.1| outer membrane protein 3a (II*;G;d) [Escherichia coli BL21(DE3)]
 gi|253325058|gb|ACT29660.1| OmpA domain protein transmembrane region-containing protein
           [Escherichia coli 'BL21-Gold(DE3)pLysS AG']
 gi|253972972|gb|ACT38643.1| outer membrane protein A (3a;II*;G;d) [Escherichia coli B str.
           REL606]
 gi|253977186|gb|ACT42856.1| outer membrane protein A (3a;II*;G;d) [Escherichia coli BL21(DE3)]
 gi|254591557|gb|ACT70918.1| outer membrane protein A (3a;II*;G;d) [Escherichia coli O157:H7
           str. TW14359]
 gi|257752898|dbj|BAI24400.1| outer membrane protein A [Escherichia coli O26:H11 str. 11368]
 gi|257758353|dbj|BAI29850.1| outer membrane protein A [Escherichia coli O103:H2 str. 12009]
 gi|257763485|dbj|BAI34980.1| outer membrane protein A [Escherichia coli O111:H- str. 11128]
 gi|260449897|gb|ACX40319.1| OmpA domain protein transmembrane region-containing protein
           [Escherichia coli DH1]
 gi|306908211|gb|EFN38710.1| OmpA domain protein transmembrane region-containing protein
           [Escherichia coli W]
 gi|310336850|gb|EFQ02017.1| outer membrane protein A [Escherichia coli 1827-70]
 gi|315060242|gb|ADT74569.1| outer membrane protein A [Escherichia coli W]
 gi|315135605|dbj|BAJ42764.1| OmpA domain protein transmembrane region-containing protein
           precursor [Escherichia coli DH1]
 gi|320648407|gb|EFX17062.1| outer membrane protein A [Escherichia coli O157:H- str. H 2687]
 gi|320659566|gb|EFX27129.1| outer membrane protein A [Escherichia coli O55:H7 str. USDA 5905]
 gi|320664337|gb|EFX31488.1| outer membrane protein A [Escherichia coli O157:H7 str. LSU-61]
 gi|323157149|gb|EFZ43272.1| outer membrane protein A [Escherichia coli EPECa14]
 gi|323159587|gb|EFZ45567.1| outer membrane protein A [Escherichia coli E128010]
 gi|323174936|gb|EFZ60551.1| outer membrane protein A [Escherichia coli LT-68]
 gi|323175416|gb|EFZ61011.1| outer membrane protein A [Escherichia coli 1180]
 gi|323185333|gb|EFZ70697.1| outer membrane protein A [Escherichia coli 1357]
 gi|323379198|gb|ADX51466.1| OmpA/MotB domain protein [Escherichia coli KO11]
 gi|323938062|gb|EGB34324.1| OmpA transmembrane domain-containing protein [Escherichia coli
           E1520]
 gi|323942872|gb|EGB39037.1| OmpA transmembrane domain-containing protein [Escherichia coli
           E482]
 gi|323947254|gb|EGB43262.1| OmpA transmembrane domain-containing protein [Escherichia coli
           H120]
 gi|323962843|gb|EGB58418.1| OmpA transmembrane domain-containing protein [Escherichia coli
           H489]
 gi|323973167|gb|EGB68359.1| OmpA transmembrane domain-containing protein [Escherichia coli
           TA007]
 gi|324117179|gb|EGC11087.1| OmpA transmembrane domain-containing protein [Escherichia coli
           E1167]
          Length = 346

 Score = 84.1 bits (206), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 37/212 (17%), Positives = 69/212 (32%), Gaps = 28/212 (13%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K  +A+ V+         AQAA                     Y   +  ++  +   
Sbjct: 1   MKKTAIAIAVALA--GFATVAQAA---------------PKDNTWYTGAKLGWSQYHDT- 42

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGSL 120
              +  + G    +  G   F GY V            +       +    +    G  L
Sbjct: 43  --GFINNNGPTHENQLGAGAFGGYQVNPYVGFEMGYDWLGRMPYKGSVENGAYKAQGVQL 100

Query: 121 RIRGGYEVSDSLLLYATVGPDVAQKYE-TGKAGEITPIAIGGTAGVGVEVGGLSESLVAR 179
             + GY ++D L +Y  +G  V +    +   G+     +      GVE   ++  +  R
Sbjct: 101 TAKLGYPITDDLDIYTRLGGMVWRADTKSNVYGKNHDTGVSPVFAGGVEY-AITPEIATR 159

Query: 180 LEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
           LEY+ +        +    +   +SLGV  +F
Sbjct: 160 LEYQWTNNIGDAHTIGTRPDNGMLSLGVSYRF 191


>gi|218517219|ref|ZP_03514059.1| outer membrane protein [Rhizobium etli 8C-3]
          Length = 153

 Score = 84.1 bits (206), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 36/149 (24%), Positives = 60/149 (40%), Gaps = 9/149 (6%)

Query: 65  NGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLAD-NIHSLHGIGGSLRIR 123
            G+   E  +      FAGYN +   I+ G+EG++ Y                 G++R R
Sbjct: 6   GGASASEDFNGGVFGGFAGYNFQFDNIVVGIEGNLEYNWNEEEALGADVGTDWAGAVRGR 65

Query: 124 GGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYR 183
            GY    +L+  A          +     + T    G T G GV+   ++ ++ AR EYR
Sbjct: 66  VGYAFDKALIYGAAGWAATRGYVDAPGFDKETETFNGYTVGAGVDF-AITNNIFARGEYR 124

Query: 184 ASKYS-------KVEGFYNTISLGVGMKF 205
            + Y         V+   + +  G+G+KF
Sbjct: 125 YNDYGERDILGVDVDLDQHELKFGIGVKF 153


>gi|218700524|ref|YP_002408153.1| outer membrane protein A [Escherichia coli IAI39]
 gi|331646217|ref|ZP_08347320.1| outer membrane protein A [Escherichia coli M605]
 gi|218370510|emb|CAR18317.1| outer membrane protein A (3a;II*;G;d) [Escherichia coli IAI39]
 gi|331044969|gb|EGI17096.1| outer membrane protein A [Escherichia coli M605]
          Length = 374

 Score = 84.1 bits (206), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 38/219 (17%), Positives = 70/219 (31%), Gaps = 38/219 (17%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K  +A+ V+         AQAA                     Y   +  ++  +   
Sbjct: 25  MKKTAIAIAVALA--GFATVAQAA---------------PKDNTWYTGAKLGWSQYHDT- 66

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGG-- 118
              +  + G    +  G   F GY V       G E    +   +     +         
Sbjct: 67  --GFIPNNGPTHENQLGAGAFGGYQV---NPYVGFEMGYDWLGRMPYKGDNINGAYKAQG 121

Query: 119 -SLRIRGGYEVSDSLLLYATVGPDVAQKYET-----GKAGEITPIAIGGTAGVGVEVGGL 172
             L  + GY ++D L +Y  +G  V +         G + +     +      GVE   +
Sbjct: 122 VQLTAKLGYPITDDLDIYTRLGGMVWRADTKANVPGGASFKDHDTGVSPVFAGGVEY-AI 180

Query: 173 SESLVARLEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
           +  +  RLEY+ +        +    +   +SLGV  +F
Sbjct: 181 TPEIATRLEYQWTNNIGDAHTIGTRPDNGMLSLGVSYRF 219


>gi|331651979|ref|ZP_08352998.1| outer membrane protein A (Outer membrane protein II) [Escherichia
           coli M718]
 gi|331050257|gb|EGI22315.1| outer membrane protein A (Outer membrane protein II) [Escherichia
           coli M718]
          Length = 375

 Score = 84.1 bits (206), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 38/217 (17%), Positives = 71/217 (32%), Gaps = 33/217 (15%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K  +A+ V+         AQAA                     Y   +  ++  +   
Sbjct: 25  MKKTAIAIAVALA--GFATVAQAA---------------PKDNTWYTGAKLGWSQYHDT- 66

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGSL 120
              +  + G    +  G   F GY V            +       +    +    G  L
Sbjct: 67  --GFIDNNGPTHENQLGAGAFGGYQVNPYVGFEMGYDWLGRMPYKGSVENGAYKAQGVQL 124

Query: 121 RIRGGYEVSDSLLLYATVGPDVAQKYE------TGKAGEITPIAIGGTAGVGVEVGGLSE 174
             + GY ++D L +Y  +G  V +         TG++ +     +      GVE   ++ 
Sbjct: 125 TAKLGYPITDDLDVYTRLGGMVWRADTKAHNNVTGESEKNHDTGVSPVFAGGVE-WAITP 183

Query: 175 SLVARLEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
            +  RLEY+ +        +    +   +SLGV  +F
Sbjct: 184 EIATRLEYQWTNNIGDAHTIGTRPDNGLLSLGVSYRF 220


>gi|51235578|gb|AAT98590.1| outer membrane protein A [Escherichia coli]
          Length = 346

 Score = 84.1 bits (206), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 37/212 (17%), Positives = 69/212 (32%), Gaps = 28/212 (13%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K  +A+ V+         AQAA                     Y   +  ++  +   
Sbjct: 1   MKKTAIAIAVALA--GFATVAQAA---------------PKDNTWYTGAKLGWSQYHDT- 42

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGSL 120
              +  + G    +  G   F GY V            +       +    +    G  L
Sbjct: 43  --GFINNNGPTHENQLGAGAFGGYQVNPYVGFEMGYDWLGRMPYKGSVKNGAYKAQGVQL 100

Query: 121 RIRGGYEVSDSLLLYATVGPDVAQKYE-TGKAGEITPIAIGGTAGVGVEVGGLSESLVAR 179
             + GY ++D L +Y  +G  V +    +   G+     +      GVE   ++  +  R
Sbjct: 101 TAKLGYPITDDLDIYTRLGGMVWRADTKSNVYGKNHDTGVSPVFAGGVEY-AITPEIATR 159

Query: 180 LEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
           LEY+ +        +    +   +SLGV  +F
Sbjct: 160 LEYQWTNNIGDAHTIGTRPDNGMLSLGVSYRF 191


>gi|213419602|ref|ZP_03352668.1| outer membrane protein A [Salmonella enterica subsp. enterica
           serovar Typhi str. E01-6750]
          Length = 287

 Score = 84.1 bits (206), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 35/216 (16%), Positives = 70/216 (32%), Gaps = 32/216 (14%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K  +A+ V+         AQAA                     Y   +  ++  +   
Sbjct: 25  MKKTAIAIAVALA--GFATVAQAA---------------PKDNTWYAGAKLGWSQYHDT- 66

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGSL 120
              +  + G    +  G   F GY V            +        +   +    G  L
Sbjct: 67  --GFIHNDGPTHENQLGAGAFGGYQVNPYVGFEMGYDWLGRMPYKGDNTNGAYKAQGVQL 124

Query: 121 RIRGGYEVSDSLLLYATVGPDVAQKYET-----GKAGEITPIAIGGTAGVGVEVGGLSES 175
             + GY ++D L +Y  +G  V +         G + +     +      G+E   ++  
Sbjct: 125 TAKLGYPITDDLDVYTRLGGMVWRADTKSNVPGGASTKDHDTGVSPVFAGGIEY-AITPE 183

Query: 176 LVARLEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
           +  RLEY+ +      + +    +   +S+GV  +F
Sbjct: 184 IATRLEYQWTNNIGDANTIGTRPDNGLLSVGVSYRF 219


>gi|271501514|ref|YP_003334540.1| OmpA domain-containing protein transmembrane region-containing
           protein [Dickeya dadantii Ech586]
 gi|270345069|gb|ACZ77834.1| OmpA domain protein transmembrane region-containing protein
           [Dickeya dadantii Ech586]
          Length = 354

 Score = 84.1 bits (206), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 39/214 (18%), Positives = 72/214 (33%), Gaps = 30/214 (14%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K  +A+ V+         AQAA                     Y   +  ++  +   
Sbjct: 1   MKKTAIAIAVALA--GFATVAQAA---------------PNDNTWYAGGKLGWSQYHDTN 43

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLH--GIGG 118
                 +    A +  G   F GY    +    G E    +   +  +  +       G 
Sbjct: 44  LTGNGYNATNAAQNQLGAGAFGGYQ---ANQYLGFEMGYDWLGRMKYNGGNQGSFKAQGI 100

Query: 119 SLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAG-EITPIAIGGTAGVGVEVGGLSESLV 177
            L  +  Y + D L +Y  +G  V +      +G       +   A VGVE   ++++  
Sbjct: 101 QLAAKLSYPIVDDLDVYTRLGGFVWRADSHDNSGRNDNDTGVSPLAAVGVEY-AITKNWA 159

Query: 178 ARLEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
            RL+Y+        + V G  +   +S+GV  +F
Sbjct: 160 TRLDYQWVNNIGDAATVGGRPDNGLLSVGVSYRF 193


>gi|254696546|ref|ZP_05158374.1| outer membrane protein, putative [Brucella abortus bv. 2 str.
           86/8/59]
 gi|254705298|ref|ZP_05167126.1| outer membrane protein, putative [Brucella suis bv. 3 str. 686]
 gi|260760923|ref|ZP_05873266.1| outer membrane protein [Brucella abortus bv. 2 str. 86/8/59]
 gi|261756008|ref|ZP_05999717.1| outer membrane protein [Brucella suis bv. 3 str. 686]
 gi|260671355|gb|EEX58176.1| outer membrane protein [Brucella abortus bv. 2 str. 86/8/59]
 gi|261745761|gb|EEY33687.1| outer membrane protein [Brucella suis bv. 3 str. 686]
          Length = 158

 Score = 84.1 bits (206), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 34/160 (21%), Positives = 59/160 (36%), Gaps = 29/160 (18%)

Query: 73  HHNAGGSIFAGYNVEDSC-IMYGVEGDVRYTVPVLA-----------DNIHSLHGIGGSL 120
            +   G ++ GYN +     + G++ +V Y     +               +     G++
Sbjct: 1   PNGFIGGLYTGYNFDTGNNFILGLDANVDYNNLKKSRDFITSGNPVQTTGETQLRWSGAV 60

Query: 121 RIRGGYEVSDSLLLYATVGPDVAQKYET----GKAGEITPIAIGGTAGVGVEVGGLSESL 176
           R R GY + D  + Y   G        +    G+    +    G T G G++    ++++
Sbjct: 61  RARAGYAI-DRFMPYIAGGVAFGGIKNSLRIGGEESSKSKTQTGWTVGAGIDYAA-TDNV 118

Query: 177 VARLEYRASKYSKVEGFY-----------NTISLGVGMKF 205
           + RLEYR + Y K                N I LGV  KF
Sbjct: 119 LLRLEYRYTDYGKKNFGLNDLDTRGSFKTNDIRLGVAYKF 158


>gi|62901665|gb|AAY18798.1| OmpA [Cronobacter sakazakii]
          Length = 347

 Score = 84.1 bits (206), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 37/212 (17%), Positives = 64/212 (30%), Gaps = 28/212 (13%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K  +A+ V+         AQAA                     Y   +  ++  +   
Sbjct: 1   MKKTAIAIAVALA--GFATVAQAA---------------PKDNTWYAGGKLGWSQFHDT- 42

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGSL 120
              +  + G       G   F GY V            +            +    G  L
Sbjct: 43  --GFIPNDGPTHESQLGAGAFGGYQVNPYVGFEMGYDWLGRMPYKGDTVNGAFKAQGVQL 100

Query: 121 RIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEIT-PIAIGGTAGVGVEVGGLSESLVAR 179
             + GY V+D L +Y  +G  V +   +           +      GVE   ++  +  R
Sbjct: 101 TAKLGYPVTDDLDVYTRLGGMVWRADSSSNIAGDDHDTGVSPVFAGGVE-WAMTRDIATR 159

Query: 180 LEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
           LEY+          V    +   +S+GV  +F
Sbjct: 160 LEYQWVNNIGDAQTVGARPDNGMLSVGVSYRF 191


>gi|209885837|ref|YP_002289694.1| OmpA domain protein transmembrane region-containing protein
           [Oligotropha carboxidovorans OM5]
 gi|209874033|gb|ACI93829.1| OmpA domain protein transmembrane region-containing protein
           [Oligotropha carboxidovorans OM5]
          Length = 236

 Score = 84.1 bits (206), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 38/215 (17%), Positives = 63/215 (29%), Gaps = 28/215 (13%)

Query: 17  SFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSF----GEEA 72
           S  S  AAD   R +            N          G     S+ +        G   
Sbjct: 14  SSTSVFAADLAARPYTKAPPAPVAPIYNWTGLYIGAQVGGAFQGSSGFVTDDPLVTGNRD 73

Query: 73  HHNAGGSIFAGYNVED-SCIMYGVEGDVR------YTVPVLADNIHSLHGIGGSLRIRGG 125
             +  G    G N +     + G+EG+        YT     D I   +    S+  R G
Sbjct: 74  DSSFLGGGVLGANYQFSPNWVLGIEGEFNGLSNNRYTFTDGFDGIRVKNDWLASVTGRLG 133

Query: 126 YEVSDSLLLYATVGPDVAQ--KYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYR 183
           Y      ++YA  G                ++    G T G G+E    + +  A++EY+
Sbjct: 134 YTWGPG-MIYAKGGVAFRDNGGIAATTPFLVSRDTTGYTVGAGLEY-MFAPAWSAKIEYQ 191

Query: 184 ASKYSKV-------------EGFYNTISLGVGMKF 205
              + +                  +T+  G+   F
Sbjct: 192 YYDFDRTALTFGTLPSTVSYRDDLHTVKAGINYHF 226


>gi|26246978|ref|NP_753018.1| outer membrane protein A [Escherichia coli CFT073]
 gi|26107378|gb|AAN79561.1|AE016758_165 Outer membrane protein A precursor [Escherichia coli CFT073]
          Length = 379

 Score = 84.1 bits (206), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 38/219 (17%), Positives = 70/219 (31%), Gaps = 38/219 (17%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K  +A+ V+         AQAA                     Y   +  ++  +   
Sbjct: 30  MKKTAIAIAVALA--GFATVAQAA---------------PKDNTWYTGAKLGWSQYHDT- 71

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGG-- 118
              +  + G    +  G   F GY V       G E    +   +     +         
Sbjct: 72  --GFIPNNGPTHENQLGAGAFGGYQV---NPYVGFEMGYDWLGRMPYKGDNINGAYKAQG 126

Query: 119 -SLRIRGGYEVSDSLLLYATVGPDVAQKYET-----GKAGEITPIAIGGTAGVGVEVGGL 172
             L  + GY ++D L +Y  +G  V +         G + +     +      GVE   +
Sbjct: 127 VQLTAKLGYPITDDLDIYTRLGGMVWRADTKANVPGGASFKDHDTGVSPVFAGGVEY-AI 185

Query: 173 SESLVARLEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
           +  +  RLEY+ +        +    +   +SLGV  +F
Sbjct: 186 TPEIATRLEYQWTNNIGDAHTIGTRPDNGMLSLGVSYRF 224


>gi|157146352|ref|YP_001453671.1| outer membrane protein A [Citrobacter koseri ATCC BAA-895]
 gi|157083557|gb|ABV13235.1| hypothetical protein CKO_02111 [Citrobacter koseri ATCC BAA-895]
          Length = 356

 Score = 84.1 bits (206), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 38/212 (17%), Positives = 67/212 (31%), Gaps = 26/212 (12%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K  +A+ V+         AQAA                     Y   +  ++  +   
Sbjct: 9   MKKTAIAIAVALA--GFATVAQAA---------------PKDNTWYTGAKLGWSQFHDVG 51

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGSL 120
           +     + G       G   F GY V            +            +    G  L
Sbjct: 52  NN-QIDNNGPTHESQLGAGAFGGYQVNPYVGFEMGYDWLGRMPYKGNTQNGAFKAQGVQL 110

Query: 121 RIRGGYEVSDSLLLYATVGPDVAQKYETGKAGE-ITPIAIGGTAGVGVEVGGLSESLVAR 179
             + GY ++D L +Y  +G  V +       G       +      GVE   ++  +  R
Sbjct: 111 TAKLGYPITDDLDVYTRLGGMVWRADAQNNTGFKDHDTGVSPVFAGGVEY-AVTRDIATR 169

Query: 180 LEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
           LEY+ +      + V G  +   +S+GV  +F
Sbjct: 170 LEYQWTNNIGDANTVGGRPDNGLLSVGVSYRF 201


>gi|332279861|ref|ZP_08392274.1| outer membrane protein A [Shigella sp. D9]
 gi|332102213|gb|EGJ05559.1| outer membrane protein A [Shigella sp. D9]
          Length = 374

 Score = 84.1 bits (206), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 38/219 (17%), Positives = 70/219 (31%), Gaps = 38/219 (17%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K  +A+ V+         AQAA                     Y   +  ++  +   
Sbjct: 25  MKKTAIAIAVALA--GFATVAQAA---------------PKDNTWYTGAKLGWSQYHDT- 66

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGG-- 118
              +  + G    +  G   F GY V       G E    +   +     +         
Sbjct: 67  --GFIPNNGPTHENQLGAGAFGGYQV---NPYVGFEMGYDWLGRMPYKGDNINGAYKAQG 121

Query: 119 -SLRIRGGYEVSDSLLLYATVGPDVAQKYET-----GKAGEITPIAIGGTAGVGVEVGGL 172
             L  + GY ++D L +Y  +G  V +         G + +     +      GVE   +
Sbjct: 122 VQLTAKLGYPITDDLDVYTRLGGMVWRADTKANVPGGASFKDHDTGVSPVFAGGVEY-AI 180

Query: 173 SESLVARLEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
           +  +  RLEY+ +        +    +   +SLGV  +F
Sbjct: 181 TPEIATRLEYQWTNNIGDAHTIGTRPDNGMLSLGVSYRF 219


>gi|299773253|gb|ADJ38701.1| outer membrane protein P5 [Haemophilus parasuis]
          Length = 365

 Score = 84.1 bits (206), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 44/228 (19%), Positives = 84/228 (36%), Gaps = 31/228 (13%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATN-RYVPIRHDFNGPYAG 59
           M+K  +A+ VS LA+AS   AQAA      + G +    T   +   +  ++  +  Y  
Sbjct: 1   MKKSLIALAVSGLAVASV--AQAAPQANTFYVGAKAGWATFHNDINQIDSKYANDARYDA 58

Query: 60  LSALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGS 119
            +  Y       + ++    +F GY + D+  +               +     H   G+
Sbjct: 59  TNLKYG-----ISRNSVTYGVFGGYQIIDNLAVELGYDYFGRVRGNKQEFRAFKHSAHGT 113

Query: 120 -LRIRGGYEVSDSLLLYATVGPD-----VAQKYETGKAGEITPIAIGGTAGVGVEVGGLS 173
            L ++  YEV + L +Y  VG         +   T +  +   +      G GVE   + 
Sbjct: 114 HLSLKPSYEVLNGLDVYGKVGAALVRNDYKRYSTTREPVKSHNLKTSLIVGAGVEY-AIL 172

Query: 174 ESLVARLEYRAS----KYSKVEG------------FYNTISLGVGMKF 205
             L  R+EY+       ++K E               ++++ G+  +F
Sbjct: 173 PELAFRVEYQWLSNVGNFTKAEAKENRRATYNYSPDSHSVTAGISYRF 220


>gi|91975762|ref|YP_568421.1| putative outer membrane protein [Rhodopseudomonas palustris BisB5]
 gi|91682218|gb|ABE38520.1| putative outer membrane protein [Rhodopseudomonas palustris BisB5]
          Length = 207

 Score = 84.1 bits (206), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 45/197 (22%), Positives = 71/197 (36%), Gaps = 22/197 (11%)

Query: 22  QAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSFGEEA---HHNAGG 78
           QAAD           V   +           + GPY G +  Y+      +        G
Sbjct: 20  QAADMGYYGSRTPYTVNQPLNA-------FSWAGPYLGGNLGYSFGNVTNSITKPSGFNG 72

Query: 79  SIFAGYNVEDSCIMYGVEGDVRYTVPVLA-DNIHSLHGIGGSLRIRGGYEVSDSLLLYAT 137
            +  GYN +   I++G+EGD++++            +   G+ R R GY ++D LL+YAT
Sbjct: 73  GVQGGYNWQSGNIVFGLEGDIQFSTADDTFAPYKFSNPWFGTARGRVGYAMND-LLIYAT 131

Query: 138 VGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFYN-- 195
            G    Q          +  + G T G G E    +  L A++EY     S    F    
Sbjct: 132 GGFAFGQLKGERLLSTESHSSAGWTVGAGAEF-AFAPKLSAKVEYLYGSLSTNNFFITGA 190

Query: 196 -------TISLGVGMKF 205
                   +  G+   F
Sbjct: 191 PNGYNFGVVRAGINYHF 207


>gi|209968936|gb|ACJ02829.1| outer membrane protein P5 [Haemophilus parasuis]
 gi|209968942|gb|ACJ02832.1| outer membrane protein P5 [Haemophilus parasuis]
 gi|209968946|gb|ACJ02834.1| outer membrane protein P5 [Haemophilus parasuis]
 gi|209968956|gb|ACJ02839.1| outer membrane protein P5 [Haemophilus parasuis]
 gi|209968958|gb|ACJ02840.1| outer membrane protein P5 [Haemophilus parasuis]
 gi|224714295|gb|ACN62142.1| outer membrane protein A [Haemophilus parasuis]
 gi|312270743|gb|ADQ55772.1| OmpA [Haemophilus parasuis]
          Length = 365

 Score = 84.1 bits (206), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 44/228 (19%), Positives = 84/228 (36%), Gaps = 31/228 (13%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATN-RYVPIRHDFNGPYAG 59
           M+K  +A+ VS LA+AS   AQAA      + G +    T   +   +  ++  +  Y  
Sbjct: 1   MKKSLIALAVSGLAVASV--AQAAPQANTFYVGAKAGWATFHNDINQIDSKYANDARYDA 58

Query: 60  LSALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGS 119
            +  Y       + ++    +F GY + D+  +               +     H   G+
Sbjct: 59  TNLKYG-----ISRNSVTYGVFGGYQIIDNLAVELGYDYFGRVRGNKQEFRAFKHSAHGT 113

Query: 120 -LRIRGGYEVSDSLLLYATVGPD-----VAQKYETGKAGEITPIAIGGTAGVGVEVGGLS 173
            L ++  YEV + L +Y  VG         +   T +  +   +      G GVE   + 
Sbjct: 114 HLSLKPSYEVLNGLDVYGKVGAALVRNDYKRYSTTREPVKSHNLKTSLIVGAGVEY-AIL 172

Query: 174 ESLVARLEYRAS----KYSKVEG------------FYNTISLGVGMKF 205
             L  R+EY+       ++K E               ++++ G+  +F
Sbjct: 173 PELAFRVEYQWLSNVGNFTKAEAKENRRATYNYSPDSHSVTAGISYRF 220


>gi|237815697|ref|ZP_04594694.1| Hypothetical protein, conserved [Brucella abortus str. 2308 A]
 gi|237788995|gb|EEP63206.1| Hypothetical protein, conserved [Brucella abortus str. 2308 A]
          Length = 222

 Score = 83.7 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 45/220 (20%), Positives = 79/220 (35%), Gaps = 26/220 (11%)

Query: 2   QKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLS 61
           ++   A  + +  +A   SA AAD +    +           +      HD++G Y G  
Sbjct: 13  KRSITAAALGAAVMAFAGSAFAADMMGGTDYT--------YNDPVAAGPHDWSGNYVGAQ 64

Query: 62  ALYNGSFGEE---AHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVP--VLADNIHSLHGI 116
              + S       +   A G I  G N+++  I++G E +  +      +          
Sbjct: 65  VGGSSSKFPSPFASRTGALGGIVVGKNMQNGNIVFGAELEGNFAEAEHRIGHGGTLQQSW 124

Query: 117 GGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESL 176
            G+ + + GY   D  L+Y T G  V +          +    G   G GVE   LS  L
Sbjct: 125 NGNAKGKVGYTF-DKTLVYGTAGYGVTRFKAKDNTTSASGWEGGVLIGAGVEQ-ALSGPL 182

Query: 177 VARLEYRASKYSKVEG-----------FYNTISLGVGMKF 205
             + EY   +++ V+              ++I  G+  KF
Sbjct: 183 SVKAEYDFQRFNDVKSQVNGIEQRNNLKNHSIKAGLNYKF 222


>gi|158536391|gb|ABW72720.1| outer membrane protein A [Escherichia coli]
 gi|158536395|gb|ABW72722.1| outer membrane protein A [Escherichia coli]
 gi|158536397|gb|ABW72723.1| outer membrane protein A [Escherichia coli]
          Length = 358

 Score = 83.7 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 37/219 (16%), Positives = 70/219 (31%), Gaps = 38/219 (17%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K   A+ ++         AQAA                     Y   +  ++  +   
Sbjct: 9   MKKT--AIAIAVALAGFATVAQAA---------------PKDNTWYTGAKLGWSQYHDT- 50

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGG-- 118
              +  + G    +  G   F GY V       G E    +   +     +         
Sbjct: 51  --GFIPNNGPTHENQLGAGAFGGYQV---NPYVGFEMGYDWLGRMPYKGDNINGAYKAQG 105

Query: 119 -SLRIRGGYEVSDSLLLYATVGPDVAQKYET-----GKAGEITPIAIGGTAGVGVEVGGL 172
             L  + GY ++D L +Y  +G  V +         G + +     +      GVE   +
Sbjct: 106 VQLTAKLGYPITDDLDVYTRLGGMVWRADTKANVPGGASFKDHDTGVSPVFAGGVEY-AI 164

Query: 173 SESLVARLEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
           +  +  RLEY+ +      + +    +   +SLGV  +F
Sbjct: 165 TPEIATRLEYQWTNNIGDANTIGTRPDNGLLSLGVSYRF 203


>gi|225627750|ref|ZP_03785787.1| Hypothetical protein, conserved [Brucella ceti str. Cudo]
 gi|225617755|gb|EEH14800.1| Hypothetical protein, conserved [Brucella ceti str. Cudo]
          Length = 222

 Score = 83.7 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 45/220 (20%), Positives = 78/220 (35%), Gaps = 26/220 (11%)

Query: 2   QKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLS 61
           ++   A  + +  +A   SA AAD +    +           +      HD++G Y G  
Sbjct: 13  KRSITAAALGAAVMAFAGSAFAADMMGGTDYT--------YNDPVAAGPHDWSGNYVGAR 64

Query: 62  ALYNGSFGEE---AHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVP--VLADNIHSLHGI 116
              + S       +   A G I  G N+++  I++G E +  +      +          
Sbjct: 65  VGGSSSKFPSPFASRTGALGGIVVGKNMQNGNIVFGAELEGNFAEAEHRIGHGGTLQQSW 124

Query: 117 GGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESL 176
            G+ + + GY   D  L+Y T G  V +               G   G GVE   LS  L
Sbjct: 125 NGNAKGKVGYAF-DKTLVYGTAGYGVTRFKAKDNTTSAPGWEGGVLIGAGVEQ-ALSGPL 182

Query: 177 VARLEYRASKYSKVEG-----------FYNTISLGVGMKF 205
             + EY   +++ V+              ++I  G+  KF
Sbjct: 183 SVKAEYDFQRFNDVKSQVNGIEQRNNLKNHSIKAGLNYKF 222


>gi|209968962|gb|ACJ02842.1| outer membrane protein P5 [Haemophilus parasuis]
          Length = 365

 Score = 83.7 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 45/228 (19%), Positives = 84/228 (36%), Gaps = 31/228 (13%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATN-RYVPIRHDFNGPYAG 59
           M+K  +A+ VS LA+AS   AQAA      + G +    T   +   +  ++  +  YA 
Sbjct: 1   MKKSLIALAVSGLAVASV--AQAAPQANTFYVGAKAGWATFHNDINQLNSKYKNDARYAT 58

Query: 60  LSALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGS 119
            +  Y         ++    +F GY + D+  +               +     H   G+
Sbjct: 59  SANGYV-----INRNSVTYGVFGGYQIIDNLAVELGYDYFGRVRGNKQEFRAFKHSAHGT 113

Query: 120 -LRIRGGYEVSDSLLLYATVGPD-----VAQKYETGKAGEITPIAIGGTAGVGVEVGGLS 173
            L ++  YEV + L +Y  VG         +   T +  +   +      G GVE   + 
Sbjct: 114 HLSLKPSYEVLNGLDVYGKVGAALVRNDYKRYSTTREPVKSHNLKTSLIVGAGVEY-AIL 172

Query: 174 ESLVARLEYRAS----KYSKVEG------------FYNTISLGVGMKF 205
             L  R+EY+       ++K E               ++++ G+  +F
Sbjct: 173 PELAFRVEYQWLSNVGNFTKAEAKENRRATYNYSPDSHSVTAGISYRF 220


>gi|300824154|ref|ZP_07104273.1| outer membrane protein A [Escherichia coli MS 119-7]
 gi|300925361|ref|ZP_07141248.1| outer membrane protein A [Escherichia coli MS 182-1]
 gi|301327213|ref|ZP_07220475.1| outer membrane protein A [Escherichia coli MS 78-1]
 gi|309795053|ref|ZP_07689473.1| outer membrane protein A [Escherichia coli MS 145-7]
 gi|300418528|gb|EFK01839.1| outer membrane protein A [Escherichia coli MS 182-1]
 gi|300523330|gb|EFK44399.1| outer membrane protein A [Escherichia coli MS 119-7]
 gi|300846194|gb|EFK73954.1| outer membrane protein A [Escherichia coli MS 78-1]
 gi|308121357|gb|EFO58619.1| outer membrane protein A [Escherichia coli MS 145-7]
          Length = 358

 Score = 83.7 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 38/219 (17%), Positives = 71/219 (32%), Gaps = 38/219 (17%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K  +A+ V+         AQAA                     Y   +  ++  +   
Sbjct: 9   MKKTAIAIAVALA--GFATVAQAA---------------PKDNTWYTGAKLGWSQYHDT- 50

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGG-- 118
              +  + G    +  G   F GY V       G E    +   +     +         
Sbjct: 51  --GFIPNNGPTHENQLGAGAFGGYQV---NPYVGFEMGYDWLGRMPYKGDNINGAYKAQG 105

Query: 119 -SLRIRGGYEVSDSLLLYATVGPDVAQKYET-----GKAGEITPIAIGGTAGVGVEVGGL 172
             L  + GY ++D L +Y  +G  V +         G + +     +      GVE   +
Sbjct: 106 VQLTAKLGYPITDDLDVYTRLGGMVWRADTKANVPGGASFKDHDTGVSPVFAGGVEY-AI 164

Query: 173 SESLVARLEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
           +  +  RLEY+ +      + +    +   +SLGV  +F
Sbjct: 165 TPEIATRLEYQWTNNIGDANTIGTRPDNGLLSLGVSYRF 203


>gi|332093647|gb|EGI98705.1| outer membrane protein A [Shigella boydii 3594-74]
          Length = 346

 Score = 83.7 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 37/212 (17%), Positives = 69/212 (32%), Gaps = 28/212 (13%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K  +A+ V+         AQAA                     Y   +  ++  +   
Sbjct: 1   MKKTAIAIAVALA--GFATVAQAA---------------PKDNTWYTGAKLGWSQYHDT- 42

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGSL 120
              +  + G    +  G   F GY V            +       +    +    G  L
Sbjct: 43  --GFINNNGPTHENQLGAGAFGGYQVNTYVGFEMGYDWLGRMPYKGSVENGAYKAQGVQL 100

Query: 121 RIRGGYEVSDSLLLYATVGPDVAQKYE-TGKAGEITPIAIGGTAGVGVEVGGLSESLVAR 179
             + GY ++D L +Y  +G  V +    +   G+     +      GVE   ++  +  R
Sbjct: 101 TAKLGYPITDDLDIYTRLGGMVWRADTKSNVYGKNHDTGVSPVFAGGVEY-AITPEIATR 159

Query: 180 LEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
           LEY+ +        +    +   +SLGV  +F
Sbjct: 160 LEYQWTNNIGDAHTIGTRPDNGMLSLGVSYRF 191


>gi|315619153|gb|EFU99733.1| outer membrane protein A [Escherichia coli 3431]
          Length = 346

 Score = 83.7 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 37/212 (17%), Positives = 69/212 (32%), Gaps = 28/212 (13%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K  +A+ V+         AQAA                     Y   +  ++  +   
Sbjct: 1   MKKTAIAIAVALA--GFATVAQAA---------------PKDNTWYTGAKLGWSQYHDT- 42

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGSL 120
              +  + G    +  G   F GY V            +       +    +    G  L
Sbjct: 43  --GFINNNGPTHENQLGAGAFGGYQVNPYVGFEMGYDWLGRMPYKGSVANGAYKAQGVQL 100

Query: 121 RIRGGYEVSDSLLLYATVGPDVAQKYE-TGKAGEITPIAIGGTAGVGVEVGGLSESLVAR 179
             + GY ++D L +Y  +G  V +    +   G+     +      GVE   ++  +  R
Sbjct: 101 TAKLGYPITDDLDIYTRLGGMVWRADTKSNVYGKNHDTGVSPVFAGGVEY-AITPEIATR 159

Query: 180 LEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
           LEY+ +        +    +   +SLGV  +F
Sbjct: 160 LEYQWTNNIGDAHTIGTRPDNGMLSLGVSYRF 191


>gi|218688793|ref|YP_002397005.1| outer membrane protein A [Escherichia coli ED1a]
 gi|218426357|emb|CAR07182.1| outer membrane protein A (3a;II*;G;d) [Escherichia coli ED1a]
          Length = 346

 Score = 83.7 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 37/212 (17%), Positives = 69/212 (32%), Gaps = 28/212 (13%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K  +A+ V+         AQAA                     Y   +  ++  +   
Sbjct: 1   MKKTAIAIAVALA--GFATVAQAA---------------PKDNTWYTGAKLGWSQYHDT- 42

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGSL 120
              +  + G    +  G   F GY V            +       +    +    G  L
Sbjct: 43  --GFIDNNGPTHENQLGAGAFGGYQVNPYVGFEMGYDWLGRMPYKGSVENGAYKAQGVQL 100

Query: 121 RIRGGYEVSDSLLLYATVGPDVAQKYE-TGKAGEITPIAIGGTAGVGVEVGGLSESLVAR 179
             + GY ++D L +Y  +G  V +    +   G+     +      GVE   ++  +  R
Sbjct: 101 TAKLGYPITDDLDVYTRLGGMVWRADTKSNVYGKNHDTGVSPVFAGGVEY-AITPEIATR 159

Query: 180 LEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
           LEY+ +        +    +   +SLGV  +F
Sbjct: 160 LEYQWTNNIGDAHTIGTRPDNGMLSLGVSYRF 191


>gi|317047599|ref|YP_004115247.1| OmpA domain-containing protein transmembrane region-containing
           protein [Pantoea sp. At-9b]
 gi|316949216|gb|ADU68691.1| OmpA domain protein transmembrane region-containing protein
           [Pantoea sp. At-9b]
          Length = 356

 Score = 83.7 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 38/220 (17%), Positives = 66/220 (30%), Gaps = 36/220 (16%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K   A+ ++         AQAA                     Y   +  ++  +   
Sbjct: 1   MKKT--AIAIAVALAGFATVAQAA---------------PKDDTWYTGAKLGWSQYHDTG 43

Query: 61  SAL--YNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGG 118
                Y  + G       G   F GY    +    G E    +   +             
Sbjct: 44  YYGNGYENNNGPTHESQLGAGAFLGYQ---ANPYLGFELGYDWLGRMPNKGSEINGAFKA 100

Query: 119 ---SLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAG----EITPIAIGGTAGVGVEVGG 171
               L  +  Y ++D L +Y  +G  V +   T              +   A VGVE   
Sbjct: 101 QGVQLAAKLSYPITDDLDVYTRLGGMVWRADSTQNNNGVRISDHDTGVSPLAAVGVEY-A 159

Query: 172 LSESLVARLEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
           L+++   RL+Y+          V    +   +S+GV  +F
Sbjct: 160 LTKNWATRLDYQWVNNIGDAGTVGARPDNSMLSVGVSYRF 199


>gi|209968912|gb|ACJ02817.1| outer membrane protein P5 [Haemophilus parasuis]
 gi|224714271|gb|ACN62130.1| outer membrane protein A [Haemophilus parasuis]
          Length = 365

 Score = 83.7 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 44/228 (19%), Positives = 85/228 (37%), Gaps = 31/228 (13%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATN-RYVPIRHDFNGPYAG 59
           M+K  +A+ VS LA+AS   A AA      + G +    T   +   +  +++ +  YA 
Sbjct: 1   MKKSLIALAVSGLAVASV--ANAAPQANSFYVGAKAGWATFHNDINQLNSKYENDARYAT 58

Query: 60  LSALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGS 119
            +  Y         ++    +F GY + D+  +               +     H   G+
Sbjct: 59  SANGYG-----INRNSVTYGVFGGYQIIDNLAVELGYDYFGRVRGNKQEFRAFKHSAHGT 113

Query: 120 -LRIRGGYEVSDSLLLYATVGPDVAQKYE-----TGKAGEITPIAIGGTAGVGVEVGGLS 173
            L ++  YEV + L +Y  VG  + +        T +  +   +      G GVE   + 
Sbjct: 114 HLSLKPSYEVLNGLDVYGKVGAALVRNDYKRYFQTREPVKSHNLKTSLIVGAGVEY-AIL 172

Query: 174 ESLVARLEYRAS----KYSKVEG------------FYNTISLGVGMKF 205
             L  R+EY+       ++K E               ++++ G+  +F
Sbjct: 173 PELAFRVEYQWLSNVGNFTKAEVKENRRATYNYSPDSHSVTAGISYRF 220


>gi|307942791|ref|ZP_07658136.1| porin [Roseibium sp. TrichSKD4]
 gi|307773587|gb|EFO32803.1| porin [Roseibium sp. TrichSKD4]
          Length = 183

 Score = 83.7 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 40/180 (22%), Positives = 69/180 (38%), Gaps = 25/180 (13%)

Query: 48  PIRHDFNGPYAGLSALYNGSFGEEAHHN---------AGGSIFAGYNVEDSCIMYGVEGD 98
           P  + + G Y G    YN   G++   +           G   AGYN      + GVE +
Sbjct: 7   PETNSWQGFYIGGHFGYNWMNGQDDLDDGIGTTSLSSVIGGFHAGYNHMFGQFLLGVEAE 66

Query: 99  VRYTVPVL--ADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITP 156
              +      A  + +      + R+R GY   +  L YAT G  +A    +G   + + 
Sbjct: 67  GNLSDLNGQTAGGLDASSNWMIAGRVRAGYAF-EHFLAYATAGVSMADASLSGTK-KSSN 124

Query: 157 IAIGGTAGVGVEVGGLSESLVARLEYRASKYS-----------KVEGFYNTISLGVGMKF 205
              G   G G+E   +++++ ARLEY+    +           KV+   + +  G+   F
Sbjct: 125 THTGLVVGGGLE-AFVTQNISARLEYQHHWLNEQSYNTNNTDYKVDAELDIVRAGLSYHF 183


>gi|300921002|ref|ZP_07137390.1| outer membrane protein A [Escherichia coli MS 115-1]
 gi|300412048|gb|EFJ95358.1| outer membrane protein A [Escherichia coli MS 115-1]
          Length = 358

 Score = 83.7 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 37/219 (16%), Positives = 70/219 (31%), Gaps = 38/219 (17%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K   A+ ++         AQAA                     Y   +  ++  +   
Sbjct: 9   MKKT--AIAIAVALAGFATVAQAA---------------PKDNTWYTGAKLGWSQYHDT- 50

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGG-- 118
              +  + G    +  G   F GY V       G E    +   +     +         
Sbjct: 51  --GFIPNNGPTHENQLGAGAFGGYQV---NPYVGFEMGYDWLGRMPYKGDNINGAYKAQG 105

Query: 119 -SLRIRGGYEVSDSLLLYATVGPDVAQKYET-----GKAGEITPIAIGGTAGVGVEVGGL 172
             L  + GY ++D L +Y  +G  V +         G + +     +      GVE   +
Sbjct: 106 VQLTAKLGYPITDDLDIYTRLGGMVWRADTKANVPGGASFKDHDTGVSPVFAGGVEY-AI 164

Query: 173 SESLVARLEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
           +  +  RLEY+ +      + +    +   +SLGV  +F
Sbjct: 165 TPEIATRLEYQWTNNIGDANTIGTRPDNGLLSLGVSYRF 203


>gi|312270721|gb|ADQ55761.1| OmpA [Haemophilus parasuis]
 gi|312270723|gb|ADQ55762.1| OmpA [Haemophilus parasuis]
          Length = 366

 Score = 83.7 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 44/228 (19%), Positives = 85/228 (37%), Gaps = 31/228 (13%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATN-RYVPIRHDFNGPYAG 59
           M+K  +A+ VS LA+AS   A AA      + G +    T   +   +  +++ +  YA 
Sbjct: 1   MKKSLIALAVSGLAVASV--ANAAPQANSFYVGAKAGWATFHNDINQLNSKYENDARYAT 58

Query: 60  LSALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGS 119
            +  Y         ++    +F GY + D+  +               +     H   G+
Sbjct: 59  SANGYG-----INRNSVTYGVFGGYQIIDNLAVELGYDYFGRVRGNKQEFRAFKHSAHGT 113

Query: 120 -LRIRGGYEVSDSLLLYATVGPDVAQKYE-----TGKAGEITPIAIGGTAGVGVEVGGLS 173
            L ++  YEV + L +Y  VG  + +        T +  +   +      G GVE   + 
Sbjct: 114 HLSLKPSYEVLNGLDVYGKVGAALVRNDYKRYFQTREPVKSHNLKTSLIVGAGVEY-AIL 172

Query: 174 ESLVARLEYRAS----KYSKVEG------------FYNTISLGVGMKF 205
             L  R+EY+       ++K E               ++++ G+  +F
Sbjct: 173 PELAFRVEYQWLSNVGNFTKAEVKENRRATYNYSPDSHSVTAGISYRF 220


>gi|300716120|ref|YP_003740923.1| outer membrane protein A [Erwinia billingiae Eb661]
 gi|299061956|emb|CAX59072.1| Outer membrane protein A [Erwinia billingiae Eb661]
          Length = 357

 Score = 83.7 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 39/219 (17%), Positives = 66/219 (30%), Gaps = 32/219 (14%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K  +A+ V+         AQAA                     Y   +  ++  +   
Sbjct: 1   MKKTAIAIAVALA--GFATVAQAA---------------PKDNTWYTGAKLGWSQYHDTG 43

Query: 61  SAL--YNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGG 118
                Y  + G       G   F GY              +            +    G 
Sbjct: 44  YYGNGYANNDGPTHESQLGAGAFGGYQANQYLGFELGYDWLGRMPNKGNVTNGAFKAQGV 103

Query: 119 SLRIRGGYEVSDSLLLYATVGPDVAQKY------ETGKAGEITPIAIGGTAGVGVEVGGL 172
            L  +  Y ++D L +Y  +G  V +         TG         +   A VGVE   L
Sbjct: 104 QLAAKLSYPITDDLDVYTRLGGMVWRADSTQQNTITGNRQSDHDTGVSPLAAVGVEY-AL 162

Query: 173 SESLVARLEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
           +++   RL+Y+          V    +   ++LGV  +F
Sbjct: 163 TQNWATRLDYQWVNNIGDAQTVGARPDNGMLALGVSYRF 201


>gi|222149200|ref|YP_002550157.1| outer membrane protein [Agrobacterium vitis S4]
 gi|221736185|gb|ACM37148.1| outer membrane protein [Agrobacterium vitis S4]
          Length = 212

 Score = 83.7 bits (205), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 47/201 (23%), Positives = 76/201 (37%), Gaps = 12/201 (5%)

Query: 15  LASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGP-YAGLSALYNGSFGEEAH 73
             S   A AAD V +       V    A +        + G  +   +    G+   +  
Sbjct: 14  FVSTGIAMAADAVDQVPTAPAAVETPAAFSWAGGYIGVYGGYGWLDATLSQGGASLSDNF 73

Query: 74  HNAGGSIFAGYNVEDS-CIMYGVEGDVRYTVPVLA-DNIHSLHGIGGSLRIRGGYEVSDS 131
                  F G+N +    ++ GVE DV Y         +     + GS R R GY + D 
Sbjct: 74  DGGRIGGFGGWNFDVGHNVILGVEADVNYDWNENNYSGVKVGMDVSGSARARAGYAI-DR 132

Query: 132 LLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYS--- 188
            L++   G    + Y    +G+      G T G GV+   ++  +  RLEYR + Y    
Sbjct: 133 ALIFVAGGWTADRTYIKSSSGDFNKTLNGWTIGAGVDY-AITNRIFTRLEYRYNDYGTKN 191

Query: 189 ----KVEGFYNTISLGVGMKF 205
                 +   N ++LG+G+KF
Sbjct: 192 ISGIDFDSKQNVVNLGIGIKF 212


>gi|224714303|gb|ACN62146.1| outer membrane protein A [Haemophilus parasuis]
 gi|224714305|gb|ACN62147.1| outer membrane protein A [Haemophilus parasuis]
 gi|224714307|gb|ACN62148.1| outer membrane protein A [Haemophilus parasuis]
          Length = 365

 Score = 83.7 bits (205), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 44/228 (19%), Positives = 84/228 (36%), Gaps = 31/228 (13%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATN-RYVPIRHDFNGPYAG 59
           M+K  +A+ VS LA+AS   A AA      + G +    T   +   +  ++  +  YA 
Sbjct: 1   MKKSLIALAVSGLAVASV--ANAAPQANSFYVGAKAGWATFHNDINQLNSKYKNDARYAT 58

Query: 60  LSALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGS 119
            +  Y         ++    +F GY + D+  +               +     H   G+
Sbjct: 59  SANGYG-----INRNSVTYGVFGGYQIIDNLAVELGYDYFGRVRGNKQEFRAFKHSAHGT 113

Query: 120 -LRIRGGYEVSDSLLLYATVGPDVAQKYE-----TGKAGEITPIAIGGTAGVGVEVGGLS 173
            L ++  YEV + L +Y  VG  + +        T +  +   +      G GVE   + 
Sbjct: 114 HLSLKPSYEVLNGLDVYGKVGAALVRNDYKRYFQTREPVKSHNLKTSLIVGAGVEY-AIL 172

Query: 174 ESLVARLEYRAS----KYSKVEG------------FYNTISLGVGMKF 205
             L  R+EY+       ++K E               ++++ G+  +F
Sbjct: 173 PELAFRVEYQWLSNVGNFTKAEVKENRRATYNYSPDSHSVTAGISYRF 220


>gi|83956056|ref|ZP_00964538.1| outer membrane protein [Sulfitobacter sp. NAS-14.1]
 gi|83839622|gb|EAP78801.1| outer membrane protein [Sulfitobacter sp. NAS-14.1]
          Length = 199

 Score = 83.7 bits (205), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 32/194 (16%), Positives = 57/194 (29%), Gaps = 15/194 (7%)

Query: 26  PVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSFGEEAHHNAGGSIFAGYN 85
              +A               Y     D N   A        S           ++ AGY+
Sbjct: 7   MAEQAPAPAWTGGYVGGNISYGFGSLDANDDLASALTTNGFSDNLSEPDGVSAALRAGYD 66

Query: 86  VEDSCIMYGVEGDVRYTVPVLA-------DNIHSLHGIGGSLRIRGGYEVSDSLLLYATV 138
            +    ++G+  +  +               +        ++  RGGY V D+ L Y  +
Sbjct: 67  WQFGRGVFGLGAEYNFGSYDGDGEGILAGSGVDVEIQDMATIFARGGYLVKDNFLAYGLL 126

Query: 139 GPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVE------- 191
           G   A+   +      +    G T G G E    +++     EY  + +  V+       
Sbjct: 127 GYSQAEGEVSLGGDSESEDLDGVTIGFGGEY-MFTQNWTGYAEYTYTDFGDVDNTDGQLE 185

Query: 192 GFYNTISLGVGMKF 205
                I  GV  +F
Sbjct: 186 ADLQQIKFGVNYRF 199


>gi|312270727|gb|ADQ55764.1| OmpA [Haemophilus parasuis]
          Length = 365

 Score = 83.7 bits (205), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 44/228 (19%), Positives = 83/228 (36%), Gaps = 31/228 (13%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATN-RYVPIRHDFNGPYAG 59
           M+K  +A+ VS LA+AS   A AA      + G +    T   +   +  ++  +  YA 
Sbjct: 1   MKKSLIALAVSGLAVASV--ANAAPQADSFYVGAKAGWATFHNDINQLNSKYKNDARYAT 58

Query: 60  LSALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGS 119
            +  Y         ++    +F GY + D+  +               +     H   G+
Sbjct: 59  SANGYG-----INRNSVTYGVFGGYQIIDNLAVELGYDYFGRVRGNKQEFREFKHSAHGT 113

Query: 120 -LRIRGGYEVSDSLLLYATVGPDVAQKYE-----TGKAGEITPIAIGGTAGVGVEVGGLS 173
            L ++  YEV   L +Y  VG  + +        T +  +   +      G GVE   + 
Sbjct: 114 HLSLKPSYEVLSGLDVYGKVGAALVRNDYKRYFQTREPVKSHNLKTSLIVGAGVEY-AIL 172

Query: 174 ESLVARLEYRAS----KYSKVEG------------FYNTISLGVGMKF 205
             L  R+EY+       ++K E               ++++ G+  +F
Sbjct: 173 PELAFRVEYQWLSNVGNFTKAEAKENRRATYNYSPDSHSVTAGISYRF 220


>gi|254714341|ref|ZP_05176152.1| 22 kDa outer membrane protein precursor [Brucella ceti M644/93/1]
 gi|261322117|ref|ZP_05961314.1| conserved hypothetical protein [Brucella ceti M644/93/1]
 gi|261294807|gb|EEX98303.1| conserved hypothetical protein [Brucella ceti M644/93/1]
          Length = 222

 Score = 83.3 bits (204), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 45/220 (20%), Positives = 78/220 (35%), Gaps = 26/220 (11%)

Query: 2   QKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLS 61
           ++   A  + +  +A   SA AAD +    +           +      HD++G Y G  
Sbjct: 13  KRSITAAALGAAVMAFAGSAFAADMMGGTDYT--------YNDPVAAGPHDWSGNYVGAR 64

Query: 62  ALYNGSFGEE---AHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVP--VLADNIHSLHGI 116
              + S       +   A G I  G N+++  I++G E +  +      +          
Sbjct: 65  VGGSSSKFPSPFASRTGALGGIVVGKNMQNGNIVFGAELEGNFAEAEHRIGHGGTLQQSW 124

Query: 117 GGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESL 176
            G+ + + GY   D  L+Y T G  V +               G   G GVE   LS  L
Sbjct: 125 NGNAKGKVGYAF-DKTLVYGTAGYGVTRFKAKDNTTSAPGWEGGVLIGAGVEQ-ALSGPL 182

Query: 177 VARLEYRASKYSKVEG-----------FYNTISLGVGMKF 205
             + EY   +++ V+              ++I  G+  KF
Sbjct: 183 SVKAEYDFQRFNDVKSQVNGIEQRNNLKNHSIKAGLNYKF 222


>gi|22852215|dbj|BAC16222.1| hypothetical protein [Bartonella henselae]
          Length = 265

 Score = 83.3 bits (204), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 45/262 (17%), Positives = 76/262 (29%), Gaps = 86/262 (32%)

Query: 10  VSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSFG 69
            S +AL S  +AQAAD +         +               + G Y G       S  
Sbjct: 1   TSVIALISASAAQAADVIVPHEVAPTVISAPA---------FSWTGFYIGGQVGNFSSKV 51

Query: 70  EEAH----------------HNAGGSIFAGYNVEDSC-IMYGVEGDVRYTVPVLADNIHS 112
           E                       G I+AG N+     ++ GVE D  +     A    +
Sbjct: 52  EITDPNKKDKLFSKDDTPKPSGFMGGIYAGSNMSLGNNMILGVETDAVWADREDAKTSSA 111

Query: 113 L-------------------------------------------HGIGGSLRIRGGYEVS 129
                                                           G+ R+R G+  +
Sbjct: 112 KVIREDELANFKDSLKNANAVFAKDKTMDDVKQDEKHTDSLALKEKWSGATRVRIGFTAA 171

Query: 130 DSLLLYATVGPDVAQKY----------------ETGKAGEITPIAIGGTAGVGVEVGGLS 173
           D ++ Y   G   AQ                   + +  + T   +G T G GV+   ++
Sbjct: 172 DRIMPYVAGGVSYAQVQAVSSTKVTQAADDAEIASAQLFDKTKTLVGFTLGGGVDF-AMT 230

Query: 174 ESLVARLEYRASKYSKVEGFYN 195
           ++++ R EYR S + K +   +
Sbjct: 231 DNVLLRAEYRYSDFGKEKFEKD 252


>gi|209968906|gb|ACJ02814.1| outer membrane protein P5 [Haemophilus parasuis]
 gi|209968938|gb|ACJ02830.1| outer membrane protein P5 [Haemophilus parasuis]
 gi|209968940|gb|ACJ02831.1| outer membrane protein P5 [Haemophilus parasuis]
 gi|209968948|gb|ACJ02835.1| outer membrane protein P5 [Haemophilus parasuis]
 gi|209968950|gb|ACJ02836.1| outer membrane protein P5 [Haemophilus parasuis]
 gi|209968952|gb|ACJ02837.1| outer membrane protein P5 [Haemophilus parasuis]
 gi|312270695|gb|ADQ55748.1| OmpA [Haemophilus parasuis]
 gi|312270697|gb|ADQ55749.1| OmpA [Haemophilus parasuis]
 gi|312270699|gb|ADQ55750.1| OmpA [Haemophilus parasuis]
 gi|312270701|gb|ADQ55751.1| OmpA [Haemophilus parasuis]
 gi|312270703|gb|ADQ55752.1| OmpA [Haemophilus parasuis]
 gi|312270705|gb|ADQ55753.1| OmpA [Haemophilus parasuis]
 gi|312270707|gb|ADQ55754.1| OmpA [Haemophilus parasuis]
 gi|312270709|gb|ADQ55755.1| OmpA [Haemophilus parasuis]
          Length = 365

 Score = 83.3 bits (204), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 44/228 (19%), Positives = 83/228 (36%), Gaps = 31/228 (13%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATN-RYVPIRHDFNGPYAG 59
           M+K  +A+ VS LA+AS   A AA      + G +    T   +   +  ++  +  YA 
Sbjct: 1   MKKSLIALAVSGLAVASV--ANAAPQADSFYVGAKAGWATFHNDINQLNSKYKNDARYAT 58

Query: 60  LSALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGS 119
            +  Y         ++    +F GY + D+  +               +     H   G+
Sbjct: 59  SANGYG-----INRNSVTYGVFGGYQIIDNLAVELGYDYFGRVRGNKQEFREFKHSAHGT 113

Query: 120 -LRIRGGYEVSDSLLLYATVGPDVAQKYE-----TGKAGEITPIAIGGTAGVGVEVGGLS 173
            L ++  YEV   L +Y  VG  + +        T +  +   +      G GVE   + 
Sbjct: 114 HLSLKPSYEVLSGLDVYGKVGAALVRNDYKRYFQTREPVKSHNLKTSLIVGAGVEY-AIL 172

Query: 174 ESLVARLEYRAS----KYSKVEG------------FYNTISLGVGMKF 205
             L  R+EY+       ++K E               ++++ G+  +F
Sbjct: 173 PELAFRVEYQWLSNVGNFTKAEMKENRRATYNYSPDSHSVTAGISYRF 220


>gi|288549451|ref|ZP_05967142.2| hypothetical protein ENTCAN_05522 [Enterobacter cancerogenus ATCC
           35316]
 gi|288319143|gb|EFC58081.1| outer membrane protein A [Enterobacter cancerogenus ATCC 35316]
          Length = 358

 Score = 83.3 bits (204), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 37/213 (17%), Positives = 63/213 (29%), Gaps = 26/213 (12%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAG- 59
           M+K  +A+ V+         AQAA                     Y   +  ++  +   
Sbjct: 9   MKKTAIAIAVALA--GFATVAQAA---------------PKDNTWYAGGKLGWSQFHDTG 51

Query: 60  LSALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGS 119
                  + G       G   F GY V            +        +   +    G  
Sbjct: 52  WYNSSLNNDGPTHESQLGAGAFGGYQVNPYVGFEMGYDWLGRMPYKGDNVNGAFKAQGVQ 111

Query: 120 LRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEIT-PIAIGGTAGVGVEVGGLSESLVA 178
           L  + GY V+D L +Y  +G  V +   +           +      GVE   ++  +  
Sbjct: 112 LTAKLGYPVTDDLDVYTRLGGMVWRADSSNSIAGDDHDTGVSPVFAGGVE-WAMTRDIAT 170

Query: 179 RLEYRASK------YSKVEGFYNTISLGVGMKF 205
           RLEY+            V      +S+GV  +F
Sbjct: 171 RLEYQWVNNIGDGATVGVRPDNGMLSVGVSYRF 203


>gi|170681860|ref|YP_001744213.1| outer membrane protein A [Escherichia coli SMS-3-5]
 gi|170519578|gb|ACB17756.1| outer membrane protein A [Escherichia coli SMS-3-5]
          Length = 358

 Score = 83.3 bits (204), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 38/219 (17%), Positives = 70/219 (31%), Gaps = 38/219 (17%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K  +A+ V+         AQAA                     Y   +  ++  +   
Sbjct: 9   MKKTAIAIAVALA--GFATVAQAA---------------PKDNTWYTGAKLGWSQYHDT- 50

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGG-- 118
              +  + G    +  G   F GY V       G E    +   +     +         
Sbjct: 51  --GFIPNNGPTHENQLGAGAFGGYQV---NPYVGFEMGYDWLGRMPYKGDNINGAYKAQG 105

Query: 119 -SLRIRGGYEVSDSLLLYATVGPDVAQKYET-----GKAGEITPIAIGGTAGVGVEVGGL 172
             L  + GY ++D L +Y  +G  V +         G + +     +      GVE   +
Sbjct: 106 VQLTAKLGYPITDDLDVYTRLGGMVWRADTKSNVPGGASTKDHDTGVSPVFAGGVEY-AI 164

Query: 173 SESLVARLEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
           +  +  RLEY+ +        +    +   +SLGV  +F
Sbjct: 165 TPEIATRLEYQWTNNIGDAHTIGTRPDNGMLSLGVSYRF 203


>gi|146339995|ref|YP_001205043.1| putative outer-membrane immunogenic protein [Bradyrhizobium sp.
           ORS278]
 gi|146192801|emb|CAL76806.1| conserved hypothetical protein; putative outer-membrane immunogenic
           protein precursor; putative secreted protein
           [Bradyrhizobium sp. ORS278]
          Length = 237

 Score = 83.3 bits (204), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 43/239 (17%), Positives = 74/239 (30%), Gaps = 46/239 (19%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+++FL+   +    A    A AAD   R +     + P  A        +D+ G Y G 
Sbjct: 1   MKRVFLS---AVALTALAVPAFAADMPARTYTKAPPMTPPQA-------IYDWTGFYIGG 50

Query: 61  SALYNGSFGEEAHHN---AGGSIFAGYNVED-SCIMYGVEGDVRYTVPVLAD-------- 108
                 + G     N     G +  G++ +     + G+E    +      +        
Sbjct: 51  HLGGAFAGGNGLEGNNARFLGGVQGGFDYQFAPNWVLGIEAQYSWMDRNTTNFGFPGATV 110

Query: 109 NIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKY--------ETGKAGEITPIAIG 160
              +     GS+  R GY    +LL YA  G                            G
Sbjct: 111 VTSTGANQLGSVTGRLGYTWGPALL-YAKGGYAWRDGNGLGVNVAGVPAGFTTSGNAKDG 169

Query: 161 GTAGVGVEVGGLSESLVARLEYRASKYSKVEGF--------------YNTISLGVGMKF 205
            T G G+E    + +  A+ EY+   +                     +T+ +GV  +F
Sbjct: 170 YTVGAGLEY-MFAPNWSAKAEYQYYNFGNTTFTGGPAPVVGSRFNNEDHTVKVGVNYRF 227


>gi|146340932|ref|YP_001205980.1| putative outer-membrane protein [Bradyrhizobium sp. ORS278]
 gi|146193738|emb|CAL77755.1| putative outer-membrane protein; putative secreted protein
           [Bradyrhizobium sp. ORS278]
          Length = 250

 Score = 83.3 bits (204), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 36/213 (16%), Positives = 65/213 (30%), Gaps = 34/213 (15%)

Query: 24  ADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSFGEEAHHNAGGSIFAG 83
           A  +  A       +           R D        +  + G+   + +    G +  G
Sbjct: 33  APVMAPAPLPTWAGLYLGLQGGGGWGRSDETFFGGPNAVGFAGTQRYDINGGFAGGV-IG 91

Query: 84  YNVEDSCIMYGVEGDVRYTVPVL---------ADNIHSLHGIGGSLRIRGGYEVSDSLLL 134
           YN +   I++G+EGD  +               D   +     G ++ R G+      L 
Sbjct: 92  YNWQVDNIVFGLEGDYHWADISGRSTEINLGAGDTYFTKLRGFGDIKGRLGWAAGP-ALF 150

Query: 135 YATVGPDVAQKYETGKAG--------EITPIAIGGTAGVGVEVGGLSESLVARLEYRASK 186
           + + G  V        AG          +    G T G G E    +++  A++EY    
Sbjct: 151 FVSGGAAVGDLQHRYDAGLFGPAFSASQSDWRWGWTIGAGAEY-MFAQNWSAKVEYNYLD 209

Query: 187 YSKV--------------EGFYNTISLGVGMKF 205
           + K                   +T+ +GV   F
Sbjct: 210 FGKSTLQYTPVAANRSEWNDTVHTVKVGVSYHF 242


>gi|209968954|gb|ACJ02838.1| outer membrane protein P5 [Haemophilus parasuis]
          Length = 365

 Score = 83.3 bits (204), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 44/228 (19%), Positives = 83/228 (36%), Gaps = 31/228 (13%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATN-RYVPIRHDFNGPYAG 59
           M+K  +A+ VS LA+AS   A AA      + G +    T   +   +  ++  +  YA 
Sbjct: 1   MKKSLIALAVSGLAVASV--ANAAPQADSFYVGAKAGWATFHNDINQLNSKYKNDARYAT 58

Query: 60  LSALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGS 119
            +  Y         ++    +F GY + D+  +               +     H   G+
Sbjct: 59  SANGYV-----INRNSVTYGVFGGYQIIDNLAVELGYDYFGRVRGNKQEFRAFKHSAHGT 113

Query: 120 -LRIRGGYEVSDSLLLYATVGPD-----VAQKYETGKAGEITPIAIGGTAGVGVEVGGLS 173
            L ++  YEV + L +Y  VG         +   T +  +   +      G GVE   + 
Sbjct: 114 HLSLKPSYEVLNGLDVYGKVGAALVRNDYKRYSTTREPVKSHNLKTSLIVGAGVEY-AIL 172

Query: 174 ESLVARLEYRAS----KYSKVEG------------FYNTISLGVGMKF 205
             L  R+EY+       ++K E               ++++ G+  +F
Sbjct: 173 PELAFRVEYQWLSNVGNFTKAEAKENRRATYNYSPDSHSVTAGISYRF 220


>gi|161619235|ref|YP_001593122.1| 22 kDa outer membrane protein precursor [Brucella canis ATCC 23365]
 gi|260566198|ref|ZP_05836668.1| outer membrane protein 22 [Brucella suis bv. 4 str. 40]
 gi|46251265|gb|AAS84603.1| Omp22 [Brucella canis]
 gi|161336046|gb|ABX62351.1| 22 kDa outer membrane protein precursor [Brucella canis ATCC 23365]
 gi|260155716|gb|EEW90796.1| outer membrane protein 22 [Brucella suis bv. 4 str. 40]
          Length = 212

 Score = 83.3 bits (204), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 46/220 (20%), Positives = 79/220 (35%), Gaps = 26/220 (11%)

Query: 2   QKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLS 61
           ++   A  + +  +AS  SA AAD +    +           +      HD++G Y G  
Sbjct: 3   KRSITAAALGAAVMASAGSAFAADMMGGTDYT--------YNDPVAAGPHDWSGNYVGAQ 54

Query: 62  ALYNGSFGEE---AHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVP--VLADNIHSLHGI 116
              + S       +   A G I  G N+++  I++G E +  +      +          
Sbjct: 55  VGGSSSKFPSPFASRTGALGGIVVGKNMQNGNIVFGAELEGNFAEAEHRIGHGGTLQQSW 114

Query: 117 GGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESL 176
            G+ + + GY   D  L+Y T G  V +               G   G GVE   LS  L
Sbjct: 115 NGNAKGKVGYAF-DKTLVYGTAGYGVTRFKAKDNTTSAPGWEGGVLIGAGVEQ-ALSGPL 172

Query: 177 VARLEYRASKYSKVEG-----------FYNTISLGVGMKF 205
             + EY   +++ V+              ++I  G+  KF
Sbjct: 173 SVKAEYDFQRFNDVKSQVNGIEQRNNLKNHSIKAGLNYKF 212


>gi|256018784|ref|ZP_05432649.1| outer membrane protein A [Shigella sp. D9]
          Length = 369

 Score = 83.3 bits (204), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 37/219 (16%), Positives = 69/219 (31%), Gaps = 38/219 (17%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K   A+ ++         AQAA                     Y   +  ++  +   
Sbjct: 20  MKKT--AIAIAVALAGFATVAQAA---------------PKDNTWYTGAKLGWSQYHDT- 61

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGG-- 118
              +  + G    +  G   F GY V       G E    +   +     +         
Sbjct: 62  --GFIPNNGPTHENQLGAGAFGGYQV---NPYVGFEMGYDWLGRMPYKGDNINGAYKAQG 116

Query: 119 -SLRIRGGYEVSDSLLLYATVGPDVAQKYET-----GKAGEITPIAIGGTAGVGVEVGGL 172
             L  + GY ++D L +Y  +G  V +         G + +     +      GVE   +
Sbjct: 117 VQLTAKLGYPITDDLDVYTRLGGMVWRADTKANVPGGASFKDHDTGVSPVFAGGVEY-AI 175

Query: 173 SESLVARLEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
           +  +  RLEY+ +        +    +   +SLGV  +F
Sbjct: 176 TPEIATRLEYQWTNNIGDAHTIGTRPDNGMLSLGVSYRF 214


>gi|209968920|gb|ACJ02821.1| outer membrane protein P5 [Haemophilus parasuis]
          Length = 365

 Score = 83.3 bits (204), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 44/228 (19%), Positives = 83/228 (36%), Gaps = 31/228 (13%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATN-RYVPIRHDFNGPYAG 59
           M+K  +A+ VS LA+AS   A AA      + G +    T   +   +  ++  +  YA 
Sbjct: 1   MKKSLIALAVSGLAVASV--ANAAPQANSFYVGAKAGWATFHNDINQLNSKYKNDARYAT 58

Query: 60  LSALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGS 119
            +  Y         ++    +F GY + D+  +               +     H   G+
Sbjct: 59  SANGYG-----INRNSVTYGVFGGYQIIDNLAVELGYDYFGRVRGNKQEFREFKHSAHGT 113

Query: 120 -LRIRGGYEVSDSLLLYATVGPDVAQKYE-----TGKAGEITPIAIGGTAGVGVEVGGLS 173
            L ++  YEV   L +Y  VG  + +        T +  +   +      G GVE   + 
Sbjct: 114 HLSLKPSYEVLSGLDVYGKVGAALVRNDYKRYFQTREPVKSHNLKTSLIVGAGVEY-AIL 172

Query: 174 ESLVARLEYRAS----KYSKVEG------------FYNTISLGVGMKF 205
             L  R+EY+       ++K E               ++++ G+  +F
Sbjct: 173 PELAFRVEYQWLSNVGNFTKAEMKENRRATYNYSPDSHSVTAGISYRF 220


>gi|238055498|sp|B7LNW7|OMPA_ESCF3 RecName: Full=Outer membrane protein A; AltName: Full=Outer
           membrane protein II; Flags: Precursor
          Length = 351

 Score = 83.3 bits (204), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 38/217 (17%), Positives = 72/217 (33%), Gaps = 33/217 (15%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K  +A+ V+         AQAA                     Y   +  ++  +   
Sbjct: 1   MKKTAIAIAVALA--GFATVAQAA---------------PKDNTWYTGAKLGWSQYHDT- 42

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGSL 120
              +  + G    +  G   F GY V            +       +    +    G  L
Sbjct: 43  --GFIDNNGPTHENQLGAGAFGGYQVNPYVGFEMGYDWLGRMPYKGSVENGAYKAQGVQL 100

Query: 121 RIRGGYEVSDSLLLYATVGPDVAQKYE------TGKAGEITPIAIGGTAGVGVEVGGLSE 174
             + GY ++D L +Y  +G  V +         TG++ +     +      GVE   ++ 
Sbjct: 101 TAKLGYPITDDLDIYTRLGGMVWRADTKAHNNVTGESEKNHDTGVSPVFAGGVE-WAITP 159

Query: 175 SLVARLEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
            +  RLEY+ +      + +    +   +SLGV  +F
Sbjct: 160 EIATRLEYQWTNNIGDANTIGTRPDNGLLSLGVSYRF 196


>gi|215486075|ref|YP_002328506.1| outer membrane protein A [Escherichia coli O127:H6 str. E2348/69]
 gi|215264147|emb|CAS08491.1| outer membrane protein A (3a; II*; G; d) [Escherichia coli O127:H6
           str. E2348/69]
          Length = 346

 Score = 83.3 bits (204), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 37/212 (17%), Positives = 69/212 (32%), Gaps = 28/212 (13%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K  +A+ V+         AQAA                     Y   +  ++  +   
Sbjct: 1   MKKTAIAIAVALA--GFATVAQAA---------------PKDNTWYTGAKLGWSQYHDT- 42

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGSL 120
              +  + G    +  G   F GY V            +       +    +    G  L
Sbjct: 43  --GFIPNNGPTHENQLGAGAFGGYQVNPYVGFEMGYDWLGRMPYKGSVENGAYKAQGVQL 100

Query: 121 RIRGGYEVSDSLLLYATVGPDVAQKYE-TGKAGEITPIAIGGTAGVGVEVGGLSESLVAR 179
             + GY ++D L +Y  +G  V +    +   G+     +      GVE   ++  +  R
Sbjct: 101 TAKLGYPITDDLDVYTRLGGMVWRADTKSNVYGKNHDTGVSPVFAGGVEY-AITPEIATR 159

Query: 180 LEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
           LEY+ +        +    +   +SLGV  +F
Sbjct: 160 LEYQWTNNIGDAHTIGTRPDNGMLSLGVSYRF 191


>gi|294141706|ref|YP_003557684.1| OmpA family protein [Shewanella violacea DSS12]
 gi|293328175|dbj|BAJ02906.1| OmpA family protein [Shewanella violacea DSS12]
          Length = 335

 Score = 83.3 bits (204), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 32/171 (18%), Positives = 60/171 (35%), Gaps = 20/171 (11%)

Query: 52  DFNGPYAGLSALYNGSFG-------EEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVP 104
           D +  Y G    +            +   +++    FAGY    +  +     D      
Sbjct: 17  DDSFFYLGAKGGWINYQNACEAQAVDCDANDSAWGGFAGYQFHRNWAVETGYNDFGQAGA 76

Query: 105 V------LADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIA 158
           V      L + I ++ G   SL+      ++++L L+   G        +G     +   
Sbjct: 77  VYPESGLLNEYIGTMKGWEFSLKGNL--PLTENLDLFGKAGTLRWDGENSGPFSYDSDDG 134

Query: 159 IGGTAGVGVEVGGLSESLVARLEYRASKYSKVE----GFYNTISLGVGMKF 205
                G+G+E   L+ S VAR+EY+       +       +  SLG+  +F
Sbjct: 135 WSPMVGIGLEY-KLTPSWVARVEYQYFDSVGSDKLGGSNMHFTSLGLSYRF 184


>gi|192359273|ref|YP_001981784.1| outer membrane protein A [Cellvibrio japonicus Ueda107]
 gi|190685438|gb|ACE83116.1| outer membrane protein A [Cellvibrio japonicus Ueda107]
          Length = 344

 Score = 83.3 bits (204), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 30/186 (16%), Positives = 62/186 (33%), Gaps = 18/186 (9%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M++LF  V + +++  +   A AA+                       I       Y+  
Sbjct: 1   MKRLF-TVLLCAISTITSYYA-AANSREEVETS---------------IYVGIRAGYSYN 43

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGSL 120
               + +  +    + G  +F GY++     +     D+  T    ++           +
Sbjct: 44  EGSCSSNHLKCDKSDTGYGLFIGYDINPRWAIETSFNDIGDTTATYSNAHLDGDLSQIDI 103

Query: 121 RIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARL 180
            ++  Y +  +L LY  VG         G+    +   +    G G+E   +SE    R+
Sbjct: 104 SVKYAYPIYQNLSLYGKVGAAYWDAKAKGQNVSFSDTGVSPLLGAGLE-LIISEHWKGRI 162

Query: 181 EYRASK 186
           EY+   
Sbjct: 163 EYQYID 168


>gi|312968985|ref|ZP_07783192.1| outer membrane protein A [Escherichia coli 2362-75]
 gi|312286387|gb|EFR14300.1| outer membrane protein A [Escherichia coli 2362-75]
          Length = 346

 Score = 83.3 bits (204), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 37/212 (17%), Positives = 69/212 (32%), Gaps = 28/212 (13%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K  +A+ V+         AQAA                     Y   +  ++  +   
Sbjct: 1   MKKTAIAIAVALA--GFATVAQAA---------------PKDNTWYTGAKLGWSQYHDT- 42

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGSL 120
              +  + G    +  G   F GY V            +       +    +    G  L
Sbjct: 43  --GFIPNNGPTHENQLGAGAFGGYQVNPYVGFEMGYDWLGRMPYKGSVKNGAYKAQGVQL 100

Query: 121 RIRGGYEVSDSLLLYATVGPDVAQKYE-TGKAGEITPIAIGGTAGVGVEVGGLSESLVAR 179
             + GY ++D L +Y  +G  V +    +   G+     +      GVE   ++  +  R
Sbjct: 101 TAKLGYPITDDLDVYTRLGGMVWRADTKSNVYGKNHDTGVSPVFAGGVEY-AITPEIATR 159

Query: 180 LEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
           LEY+ +        +    +   +SLGV  +F
Sbjct: 160 LEYQWTNNIGDAHTIGTRPDNGMLSLGVSYRF 191


>gi|309701236|emb|CBJ00536.1| outer membrane protein A [Escherichia coli ETEC H10407]
          Length = 346

 Score = 83.3 bits (204), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 35/212 (16%), Positives = 68/212 (32%), Gaps = 28/212 (13%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K  +A+ V+    A+   A                        Y   +  ++  +   
Sbjct: 1   MKKTAIAIAVALAGFATVAQA-----------------TPKDNTWYTGAKLGWSQYHDT- 42

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGSL 120
              +  + G    +  G   F GY V            +       +    +    G  L
Sbjct: 43  --GFINNNGPTHENQLGAGAFGGYQVNPYVGFEMGYDWLGRMPYKGSVENGAYKAQGVQL 100

Query: 121 RIRGGYEVSDSLLLYATVGPDVAQKYE-TGKAGEITPIAIGGTAGVGVEVGGLSESLVAR 179
             + GY ++D L +Y  +G  V +    +   G+     +      GVE   ++  +  R
Sbjct: 101 TAKLGYPITDDLDIYTRLGGMVWRADTKSNVYGKNHDTGVSPVFAGGVEY-AITPEIATR 159

Query: 180 LEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
           LEY+ +        +    +   +SLGV  +F
Sbjct: 160 LEYQWTNNIGDAHTIGTRPDNGMLSLGVSYRF 191


>gi|224714291|gb|ACN62140.1| outer membrane protein A [Haemophilus parasuis]
          Length = 365

 Score = 82.9 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 44/228 (19%), Positives = 85/228 (37%), Gaps = 31/228 (13%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATN-RYVPIRHDFNGPYAG 59
           M+K  +A+ VS LA+AS   AQAA      + G +    T   +   +  ++  +  Y  
Sbjct: 1   MKKSLIALAVSGLAVASV--AQAAPQANTFYVGAKAGWATFHNDINQIDSKYANDARYDA 58

Query: 60  LSALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGS 119
            +  Y       + ++    +F GY + D+  +               +     H   G+
Sbjct: 59  TNLKYG-----ISRNSVTYGVFGGYQIIDNLAVELGYDYFGRVRGNKQEFRAFKHSAHGT 113

Query: 120 -LRIRGGYEVSDSLLLYATVGPDVAQKYE-----TGKAGEITPIAIGGTAGVGVEVGGLS 173
            L ++  YEV + L +Y  VG  + +        T +  +   +      G GVE   + 
Sbjct: 114 HLSLKPSYEVLNGLDVYGKVGAALVRNDYKRYFQTREPVKSHNLKTSLIVGAGVEY-AIL 172

Query: 174 ESLVARLEYRAS----KYSKVEG------------FYNTISLGVGMKF 205
             L  R+EY+       ++K E               ++++ G+  +F
Sbjct: 173 PELAFRVEYQWLSNVGNFTKAEMKENRRATYNYSPDSHSVTAGISYRF 220


>gi|188534230|ref|YP_001908027.1| outer membrane protein A [Erwinia tasmaniensis Et1/99]
 gi|188029272|emb|CAO97149.1| Outer membrane protein A [Erwinia tasmaniensis Et1/99]
          Length = 355

 Score = 82.9 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 38/218 (17%), Positives = 66/218 (30%), Gaps = 31/218 (14%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K  +A+ V+         AQAA                     Y   +  ++  +   
Sbjct: 1   MKKTAIAIAVALA--GFATVAQAA---------------PKDDTWYTGGKLGWSQYHDTG 43

Query: 61  SAL--YNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGG 118
                Y  + G       G   F GY              +       +    +    G 
Sbjct: 44  YYGNGYQNNNGPTHESQLGAGAFLGYQANQYLGFELGYDWLGRMPNKGSVTNGAFKAQGV 103

Query: 119 SLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGE-----ITPIAIGGTAGVGVEVGGLS 173
            L  +  Y ++D L +Y  +G  V +   T               +   A VGVE   L+
Sbjct: 104 QLAAKLSYPIADDLDVYTRLGGMVWRADSTQTNPTYGRISNHDTGVSPLAAVGVEY-ALT 162

Query: 174 ESLVARLEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
           ++   RL+Y+          V    +   +S+GV  +F
Sbjct: 163 KNWATRLDYQWVNNIGDAGTVGTRPDNSMLSVGVSYRF 200


>gi|86749064|ref|YP_485560.1| outer membrane protein [Rhodopseudomonas palustris HaA2]
 gi|86572092|gb|ABD06649.1| outer membrane protein [Rhodopseudomonas palustris HaA2]
          Length = 254

 Score = 82.9 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 44/256 (17%), Positives = 70/256 (27%), Gaps = 53/256 (20%)

Query: 1   MQKLFLAVGVSSLALA-SFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNG---- 55
           M +L     V  +A       A AAD   +A        P+ +        H   G    
Sbjct: 1   MAQLGYGFAVLVVACGLGSSMALAADMAMKAPVKAVPYAPSPSWTGLYVGGHLGGGWVDE 60

Query: 56  ------PYAGLSALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLAD- 108
                   +       G+     H    G + AGYN +    + G+ GD  +T   +   
Sbjct: 61  TATFVSSTSINLIDPLGTSYPIDHSGFLGGVQAGYNYQIQNWVIGIAGDFSWTSAKVDTV 120

Query: 109 -----------NIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETG-------- 149
                      +  +      +   R GY   + LL Y   G         G        
Sbjct: 121 TASLLVPGAQVHTQAKTDWYATATGRVGYAFGN-LLAYGKGGAAWIHSVHGGFADFGAAG 179

Query: 150 --KAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYS------------------K 189
                ++T    G T GVG+E    +       EY    +                    
Sbjct: 180 IVPFSDVTTTRAGWTVGVGLE-WAFAPHWSVFGEYNYMDFGTRTYTFTNLADGGSTSNFD 238

Query: 190 VEGFYNTISLGVGMKF 205
           V+   + +  GV  +F
Sbjct: 239 VKTSVSLVKAGVNYRF 254


>gi|319898375|ref|YP_004158468.1| Hemin-binding protein E [Bartonella clarridgeiae 73]
 gi|319402339|emb|CBI75878.1| Hemin-binding protein E [Bartonella clarridgeiae 73]
          Length = 288

 Score = 82.9 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 47/296 (15%), Positives = 83/296 (28%), Gaps = 99/296 (33%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M    L +  S          QAAD +           P I ++        + G Y G 
Sbjct: 1   MNVTRLMIT-SIWIFVLASMVQAADIMIPYQQQSHQPAPMIVSSD-----FSWTGFYFGG 54

Query: 61  SALYNGSFGEEAH-------------------HNAGGSIFAGYNVEDSC-IMYGVEGDVR 100
                 S                             G ++AG NV     ++ G++ D+ 
Sbjct: 55  QVGGFSSKSTVRGRRNSDAEWESLEPKYLPKLSGVIGGVYAGSNVNFGNGLILGIDTDMA 114

Query: 101 YTVPVL-------------------------------------------------ADNIH 111
           ++                                                     + +  
Sbjct: 115 WSGKKDTKIIHREEQNEETVEEESTRRQENTRNNNSRVERSVQVCAVAEEGSNPVSSSHT 174

Query: 112 SLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYE-------------TGKAGEITPIA 158
                 G+ R+R G+ V D ++ Y + G    Q  +             T    + T + 
Sbjct: 175 LKEKWVGATRVRIGFAV-DRVMPYVSGGVAYTQLQDLLTIRKEGKELPITRNVIDDTKVF 233

Query: 159 IGGTAGVGVEVGGLSESLVARLEYRASKYSKVEG---------FYNTISLGVGMKF 205
           +G T G G++   +++S++ R EYR S + K +            N   +GV  KF
Sbjct: 234 VGYTFGGGIDF-AMAKSVILRAEYRYSDFGKKKFAKDKMEIGYKTNDFRVGVAYKF 288


>gi|320196555|gb|EFW71178.1| Outer membrane protein A precursor [Escherichia coli WV_060327]
 gi|330910729|gb|EGH39239.1| outer membrane protein A precursor [Escherichia coli AA86]
          Length = 358

 Score = 82.9 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 37/219 (16%), Positives = 69/219 (31%), Gaps = 38/219 (17%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K   A+ ++         AQAA                     Y   +  ++  +   
Sbjct: 9   MKKT--AIAIAVALAGFATVAQAA---------------PKDNTWYTGAKLGWSQYHDT- 50

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGG-- 118
              +  + G    +  G   F GY V       G E    +   +     +         
Sbjct: 51  --GFIPNNGPTHENQLGAGAFGGYQV---NPYVGFEMGYDWLGRMPYKGDNINGAYKAQG 105

Query: 119 -SLRIRGGYEVSDSLLLYATVGPDVAQKYET-----GKAGEITPIAIGGTAGVGVEVGGL 172
             L  + GY ++D L +Y  +G  V +         G + +     +      GVE   +
Sbjct: 106 VQLTAKLGYPITDDLDIYTRLGGMVWRADTKANVPGGASFKDHDTGVSPVFAGGVEY-AI 164

Query: 173 SESLVARLEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
           +  +  RLEY+ +        +    +   +SLGV  +F
Sbjct: 165 TPEIATRLEYQWTNNIGDAHTIGTRPDNGMLSLGVSYRF 203


>gi|209968902|gb|ACJ02812.1| outer membrane protein P5 [Haemophilus parasuis]
 gi|209968930|gb|ACJ02826.1| outer membrane protein P5 [Haemophilus parasuis]
 gi|224714289|gb|ACN62139.1| outer membrane protein A [Haemophilus parasuis]
          Length = 365

 Score = 82.9 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 44/228 (19%), Positives = 83/228 (36%), Gaps = 31/228 (13%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATN-RYVPIRHDFNGPYAG 59
           M+K  +A+ VS LA+AS   A AA      + G +    T   +   +  ++  +  YA 
Sbjct: 1   MKKSLIALAVSGLAVASV--ANAAPQANSFYVGAKAGWATFHNDINQLNSKYKNDARYAT 58

Query: 60  LSALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGS 119
            +  Y         ++    +F GY + D+  +               +     H   G+
Sbjct: 59  SANGYV-----INRNSVTYGVFGGYQIIDNLAVELGYDYFGRVRGNKQEFRAFKHSAHGT 113

Query: 120 -LRIRGGYEVSDSLLLYATVGPD-----VAQKYETGKAGEITPIAIGGTAGVGVEVGGLS 173
            L ++  YEV + L +Y  VG         +   T +  +   +      G GVE   + 
Sbjct: 114 HLSLKPSYEVLNGLDVYGKVGAALVRNDYKRYSTTREPVKSHNLKTSLIVGAGVEY-AIL 172

Query: 174 ESLVARLEYRAS----KYSKVEG------------FYNTISLGVGMKF 205
             L  R+EY+       ++K E               ++++ G+  +F
Sbjct: 173 PELAFRVEYQWLSNVGNFTKAEAKENRRATYNYSPDSHSVTAGISYRF 220


>gi|311280141|ref|YP_003942372.1| OmpA/MotB domain-containing protein [Enterobacter cloacae SCF1]
 gi|308749336|gb|ADO49088.1| OmpA/MotB domain protein [Enterobacter cloacae SCF1]
          Length = 362

 Score = 82.9 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 36/213 (16%), Positives = 64/213 (30%), Gaps = 26/213 (12%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAG- 59
           M+K  +A+ V+         AQAA                     Y   +  ++  +   
Sbjct: 12  MKKTAIAIAVALA--GFATVAQAA---------------PKDNTWYAGGKLGWSQFHDTG 54

Query: 60  LSALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGS 119
                  + G   +   G   F GY V            +            +    G  
Sbjct: 55  WYNDDLNNNGPTHNSQLGAGAFGGYQVNPYVGFEMGYDWLGRMPYKGDKVNGAFKAQGVQ 114

Query: 120 LRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEIT-PIAIGGTAGVGVEVGGLSESLVA 178
           L  + GY ++D L +Y  +G  + +   +           +      GVE   ++  +  
Sbjct: 115 LTAKLGYPITDDLDIYTRLGGMIWRADSSNSIAGDNHDTGVSPLVAGGVE-WAITRDIAT 173

Query: 179 RLEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
           RLEY+          V    +   +SLGV  +F
Sbjct: 174 RLEYQWVNNIGDAGTVGVRPDNGMLSLGVSYRF 206


>gi|209968928|gb|ACJ02825.1| outer membrane protein P5 [Haemophilus parasuis]
 gi|224714287|gb|ACN62138.1| outer membrane protein A [Haemophilus parasuis]
          Length = 365

 Score = 82.9 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 44/228 (19%), Positives = 84/228 (36%), Gaps = 31/228 (13%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATN-RYVPIRHDFNGPYAG 59
           M+K  +A+ VS LA+AS   A AA      + G +    T   +   +  ++  +  YA 
Sbjct: 1   MKKSLIALAVSGLAVASV--ANAAPQANSFYVGAKAGWATFHNDINQLNSKYANDARYAT 58

Query: 60  LSALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGS 119
            +  Y         ++    +F GY + D+  +               +     H   G+
Sbjct: 59  SANGYG-----INRNSVTYGVFGGYQIIDNLAVELGYDYFGRVRGNKQEFRAFKHSAHGT 113

Query: 120 -LRIRGGYEVSDSLLLYATVGPDVAQKYE-----TGKAGEITPIAIGGTAGVGVEVGGLS 173
            L ++  YEV + L +Y  VG  + +        T +  +   +      G GVE   + 
Sbjct: 114 HLSLKPSYEVLNGLDVYGKVGAALVRNDYKRYFQTREPVKSHNLKTSLIVGAGVEY-AIL 172

Query: 174 ESLVARLEYRAS----KYSKVEG------------FYNTISLGVGMKF 205
             L  R+EY+       ++K E               ++++ G+  +F
Sbjct: 173 PELAFRVEYQWLSNVGNFTKAEMKENRRATYNYSPDSHSVTAGISYRF 220


>gi|312270725|gb|ADQ55763.1| OmpA [Haemophilus parasuis]
          Length = 365

 Score = 82.9 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 44/228 (19%), Positives = 83/228 (36%), Gaps = 31/228 (13%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATN-RYVPIRHDFNGPYAG 59
           M+K  +A+ VS LA+AS   A AA      + G +    T   +   +  ++  +  YA 
Sbjct: 1   MKKSLIALAVSGLAVASV--ANAAPQADSFYVGAKAGWATFHNDINQLNFKYKNDARYAT 58

Query: 60  LSALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGS 119
            +  Y         ++    +F GY + D+  +               +     H   G+
Sbjct: 59  SANGYG-----INRNSVTYGVFGGYQIIDNLAVELGYDYFGRVRGNKQEFRAFKHSAHGT 113

Query: 120 -LRIRGGYEVSDSLLLYATVGPD-----VAQKYETGKAGEITPIAIGGTAGVGVEVGGLS 173
            L ++  YEV + L +Y  VG         +   T +  +   +      G GVE   + 
Sbjct: 114 HLSLKPSYEVLNGLDVYGKVGAALVRNDYKRYSTTREPVKSHNLNTSLIVGAGVEY-AIL 172

Query: 174 ESLVARLEYRAS----KYSKVEG------------FYNTISLGVGMKF 205
             L  R+EY+       ++K E               ++++ G+  +F
Sbjct: 173 PELAFRVEYQWLSNVGNFTKAEAKENRRATYNYSPDSHSVTAGISYRF 220


>gi|281600319|gb|ADA73303.1| Outer membrane protein A [Shigella flexneri 2002017]
          Length = 356

 Score = 82.9 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 38/219 (17%), Positives = 71/219 (32%), Gaps = 38/219 (17%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K  +A+ V+         AQAA                     Y   +  ++  +   
Sbjct: 9   MKKTAIAIAVALA--GFATVAQAA---------------PKDNTWYTGAKLGWSQYHDT- 50

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGG-- 118
              +  + G    +  G   F GY V       G E    +   +     +         
Sbjct: 51  --GFIPNNGPTHENQLGAGAFGGYQV---NPYVGFEMGYDWLGRMPYKGDNINGAYKAQG 105

Query: 119 -SLRIRGGYEVSDSLLLYATVGPDVAQKYET-----GKAGEITPIAIGGTAGVGVEVGGL 172
             L  + GY ++D L +Y  +G  V +         G + +     +      GVE   +
Sbjct: 106 VQLTAKLGYPITDDLDIYTRLGGMVWRADTKANVPGGASFKDHDTGVSPVFAGGVEY-AI 164

Query: 173 SESLVARLEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
           +  +  RLEY+ +      + +    +   +SLGV  +F
Sbjct: 165 TPEIATRLEYQWTNNIGDANTIGTRPDNGLLSLGVSYRF 203


>gi|158536385|gb|ABW72717.1| outer membrane protein A [Escherichia coli]
 gi|158536387|gb|ABW72718.1| outer membrane protein A [Escherichia coli]
 gi|158536389|gb|ABW72719.1| outer membrane protein A [Escherichia coli]
 gi|158536393|gb|ABW72721.1| outer membrane protein A [Escherichia coli]
 gi|158536399|gb|ABW72724.1| outer membrane protein A [Escherichia coli]
 gi|158536401|gb|ABW72725.1| outer membrane protein A [Escherichia coli]
          Length = 358

 Score = 82.9 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 37/219 (16%), Positives = 69/219 (31%), Gaps = 38/219 (17%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K   A+ ++         AQAA                     Y   +  ++  +   
Sbjct: 9   MKKT--AIAIAVALAGFATVAQAA---------------PKDNTWYTGAKLGWSQYHDT- 50

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGG-- 118
              +  + G    +  G   F GY V       G E    +   +     +         
Sbjct: 51  --GFIPNNGPTHENQLGAGAFGGYQV---NPYVGFEMGYDWLGRMPYKGDNINGAYKAQG 105

Query: 119 -SLRIRGGYEVSDSLLLYATVGPDVAQKYET-----GKAGEITPIAIGGTAGVGVEVGGL 172
             L  + GY ++D L +Y  +G  V +         G + +     +      GVE   +
Sbjct: 106 VQLTAKLGYPITDDLDVYTRLGGMVWRADTKANVPGGASFKDHDTGVSPVFAGGVEY-AI 164

Query: 173 SESLVARLEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
           +  +  RLEY+ +        +    +   +SLGV  +F
Sbjct: 165 TPEIATRLEYQWTNNIGDAHTIGTRPDNGMLSLGVSYRF 203


>gi|23502160|ref|NP_698287.1| hypothetical protein BR1284 [Brucella suis 1330]
 gi|163843547|ref|YP_001627951.1| 22 kDa outer membrane protein precursor [Brucella suis ATCC 23445]
 gi|254702018|ref|ZP_05163846.1| 22 kDa outer membrane protein precursor [Brucella suis bv. 5 str.
           513]
 gi|254704559|ref|ZP_05166387.1| 22 kDa outer membrane protein precursor [Brucella suis bv. 3 str.
           686]
 gi|256369703|ref|YP_003107213.1| hypothetical protein BMI_I1295 [Brucella microti CCM 4915]
 gi|261752584|ref|ZP_05996293.1| outer membrane protein 22 [Brucella suis bv. 5 str. 513]
 gi|261755243|ref|ZP_05998952.1| outer membrane protein 22 [Brucella suis bv. 3 str. 686]
 gi|294852619|ref|ZP_06793292.1| outer membrane protein [Brucella sp. NVSL 07-0026]
 gi|23348124|gb|AAN30202.1| membrane protein, putative [Brucella suis 1330]
 gi|157310303|emb|CAN43863.1| outer membrane protein 22 [Brucella microti CCM 4915]
 gi|157310305|emb|CAN43864.1| outer membrane protein 22 [Brucella microti]
 gi|163674270|gb|ABY38381.1| 22 kDa outer membrane protein precursor [Brucella suis ATCC 23445]
 gi|255999865|gb|ACU48264.1| hypothetical protein BMI_I1295 [Brucella microti CCM 4915]
 gi|261742337|gb|EEY30263.1| outer membrane protein 22 [Brucella suis bv. 5 str. 513]
 gi|261744996|gb|EEY32922.1| outer membrane protein 22 [Brucella suis bv. 3 str. 686]
 gi|294821208|gb|EFG38207.1| outer membrane protein [Brucella sp. NVSL 07-0026]
          Length = 212

 Score = 82.9 bits (203), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 45/220 (20%), Positives = 78/220 (35%), Gaps = 26/220 (11%)

Query: 2   QKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLS 61
           ++   A  + +  +A   SA AAD +    +           +      HD++G Y G  
Sbjct: 3   KRSITAAALGAAVMAFAGSAFAADMMGGTDYT--------YNDPVAAGPHDWSGNYVGAQ 54

Query: 62  ALYNGSFGEE---AHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVP--VLADNIHSLHGI 116
              + S       +   A G I  G N+++  I++G E +  +      +          
Sbjct: 55  VGGSSSKFPSPFASRTGALGGIVVGKNMQNGNIVFGAELEGNFAEAEHRIGHGGTLQQSW 114

Query: 117 GGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESL 176
            G+ + + GY   D  L+Y T G  V +               G   G GVE   LS  L
Sbjct: 115 NGNAKGKVGYAF-DKTLVYGTAGYGVTRFKAKDNTTSAPGWEGGVLIGAGVEQ-ALSGPL 172

Query: 177 VARLEYRASKYSKVEG-----------FYNTISLGVGMKF 205
             + EY   +++ V+              ++I  G+  KF
Sbjct: 173 SVKAEYDFQRFNDVKSQVNGIEQRNNLKNHSIKAGLNYKF 212


>gi|296445473|ref|ZP_06887430.1| putative outer-membrane immunogenic protein precursor [Methylosinus
           trichosporium OB3b]
 gi|296257039|gb|EFH04109.1| putative outer-membrane immunogenic protein precursor [Methylosinus
           trichosporium OB3b]
          Length = 210

 Score = 82.9 bits (203), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 37/172 (21%), Positives = 57/172 (33%), Gaps = 21/172 (12%)

Query: 50  RHDFNGPYAGLSALYNG---SFGEEAHHNAGGSIFAGYNVED-SCIMYGVEGDVRYTVPV 105
              + G Y GL+A       +     +    G    GYN++     + G+E D + T   
Sbjct: 41  VFSWTGAYVGLNAGGAFKADNGLGGDYSGVVGGGQIGYNLQLSPLFVVGLETDFQGTSLS 100

Query: 106 LAD--NIHSLHGIGGSLRIRGGYE-VSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGT 162
                         G++R R G       LL Y T G    +          +    G T
Sbjct: 101 RNTWFGQQVSLPWFGTVRGRVGVTLFDSQLLAYGTGGFAYGEVKA----PWSSDTHTGWT 156

Query: 163 AGVGVEVGGLSESLVARLEYRASKYSKVEG---------FYNTISLGVGMKF 205
           AG GVE      +  A++EY  +      G          ++T+  GV   F
Sbjct: 157 AGGGVE-WAFLPNWSAKVEYLYTDLQNNSGWGWVAPQRAKFHTVRAGVNYHF 207


>gi|319783214|ref|YP_004142690.1| porin [Mesorhizobium ciceri biovar biserrulae WSM1271]
 gi|317169102|gb|ADV12640.1| porin [Mesorhizobium ciceri biovar biserrulae WSM1271]
          Length = 221

 Score = 82.9 bits (203), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 44/227 (19%), Positives = 73/227 (32%), Gaps = 28/227 (12%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M++L +A             A AADP         G   T      +   + +      +
Sbjct: 1   MRRLMVASA--GFLAVLAVPAFAADPAVDVPMTAPGFDWTGYYAG-LQAGYGWGQSDISV 57

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLAD------NIHSLH 114
           +     S   +      G   AG   +    + G E D+ Y+               +  
Sbjct: 58  TEGAPFSIAPDIDGGFVGGHVAG-LWQFDQAVLGAEADLNYSSVGGTTVSALGSTFGTDI 116

Query: 115 GIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYET---GKAGEITPIAIGGTAGVGVEVGG 171
              GS+  + GY + D LL+Y   G   A    +   G A + T   +G T G GV+   
Sbjct: 117 KWFGSVNAKAGYAM-DRLLVYGIGGVAFAGIETSQVAGPAFDSTRTNVGWTVGAGVDY-A 174

Query: 172 LSESLVARLEYRASKYS-------------KVEGFYNTISLGVGMKF 205
           L++  V   +YR   +                    NT+ + +  KF
Sbjct: 175 LTDKFVVGAQYRYYDFGSEHYEVAEPFNDRDQNVKLNTVGINLSYKF 221


>gi|148255876|ref|YP_001240461.1| putative outer-membrane protein [Bradyrhizobium sp. BTAi1]
 gi|146408049|gb|ABQ36555.1| putative outer-membrane protein precursor [Bradyrhizobium sp.
           BTAi1]
          Length = 237

 Score = 82.9 bits (203), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 38/242 (15%), Positives = 70/242 (28%), Gaps = 50/242 (20%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+KL L      +       A AAD   R +      V        +   +D++G Y G+
Sbjct: 1   MKKLLLTTTALVVL---ASPALAADLAARPYTKAPPPV--------MAAIYDWSGFYIGV 49

Query: 61  SALYNGSF-----------GEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLAD- 108
           +     +            G             GY  +    ++GVE    +      + 
Sbjct: 50  NGGGGWTHNTWDVVGGGREGSHDSSGGTIGGQVGYRWQMGQFVFGVEAQGNWADFAGDNQ 109

Query: 109 ------NIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKA-------GEIT 155
                    +     G    + GY  ++ +L+YA  G  +     T          G   
Sbjct: 110 SALFGTRNRTKTDAFGLFTGQVGYAFNN-VLVYAKGGAAITSNTYTITNAATGAFLGSND 168

Query: 156 PIAIGGTAGVGVEVGGLSESLVARLEYRASKY------------SKVEGFYNTISLGVGM 203
               GG  G G+E G  + +    +EY                   ++   +  +  +  
Sbjct: 169 NTRWGGVVGAGLEYGF-APNWSLGVEYDHLFMDRQTVSFGALGSDSIKQDADLFTARLNY 227

Query: 204 KF 205
           +F
Sbjct: 228 RF 229


>gi|300902879|ref|ZP_07120825.1| outer membrane protein A [Escherichia coli MS 84-1]
 gi|301302427|ref|ZP_07208558.1| outer membrane protein A [Escherichia coli MS 124-1]
 gi|300405092|gb|EFJ88630.1| outer membrane protein A [Escherichia coli MS 84-1]
 gi|300842266|gb|EFK70026.1| outer membrane protein A [Escherichia coli MS 124-1]
 gi|315258005|gb|EFU37973.1| outer membrane protein A [Escherichia coli MS 85-1]
          Length = 358

 Score = 82.9 bits (203), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 37/219 (16%), Positives = 69/219 (31%), Gaps = 38/219 (17%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K   A+ ++         AQAA                     Y   +  ++  +   
Sbjct: 9   MKKT--AIAIAVALAGFATVAQAA---------------PKDNTWYTGAKLGWSQYHDT- 50

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGG-- 118
              +  + G    +  G   F GY V       G E    +   +     +         
Sbjct: 51  --GFIPNNGPTHENQLGAGAFGGYQV---NPYVGFEMGYDWLGRMPYKGDNINGAYKAQG 105

Query: 119 -SLRIRGGYEVSDSLLLYATVGPDVAQKYET-----GKAGEITPIAIGGTAGVGVEVGGL 172
             L  + GY ++D L +Y  +G  V +         G + +     +      GVE   +
Sbjct: 106 VQLTAKLGYPITDDLDVYTRLGGMVWRADTKANVPGGASFKDHDTGVSPVFAGGVEY-AI 164

Query: 173 SESLVARLEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
           +  +  RLEY+ +        +    +   +SLGV  +F
Sbjct: 165 TPEIATRLEYQWTNNIGDAHTIGTRPDNGMLSLGVSYRF 203


>gi|146340934|ref|YP_001205982.1| putative outer-membrane protein [Bradyrhizobium sp. ORS278]
 gi|146193740|emb|CAL77757.1| putative outer-membrane protein; putative secreted protein
           [Bradyrhizobium sp. ORS278]
          Length = 261

 Score = 82.9 bits (203), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 43/228 (18%), Positives = 68/228 (29%), Gaps = 37/228 (16%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           MQK  L +  +S+AL     A AAD   R +              +       NG     
Sbjct: 1   MQKTAL-ITTASVALLGLAPASAADFATRPYGKAPPPAYVTPLPSWAGFYLGLNGGADWS 59

Query: 61  SALYN------------GSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLAD 108
              +              S G     +       GY  + +  ++G+E    +T    ++
Sbjct: 60  RNCWTLNNVGGVPVAPRQSEGCHNASSGLIGGQVGYRWQAASWVFGLEAQGNWTDLKSSN 119

Query: 109 ----------NIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKA------- 151
                        +     G    + GY   D++L Y   G  VA    TG A       
Sbjct: 120 ASTAALAAGITNTTKTDAIGLFTGQVGYAW-DNVLWYVKGGAAVAHNKYTGTANAAAPVA 178

Query: 152 -----GEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFY 194
                   +    GGT G GVE G  + +    +EY        +  +
Sbjct: 179 VGTLLDSASETRWGGTVGTGVEYGF-APNWSVAVEYDHLFMGSRDISF 225


>gi|157159269|ref|YP_001462189.1| outer membrane protein A [Escherichia coli E24377A]
 gi|331667340|ref|ZP_08368205.1| outer membrane protein A [Escherichia coli TA271]
 gi|51235576|gb|AAT98589.1| outer membrane protein A [Escherichia coli]
 gi|157081299|gb|ABV21007.1| outer membrane protein A [Escherichia coli E24377A]
 gi|331065696|gb|EGI37589.1| outer membrane protein A [Escherichia coli TA271]
          Length = 350

 Score = 82.9 bits (203), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 38/219 (17%), Positives = 71/219 (32%), Gaps = 38/219 (17%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K  +A+ V+         AQAA                     Y   +  ++  +   
Sbjct: 1   MKKTAIAIAVALA--GFATVAQAA---------------PKDNTWYTGAKLGWSQYHDT- 42

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGG-- 118
              +  + G    +  G   F GY V       G E    +   +     +         
Sbjct: 43  --GFIPNNGPTHENQLGAGAFGGYQV---NPYVGFEMGYDWLGRMPYKGDNINGAYKAQG 97

Query: 119 -SLRIRGGYEVSDSLLLYATVGPDVAQKYET-----GKAGEITPIAIGGTAGVGVEVGGL 172
             L  + GY ++D L +Y  +G  V +         G + +     +      GVE   +
Sbjct: 98  VQLTAKLGYPITDDLDVYTRLGGMVWRADTKANVPGGASFKDHDTGVSPVFAGGVEY-AI 156

Query: 173 SESLVARLEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
           +  +  RLEY+ +      + +    +   +SLGV  +F
Sbjct: 157 TPEIATRLEYQWTNNIGDANTIGTRPDNGLLSLGVSYRF 195


>gi|296446453|ref|ZP_06888397.1| putative outer-membrane immunogenic protein precursor [Methylosinus
           trichosporium OB3b]
 gi|296256088|gb|EFH03171.1| putative outer-membrane immunogenic protein precursor [Methylosinus
           trichosporium OB3b]
          Length = 210

 Score = 82.9 bits (203), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 44/221 (19%), Positives = 69/221 (31%), Gaps = 38/221 (17%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K   A+  + + LA     +AAD             P           + ++G YAGL
Sbjct: 1   MRKTVSALASTFVLLAGD--VRAADLP-----------PQATVFGGARPAYAWSGVYAGL 47

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSC-IMYGVEGDVRYTVPVLADNIHS----LHG 115
           +     S          G    GYN       + G+E D + T        +        
Sbjct: 48  NLGAGLSASGLDRSGILGGGQLGYNYRLGPLFVVGLETDFQGTSLGGDSGRYGFPSPRFD 107

Query: 116 IGGSLRIRGG-YEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSE 174
             G+ R R G    SD LL + T G             +   +  G TAG G+E    + 
Sbjct: 108 WFGTARGRVGVLPFSDHLLFFGTGGYAYGH--------DGDRMHDGWTAGGGLE-WAFAR 158

Query: 175 SLVARLEYRASKYSKVE----------GFYNTISLGVGMKF 205
               + EY  + +                ++ +  GV   F
Sbjct: 159 DWSVKAEYLYTDFGAGGQPRFPAPRRVDDFHFMRAGVNYHF 199


>gi|284920801|emb|CBG33864.1| outer membrane protein A [Escherichia coli 042]
          Length = 350

 Score = 82.9 bits (203), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 37/219 (16%), Positives = 69/219 (31%), Gaps = 38/219 (17%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K  +A+ V+         AQAA                     Y   +  ++  +   
Sbjct: 1   MKKTAIAIAVALA--GFATVAQAA---------------PKDNTWYTGAKLGWSQYHDT- 42

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGG-- 118
              +  + G    +  G   F GY V       G E    +   +     +         
Sbjct: 43  --GFIDNNGPTHENQLGAGAFGGYQV---NPYVGFEMGYDWLGRMPYKGDNINGAYKAQG 97

Query: 119 -SLRIRGGYEVSDSLLLYATVGPDVAQKYETGK-----AGEITPIAIGGTAGVGVEVGGL 172
             L  + GY ++D L +Y  +G  V +           + +     +      GVE   +
Sbjct: 98  VQLTAKLGYPITDDLDVYTRLGGMVWRADTKSNVPGGVSTKDHDTGVSPVFAGGVEY-AI 156

Query: 173 SESLVARLEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
           +  +  RLEY+ +        +    +   +SLGV  +F
Sbjct: 157 TPEIATRLEYQWTNNIGDAHTIGTRPDNGMLSLGVSYRF 195


>gi|209968910|gb|ACJ02816.1| outer membrane protein P5 [Haemophilus parasuis]
 gi|209968944|gb|ACJ02833.1| outer membrane protein P5 [Haemophilus parasuis]
 gi|224714273|gb|ACN62131.1| outer membrane protein A [Haemophilus parasuis]
 gi|224714279|gb|ACN62134.1| outer membrane protein A [Haemophilus parasuis]
          Length = 365

 Score = 82.5 bits (202), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 44/228 (19%), Positives = 83/228 (36%), Gaps = 31/228 (13%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATN-RYVPIRHDFNGPYAG 59
           M+K  +A+ VS LA+AS   A AA      + G +    T   +   +  ++  +  YA 
Sbjct: 1   MKKSLIALAVSGLAVASV--ANAAPQADSFYVGAKAGWATFHNDINQLNFKYKNDARYAT 58

Query: 60  LSALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGS 119
            +  Y         ++    +F GY + D+  +               +     H   G+
Sbjct: 59  SANGYG-----INRNSVTYGVFGGYQIIDNLAVELGYDYFGRVRGNKQEFREFKHSAHGT 113

Query: 120 -LRIRGGYEVSDSLLLYATVGPDVAQKYE-----TGKAGEITPIAIGGTAGVGVEVGGLS 173
            L ++  YEV   L +Y  VG  + +        T +  +   +      G GVE   + 
Sbjct: 114 HLSLKPSYEVLSGLDVYGKVGAALVRNDYKRYFQTREPVKSHNLKTSLIVGAGVEY-AIL 172

Query: 174 ESLVARLEYRAS----KYSKVEG------------FYNTISLGVGMKF 205
             L  R+EY+       ++K E               ++++ G+  +F
Sbjct: 173 PELAFRVEYQWLSNVGNFTKAEMKENRRATYNYSPDSHSVTAGISYRF 220


>gi|293414237|ref|ZP_06656886.1| OOP family OmpA-OmpF porin [Escherichia coli B185]
 gi|291434295|gb|EFF07268.1| OOP family OmpA-OmpF porin [Escherichia coli B185]
          Length = 350

 Score = 82.5 bits (202), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 37/216 (17%), Positives = 70/216 (32%), Gaps = 32/216 (14%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K  +A+ V+         AQAA                     Y   +  ++  +   
Sbjct: 1   MKKTAIAIAVALA--GFATVAQAA---------------PKDNTWYTGAKLGWSQYHDT- 42

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGSL 120
              +  + G    +  G   F GY V            +        +   +    G  L
Sbjct: 43  --GFIPNNGPTHENQLGAGAFGGYQVNPYVGFEMGYDWLGRMPYKGDNINGAYKAQGVQL 100

Query: 121 RIRGGYEVSDSLLLYATVGPDVAQKYET-----GKAGEITPIAIGGTAGVGVEVGGLSES 175
             + GY ++D L +Y  +G  V +         G + +     +      GVE   ++  
Sbjct: 101 TAKLGYPITDDLDIYTRLGGMVWRADTKANVPGGASFKDHDTGVSPVFAGGVEY-AITPE 159

Query: 176 LVARLEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
           +  RLEY+ +      + +    +   +SLGV  +F
Sbjct: 160 IATRLEYQWTNNIGDANTIGTRPDNGLLSLGVSYRF 195


>gi|300937693|ref|ZP_07152496.1| outer membrane protein A [Escherichia coli MS 21-1]
 gi|301023085|ref|ZP_07186892.1| outer membrane protein A [Escherichia coli MS 69-1]
 gi|300397206|gb|EFJ80744.1| outer membrane protein A [Escherichia coli MS 69-1]
 gi|300457294|gb|EFK20787.1| outer membrane protein A [Escherichia coli MS 21-1]
          Length = 358

 Score = 82.5 bits (202), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 37/219 (16%), Positives = 69/219 (31%), Gaps = 38/219 (17%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K   A+ ++         AQAA                     Y   +  ++  +   
Sbjct: 9   MKKT--AIAIAVALAGFATVAQAA---------------PKDNTWYTGAKLGWSQYHDT- 50

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGG-- 118
              +  + G    +  G   F GY V       G E    +   +     +         
Sbjct: 51  --GFIPNNGPTHENQLGAGAFGGYQV---NPYVGFEMGYDWLGRMPYKGDNINGAYKAQG 105

Query: 119 -SLRIRGGYEVSDSLLLYATVGPDVAQKYET-----GKAGEITPIAIGGTAGVGVEVGGL 172
             L  + GY ++D L +Y  +G  V +         G + +     +      GVE   +
Sbjct: 106 VQLTAKLGYPITDDLDIYTRLGGMVWRADTKANVPGGASFKDHDTGVSPVFAGGVEY-AI 164

Query: 173 SESLVARLEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
           +  +  RLEY+ +        +    +   +SLGV  +F
Sbjct: 165 TPEIATRLEYQWTNNIGDAHTIGTRPDNGMLSLGVSYRF 203


>gi|146311126|ref|YP_001176200.1| outer membrane protein A [Enterobacter sp. 638]
 gi|145318002|gb|ABP60149.1| OmpA domain protein transmembrane region-containing protein
           [Enterobacter sp. 638]
          Length = 351

 Score = 82.5 bits (202), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 37/213 (17%), Positives = 65/213 (30%), Gaps = 26/213 (12%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAG- 59
           M+K  +A+ V+         AQAA                     Y   +  ++  +   
Sbjct: 1   MKKTAIAIAVALA--GFATVAQAA---------------PKDNTWYAGGKLGWSQFHDTG 43

Query: 60  LSALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGS 119
                  + G       G   F GY V            +        +   +    G  
Sbjct: 44  WYNSSLNNDGPTHESQLGAGAFGGYQVNPYVGFEMGYDWLGRMPYKGDNVNGAFKAQGVQ 103

Query: 120 LRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEIT-PIAIGGTAGVGVEVGGLSESLVA 178
           L  + GY V+D L +Y  +G  V +   +           +      GVE   ++  +  
Sbjct: 104 LTAKLGYPVTDDLDVYTRLGGMVWRADSSNSIAGDDHDTGVSPVFAGGVE-WAMTRDIAT 162

Query: 179 RLEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
           RLEY+        + V    +   +S+GV  +F
Sbjct: 163 RLEYQWVNNIGDGNTVGVRPDNGMLSVGVSYRF 195


>gi|256061359|ref|ZP_05451503.1| 22 kDa outer membrane protein precursor [Brucella neotomae 5K33]
 gi|261325360|ref|ZP_05964557.1| Omp22 [Brucella neotomae 5K33]
 gi|46251267|gb|AAS84604.1| Omp22 [Brucella neotomae]
 gi|261301340|gb|EEY04837.1| Omp22 [Brucella neotomae 5K33]
          Length = 212

 Score = 82.5 bits (202), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 45/220 (20%), Positives = 78/220 (35%), Gaps = 26/220 (11%)

Query: 2   QKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLS 61
           ++   A  + +  +A   SA AAD +    +           +      HD++G Y G  
Sbjct: 3   KRSITAAALGAAVMAFAGSAFAADMMGGTDYT--------YNDPVAAGLHDWSGNYVGAQ 54

Query: 62  ALYNGSFGEE---AHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVP--VLADNIHSLHGI 116
              + S       +   A G I  G N+++  I++G E +  +      +          
Sbjct: 55  VGGSSSKFPSPFASRTGALGGIVVGKNMQNGNIVFGAELEGNFAEAEHRIGHGGTLQQSW 114

Query: 117 GGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESL 176
            G+ + + GY   D  L+Y T G  V +               G   G GVE   LS  L
Sbjct: 115 NGNAKGKVGYAF-DKTLVYGTAGYGVTRFKAKDNTTSAPGWEGGVLIGAGVEQ-ALSGPL 172

Query: 177 VARLEYRASKYSKVEG-----------FYNTISLGVGMKF 205
             + EY   +++ V+              ++I  G+  KF
Sbjct: 173 SVKAEYDFQRFNDVKSQVNGIEQRNNLKNHSIKAGLNYKF 212


>gi|332092496|gb|EGI97569.1| outer membrane protein A [Shigella boydii 5216-82]
 gi|332095872|gb|EGJ00879.1| outer membrane protein A [Shigella dysenteriae 155-74]
          Length = 351

 Score = 82.5 bits (202), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 38/217 (17%), Positives = 71/217 (32%), Gaps = 33/217 (15%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K  +A+ V+         AQAA                     Y   +  ++  +   
Sbjct: 1   MKKTAIAIAVALA--GFATVAQAA---------------PKDNTWYTGAKLGWSQYHDT- 42

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGSL 120
              +  + G    +  G   F GY V            +       +    +    G  L
Sbjct: 43  --GFIDNNGPTHENQLGAGAFGGYQVNPYVGFEMGYDWLGRMPYKGSVENGAYKAQGVQL 100

Query: 121 RIRGGYEVSDSLLLYATVGPDVAQKYE------TGKAGEITPIAIGGTAGVGVEVGGLSE 174
             + GY ++D L +Y  +G  V +         TG++ +     +      GVE   ++ 
Sbjct: 101 TAKLGYPITDDLDVYTRLGGMVWRADTKAHNNVTGESEKNHDTGVSPVFAGGVE-WAITP 159

Query: 175 SLVARLEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
            +  RLEY+ +        +    +   +SLGV  +F
Sbjct: 160 EIATRLEYQWTNNIGDAHTIGTRPDNGLLSLGVSYRF 196


>gi|323462898|pdb|3NB3|A Chain A, The Host Outer Membrane Proteins Ompa And Ompc Are Packed
           At Specific Sites In The Shigella Phage Sf6 Virion As
           Structural Components
 gi|323462899|pdb|3NB3|B Chain B, The Host Outer Membrane Proteins Ompa And Ompc Are Packed
           At Specific Sites In The Shigella Phage Sf6 Virion As
           Structural Components
 gi|323462900|pdb|3NB3|C Chain C, The Host Outer Membrane Proteins Ompa And Ompc Are Packed
           At Specific Sites In The Shigella Phage Sf6 Virion As
           Structural Components
          Length = 346

 Score = 82.5 bits (202), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 37/212 (17%), Positives = 69/212 (32%), Gaps = 28/212 (13%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K  +A+ V+         AQAA                     Y   +  ++  +   
Sbjct: 1   MKKTAIAIAVALA--GFATVAQAA---------------PKDNTWYTGAKLGWSQYHDT- 42

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGSL 120
              +  + G    +  G   F GY V            +       +    +    G  L
Sbjct: 43  --GFINNNGPTHENKLGAGAFGGYQVNPYVGFEMGYDWLGRMPYKGSVENGAYKAQGVQL 100

Query: 121 RIRGGYEVSDSLLLYATVGPDVAQKYE-TGKAGEITPIAIGGTAGVGVEVGGLSESLVAR 179
             + GY ++D L +Y  +G  V +    +   G+     +      GVE   ++  +  R
Sbjct: 101 TAKLGYPITDDLDIYTRLGGMVWRADTYSNVYGKNHDTGVSPVFAGGVEY-AITPEIATR 159

Query: 180 LEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
           LEY+ +        +    +   +SLGV  +F
Sbjct: 160 LEYQWTNNIGDAHTIGTRPDNGMLSLGVSYRF 191


>gi|39935882|ref|NP_948158.1| outer membrane protein [Rhodopseudomonas palustris CGA009]
 gi|39649736|emb|CAE28257.1| possible outer membrane protein [Rhodopseudomonas palustris CGA009]
          Length = 288

 Score = 82.5 bits (202), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 32/194 (16%), Positives = 57/194 (29%), Gaps = 37/194 (19%)

Query: 39  PTIATNRYVPIRHDFNGPYAGLSALYNGSF------------------GEEAHHNAGGSI 80
           P       +   +D++G Y G +  +  S                   G           
Sbjct: 64  PYTKAPPIIAAAYDWSGFYVGANGGWGTSRNCWDYLGTTATPAVALGEGCHDASGGTAGG 123

Query: 81  FAGYNVEDSCIMYGVEGDVRYTVPVLAD----------NIHSLHGIGGSLRIRGGYEVSD 130
             GYN + S  ++GVE    +     ++             +     G    R GY  ++
Sbjct: 124 QVGYNWQISTWVFGVEAQGNWADFKGSNANLLVIPAPTTNQTKIDAFGLFTARVGYAWNN 183

Query: 131 SLLLYATVGPDVAQKYET-------GKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYR 183
             L+Y   G  V     T           + +    G T G G+E G  + S    +EY 
Sbjct: 184 -ALIYVKGGAAVTSDKYTRFRTATGVFNDDASETRWGATVGTGLEYGF-TPSWSFAVEYD 241

Query: 184 ASKYSKVEGFYNTI 197
                  +  ++ +
Sbjct: 242 HLFLGGRDLTFSPV 255


>gi|39937872|ref|NP_950148.1| hypothetical protein RPA4814 [Rhodopseudomonas palustris CGA009]
 gi|39651732|emb|CAE30254.1| conserved hypothetical protein [Rhodopseudomonas palustris CGA009]
          Length = 561

 Score = 82.5 bits (202), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 41/215 (19%), Positives = 61/215 (28%), Gaps = 28/215 (13%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPI--RHDFNGPYA 58
           M ++ + V   +  +     A AAD  R         V    T  Y        F     
Sbjct: 1   MSRILVTVATLATVI---SPAAAADMPRFPPLMPVAPVSWNWTGLYWGAHVGGSFGSSSF 57

Query: 59  GLSALYNGSFGEEAHHNAGGSIFAGYNVEDS-CIMYGVEGDVRYTVPVLAD--------- 108
              A      G      A   I  GYN + +   + GVE D+        +         
Sbjct: 58  SDPAGPGLYGGSVRSPAALAGIQVGYNYQPNANWLIGVEADLSSMNAKGTNTCMASSGLF 117

Query: 109 ---NIHSLHGIGGSLRIRGGYEVSD--SLLLYATVGPDVAQKYETGKAGEI-------TP 156
              N         +L  R G+        LLYA  G     +      G           
Sbjct: 118 ISSNCRVRQDALATLTGRAGFVTGPGGRTLLYAKGGAAYLSERLDIAVGYPLGNLTAAND 177

Query: 157 IAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVE 191
              G T G G+E   L+ +   +LEY  + +   +
Sbjct: 178 GRWGWTVGAGIE-RALAPAWSVKLEYNYADFGSRD 211


>gi|310767218|gb|ADP12168.1| outer membrane protein A [Erwinia sp. Ejp617]
          Length = 355

 Score = 82.5 bits (202), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 36/218 (16%), Positives = 65/218 (29%), Gaps = 31/218 (14%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K  +A+ V+         AQAA                     Y   +  ++  +   
Sbjct: 1   MKKTAIAIAVALA--GFATVAQAA---------------PKDDTWYTGGKLGWSQYHDTG 43

Query: 61  SAL--YNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGG 118
                Y  + G       G   F GY              +            +    G 
Sbjct: 44  YYGNGYENNDGPTHESQLGAGAFLGYQANQYLGFELGYDWLGRMPNKGDVTNGAFKAQGI 103

Query: 119 SLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGE-----ITPIAIGGTAGVGVEVGGLS 173
            +  +  Y ++D L +Y  +G  V +   T               +   A VGVE   ++
Sbjct: 104 QMAAKLSYPIADDLDVYTRLGGMVWRADATQTNPTFGRISNHDTGVSPLAAVGVEY-AVT 162

Query: 174 ESLVARLEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
           ++   RL+Y+          V    +   +S+GV  +F
Sbjct: 163 KNWATRLDYQWVNNIGDAGTVGARPDNSMLSVGVSYRF 200


>gi|292487869|ref|YP_003530744.1| outer membrane protein A [Erwinia amylovora CFBP1430]
 gi|292899094|ref|YP_003538463.1| outer membrane protein A [Erwinia amylovora ATCC 49946]
 gi|291198942|emb|CBJ46052.1| outer membrane protein A [Erwinia amylovora ATCC 49946]
 gi|291553291|emb|CBA20336.1| Outer membrane protein A precursor [Erwinia amylovora CFBP1430]
 gi|312171991|emb|CBX80248.1| Outer membrane protein A precursor [Erwinia amylovora ATCC
           BAA-2158]
          Length = 355

 Score = 82.5 bits (202), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 36/218 (16%), Positives = 65/218 (29%), Gaps = 31/218 (14%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K  +A+ V+         AQAA                     Y   +  ++  +   
Sbjct: 1   MKKTAIAIAVALA--GFATVAQAA---------------PKDDTWYTGGKLGWSQYHDTG 43

Query: 61  SAL--YNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGG 118
                Y  + G       G   F GY              +            +    G 
Sbjct: 44  YYGNGYENNDGPTHESQLGAGAFLGYQANQYLGFELGYDWLGRMPNKGDVTNGAFKAQGI 103

Query: 119 SLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGE-----ITPIAIGGTAGVGVEVGGLS 173
            +  +  Y ++D L +Y  +G  V +   T               +   A VGVE   ++
Sbjct: 104 QMAAKLSYPIADDLDVYTRLGGMVWRADATQTNPTYGRISNHDTGVSPLAAVGVEY-AVT 162

Query: 174 ESLVARLEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
           ++   RL+Y+          V    +   +S+GV  +F
Sbjct: 163 KNWATRLDYQWVNNIGDAGTVGARPDNSMLSVGVSYRF 200


>gi|312270741|gb|ADQ55771.1| OmpA [Haemophilus parasuis]
          Length = 365

 Score = 82.5 bits (202), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 43/228 (18%), Positives = 83/228 (36%), Gaps = 31/228 (13%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATN-RYVPIRHDFNGPYAG 59
           M+K  +A+ VS LA+AS   AQAA      + G +    +   +   +  ++  +  Y  
Sbjct: 1   MKKSLIALAVSGLAVASV--AQAAPQANTFYVGAKAGWVSFHNDINQIDSKYASDARYDA 58

Query: 60  LSALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGS 119
            +  Y         ++    +F GY + D+  +               +     H   G+
Sbjct: 59  TNLKYG-----INRNSVTYGVFGGYQIIDNLAVELGYDYFGRVRGNKQEFRAFKHSAHGT 113

Query: 120 -LRIRGGYEVSDSLLLYATVGPD-----VAQKYETGKAGEITPIAIGGTAGVGVEVGGLS 173
            L ++  YEV + L +Y  VG         +   T +  +   +      G GVE   + 
Sbjct: 114 HLSLKPSYEVLNGLDVYGKVGAALVRNDYKRYSTTTEPVKSHNLKTSLIVGAGVEY-AIL 172

Query: 174 ESLVARLEYRAS----KYSKVEG------------FYNTISLGVGMKF 205
             L  R+EY+       ++K E               ++++ G+  +F
Sbjct: 173 PELAFRVEYQWLSNVGNFTKAEAKENRRATYNYSPDSHSVTAGISYRF 220


>gi|316934003|ref|YP_004108985.1| porin [Rhodopseudomonas palustris DX-1]
 gi|315601717|gb|ADU44252.1| porin [Rhodopseudomonas palustris DX-1]
          Length = 578

 Score = 82.5 bits (202), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 39/226 (17%), Positives = 57/226 (25%), Gaps = 53/226 (23%)

Query: 7   AVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNG 66
           ++   S  LA+ C A AAD  R                       ++ G Y G       
Sbjct: 16  SIICVSAVLAASCGAHAADLPR-------------PPAAKAVAVWNWTGFYLGAHLGAGF 62

Query: 67  SFGEEAHHNAG-------------GSIFAGYNVEDSC--IMYGVEGDVRYTVPVLAD--- 108
              +  +                   + AGY  +      + GVE D         D   
Sbjct: 63  GTAKVDNPFGASIYGDTVRAPKALAGLQAGYTWQAPGSAWVLGVEVDASAIDADGTDTCL 122

Query: 109 ---------NIHSLHGIGGSLRIRGGYEVS--DSLLLYATVGPDVAQKYETGKAGEIT-- 155
                    N      + G+L  R G+        LLY   G        T         
Sbjct: 123 AYSGQFVSANCRIREHVLGTLTGRLGHAFGAQGRSLLYVKGGGAFLIGNLTMTTNASDYL 182

Query: 156 --------PIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGF 193
                       G T G G+E   L+     R EY  + + +    
Sbjct: 183 AQPGAELNATRWGWTVGAGIE-HALTPRWSVRAEYDYANFGRRGMD 227


>gi|312270719|gb|ADQ55760.1| OmpA [Haemophilus parasuis]
          Length = 365

 Score = 82.5 bits (202), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 44/228 (19%), Positives = 85/228 (37%), Gaps = 31/228 (13%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATN-RYVPIRHDFNGPYAG 59
           M+K  +A+ VS LA+AS   A AA      + G +    T   +   +  +++ +  YA 
Sbjct: 1   MKKSLIALAVSGLAVASV--ANAAPQANSFYVGAKAGWATFHNDINQLNSKYENDVRYAT 58

Query: 60  LSALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGS 119
            +  Y         ++    +F GY + D+  +               +     H   G+
Sbjct: 59  SANGYG-----INRNSVTYGVFGGYQIIDNLAVELGYDYFGRVRGNKQEFRAFKHSAHGT 113

Query: 120 -LRIRGGYEVSDSLLLYATVGPDVAQKYE-----TGKAGEITPIAIGGTAGVGVEVGGLS 173
            L ++  YEV + L +Y  VG  + +        T +  +   +      G GVE   + 
Sbjct: 114 HLSLKPSYEVLNGLDVYGKVGAALVRNDYKRYFQTREPVKSHNLKTSLIVGAGVEY-AIL 172

Query: 174 ESLVARLEYRAS----KYSKVEG------------FYNTISLGVGMKF 205
             L  R+EY+       ++K E               ++++ G+  +F
Sbjct: 173 PELAFRVEYQWLSNVGNFTKAEVKENRRATYNYSPDSHSVTAGISYRF 220


>gi|225852776|ref|YP_002733009.1| hypothetical protein BMEA_A1331 [Brucella melitensis ATCC 23457]
 gi|256044924|ref|ZP_05447827.1| hypothetical membrane protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|256263738|ref|ZP_05466270.1| outer membrane protein [Brucella melitensis bv. 2 str. 63/9]
 gi|260565476|ref|ZP_05835960.1| outer membrane protein [Brucella melitensis bv. 1 str. 16M]
 gi|265991350|ref|ZP_06103907.1| outer membrane protein [Brucella melitensis bv. 1 str. Rev.1]
 gi|225641141|gb|ACO01055.1| hypothetical membrane protein [Brucella melitensis ATCC 23457]
 gi|260151544|gb|EEW86638.1| outer membrane protein [Brucella melitensis bv. 1 str. 16M]
 gi|263002134|gb|EEZ14709.1| outer membrane protein [Brucella melitensis bv. 1 str. Rev.1]
 gi|263093797|gb|EEZ17802.1| outer membrane protein [Brucella melitensis bv. 2 str. 63/9]
 gi|326409306|gb|ADZ66371.1| conserved hypothetical protein [Brucella melitensis M28]
 gi|326539015|gb|ADZ87230.1| hypothetical membrane protein [Brucella melitensis M5-90]
          Length = 212

 Score = 82.5 bits (202), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 45/220 (20%), Positives = 79/220 (35%), Gaps = 26/220 (11%)

Query: 2   QKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLS 61
           ++   A  + +  +A   SA AAD +    +           +      HD++G Y G  
Sbjct: 3   KRSITAAALGAAVMAFAGSAFAADMMGGTDYT--------YNDPVAAGPHDWSGNYVGAQ 54

Query: 62  ALYNGSFGEE---AHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVP--VLADNIHSLHGI 116
              + S       +   A G I  G N+++  I++G E +  +      +          
Sbjct: 55  VGGSSSKFPSPFASRTGALGGIVVGKNMQNGNIVFGAELEGNFAEAEHRIGHGGTLQQSW 114

Query: 117 GGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESL 176
            G+ + + GY   D  L+Y T G  V +          +    G   G GVE   LS  L
Sbjct: 115 NGNAKGKVGYTF-DKTLVYGTAGYGVTRFKAKDNTTSASGCEGGVLIGAGVEQ-ALSGPL 172

Query: 177 VARLEYRASKYSKVEG-----------FYNTISLGVGMKF 205
             + EY   +++ V+              ++I  G+  KF
Sbjct: 173 SVKAEYDFQRFNDVKSQVNGIEQRNNLKNHSIKAGLNYKF 212


>gi|299773257|gb|ADJ38703.1| outer membrane protein P5 [Haemophilus parasuis]
          Length = 365

 Score = 82.5 bits (202), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 43/228 (18%), Positives = 83/228 (36%), Gaps = 31/228 (13%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATN-RYVPIRHDFNGPYAG 59
           M+K  +A+ VS LA+AS  S  AA      + G +    T   +   +  ++  +  Y  
Sbjct: 1   MKKSLIALAVSGLAVASVSS--AAPQANTFYVGAKAGWATFHNDINQIDSKYANDARYDA 58

Query: 60  LSALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGS 119
            +  Y       + ++    +F GY + D+  +               +     H   G+
Sbjct: 59  TNLKYG-----ISRNSVTYGVFGGYQIIDNLAVELGYDYFGRVRGNKQEFRAFKHSAHGT 113

Query: 120 -LRIRGGYEVSDSLLLYATVGPD-----VAQKYETGKAGEITPIAIGGTAGVGVEVGGLS 173
            L ++  YEV + L +Y  VG         +   T +  +   +      G GVE   + 
Sbjct: 114 HLSLKPSYEVLNGLDVYGKVGAALVRNDYKRYSTTREPVKSHNLKTSLIVGAGVEY-AIL 172

Query: 174 ESLVARLEYRAS----KYSKVEG------------FYNTISLGVGMKF 205
             L  R+EY+       ++K E               ++++ G+  +F
Sbjct: 173 PELAFRVEYQWLSNVGNFTKAEAKENRRATYNYSPDSHSVTAGISYRF 220


>gi|62290190|ref|YP_221983.1| hypothetical protein BruAb1_1285 [Brucella abortus bv. 1 str.
           9-941]
 gi|82700111|ref|YP_414685.1| hypothetical protein BAB1_1302 [Brucella melitensis biovar Abortus
           2308]
 gi|189024424|ref|YP_001935192.1| hypothetical protein BAbS19_I12150 [Brucella abortus S19]
 gi|254689494|ref|ZP_05152748.1| hypothetical protein Babob68_04824 [Brucella abortus bv. 6 str.
           870]
 gi|254693981|ref|ZP_05155809.1| hypothetical protein Babob3T_04824 [Brucella abortus bv. 3 str.
           Tulya]
 gi|254697632|ref|ZP_05159460.1| hypothetical protein Babob28_07971 [Brucella abortus bv. 2 str.
           86/8/59]
 gi|254730522|ref|ZP_05189100.1| hypothetical protein Babob42_04834 [Brucella abortus bv. 4 str.
           292]
 gi|256257742|ref|ZP_05463278.1| hypothetical protein Babob9C_10416 [Brucella abortus bv. 9 str.
           C68]
 gi|260546733|ref|ZP_05822472.1| outer membrane protein [Brucella abortus NCTC 8038]
 gi|260755016|ref|ZP_05867364.1| outer membrane protein 22 [Brucella abortus bv. 6 str. 870]
 gi|260758232|ref|ZP_05870580.1| outer membrane protein 22 [Brucella abortus bv. 4 str. 292]
 gi|260762059|ref|ZP_05874402.1| outer membrane protein 22 [Brucella abortus bv. 2 str. 86/8/59]
 gi|260884027|ref|ZP_05895641.1| outer membrane protein [Brucella abortus bv. 9 str. C68]
 gi|261214272|ref|ZP_05928553.1| outer membrane protein 22 [Brucella abortus bv. 3 str. Tulya]
 gi|297248580|ref|ZP_06932298.1| hypothetical protein BAYG_01539 [Brucella abortus bv. 5 str. B3196]
 gi|14018349|emb|CAC38354.1| outer membrane protein [Brucella abortus]
 gi|46251261|gb|AAS84601.1| Omp22 [Brucella abortus]
 gi|62196322|gb|AAX74622.1| hypothetical membrane protein [Brucella abortus bv. 1 str. 9-941]
 gi|82616212|emb|CAJ11258.1| membrane protein, putative [Brucella melitensis biovar Abortus
           2308]
 gi|189019996|gb|ACD72718.1| hypothetical protein BAbS19_I12150 [Brucella abortus S19]
 gi|260095783|gb|EEW79660.1| outer membrane protein [Brucella abortus NCTC 8038]
 gi|260668550|gb|EEX55490.1| outer membrane protein 22 [Brucella abortus bv. 4 str. 292]
 gi|260672491|gb|EEX59312.1| outer membrane protein 22 [Brucella abortus bv. 2 str. 86/8/59]
 gi|260675124|gb|EEX61945.1| outer membrane protein 22 [Brucella abortus bv. 6 str. 870]
 gi|260873555|gb|EEX80624.1| outer membrane protein [Brucella abortus bv. 9 str. C68]
 gi|260915879|gb|EEX82740.1| outer membrane protein 22 [Brucella abortus bv. 3 str. Tulya]
 gi|297175749|gb|EFH35096.1| hypothetical protein BAYG_01539 [Brucella abortus bv. 5 str. B3196]
          Length = 212

 Score = 82.5 bits (202), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 45/220 (20%), Positives = 79/220 (35%), Gaps = 26/220 (11%)

Query: 2   QKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLS 61
           ++   A  + +  +A   SA AAD +    +           +      HD++G Y G  
Sbjct: 3   KRSITAAALGAAVMAFAGSAFAADMMGGTDYT--------YNDPVAAGPHDWSGNYVGAQ 54

Query: 62  ALYNGSFGEE---AHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVP--VLADNIHSLHGI 116
              + S       +   A G I  G N+++  I++G E +  +      +          
Sbjct: 55  VGGSSSKFPSPFASRTGALGGIVVGKNMQNGNIVFGAELEGNFAEAEHRIGHGGTLQQSW 114

Query: 117 GGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESL 176
            G+ + + GY   D  L+Y T G  V +          +    G   G GVE   LS  L
Sbjct: 115 NGNAKGKVGYTF-DKTLVYGTAGYGVTRFKAKDNTTSASGWEGGVLIGAGVEQ-ALSGPL 172

Query: 177 VARLEYRASKYSKVEG-----------FYNTISLGVGMKF 205
             + EY   +++ V+              ++I  G+  KF
Sbjct: 173 SVKAEYDFQRFNDVKSQVNGIEQRNNLKNHSIKAGLNYKF 212


>gi|154246284|ref|YP_001417242.1| porin [Xanthobacter autotrophicus Py2]
 gi|154160369|gb|ABS67585.1| porin [Xanthobacter autotrophicus Py2]
          Length = 232

 Score = 82.5 bits (202), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 40/210 (19%), Positives = 67/210 (31%), Gaps = 42/210 (20%)

Query: 36  GVVPTIATNRYVPIRHDFNGPYAGLSALYNGSF----------------GEEAHHNAGGS 79
                +           + G Y G +  +  +                      +   G 
Sbjct: 25  ATRYPVKAAPIPVQTFSWTGFYIGGNVGWGWADNTYDVTPFGSLIGYSYSPGTGNGFIGG 84

Query: 80  IFAGYNVED-SCIMYGVEGDVRYTVPVLAD----------NIHSLHGIGGSLRIRGGYEV 128
           +  GYN +  + ++ GVE D  ++    +            I       G++R R GY +
Sbjct: 85  LQTGYNYQFANNVVIGVEADFDWSDIGSSSLVVGGPFTGGAISQNIDYFGTIRARLGYGI 144

Query: 129 SDSLLLYATVGPDVAQKYETGKAGEI-TPIAIGGTAGVGVEVGGLSESLVARLEYRASKY 187
            D  L Y T G   A++  +   G        G T G GVE   ++ +   + EY    +
Sbjct: 145 -DRFLPYITGGAAWAKQNFSDFYGNTYNDTKWGWTVGAGVEY-AITNNWTVKAEYLYLGF 202

Query: 188 SK------------VEGFYNTISLGVGMKF 205
           +K            V    +T  LGV  KF
Sbjct: 203 NKNTTNDYFGDSYSVGSNISTAKLGVNYKF 232


>gi|319405139|emb|CBI78745.1| Hemin binding protein d [Bartonella sp. AR 15-3]
          Length = 262

 Score = 82.5 bits (202), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 45/256 (17%), Positives = 80/256 (31%), Gaps = 70/256 (27%)

Query: 14  ALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSFGEEAH 73
                   QAAD ++         VP IA++        + G Y G              
Sbjct: 13  VFIPVSIVQAADIMKPHQSQSYQPVPLIASS----SSFSWTGFYFGGQIGGFSGEATLKD 68

Query: 74  ---------------HNAGGSIFAGYNVEDS-CIMYGVEGDVRYTVPVLADNIHS----- 112
                              G ++AG NV     ++ G++ D+ ++       ++      
Sbjct: 69  KNDASEDSKLLSPELSGFIGGVYAGSNVGLGKDLILGIDTDMVWSGKKYTKVVNVPGDIE 128

Query: 113 ------------------LHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKY-------- 146
                                  G+ R+R G+ V D ++ Y + G    Q          
Sbjct: 129 KVTYRFIKRPNDRFDYVLKEKWAGATRMRVGFIV-DRVMPYVSGGVSYVQLQSVFEVKSS 187

Query: 147 --------ETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEG------ 192
                         + T I +G + G G++V  +++++V R EYR S + K +       
Sbjct: 188 NTQKQNVGINEVKLDETKILVGYSIGGGIDV-AMTDNVVMRAEYRYSDFGKKKFAEEDGE 246

Query: 193 ---FYNTISLGVGMKF 205
                N   +GV  KF
Sbjct: 247 LSYKTNDFRVGVAYKF 262


>gi|254710345|ref|ZP_05172156.1| 22 kDa outer membrane protein precursor [Brucella pinnipedialis
           B2/94]
 gi|256255239|ref|ZP_05460775.1| 22 kDa outer membrane protein precursor [Brucella ceti B1/94]
 gi|260168973|ref|ZP_05755784.1| 22 kDa outer membrane protein precursor [Brucella sp. F5/99]
 gi|261222435|ref|ZP_05936716.1| Omp22 [Brucella ceti B1/94]
 gi|261317908|ref|ZP_05957105.1| conserved hypothetical protein [Brucella pinnipedialis B2/94]
 gi|261758466|ref|ZP_06002175.1| outer membrane protein [Brucella sp. F5/99]
 gi|46251269|gb|AAS84605.1| Omp22 [Brucella pinnipedialis]
 gi|46251271|gb|AAS84606.1| Omp22 [Brucella ceti]
 gi|46251273|gb|AAS84607.1| Omp22 [Brucella ceti]
 gi|260921019|gb|EEX87672.1| Omp22 [Brucella ceti B1/94]
 gi|261297131|gb|EEY00628.1| conserved hypothetical protein [Brucella pinnipedialis B2/94]
 gi|261738450|gb|EEY26446.1| outer membrane protein [Brucella sp. F5/99]
          Length = 212

 Score = 82.5 bits (202), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 45/220 (20%), Positives = 78/220 (35%), Gaps = 26/220 (11%)

Query: 2   QKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLS 61
           ++   A  + +  +A   SA AAD +    +           +      HD++G Y G  
Sbjct: 3   KRSITAAALGAAVMAFAGSAFAADMMGGTDYT--------YNDPVAAGPHDWSGNYVGAR 54

Query: 62  ALYNGSFGEE---AHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVP--VLADNIHSLHGI 116
              + S       +   A G I  G N+++  I++G E +  +      +          
Sbjct: 55  VGGSSSKFPSPFASRTGALGGIVVGKNMQNGNIVFGAELEGNFAEAEHRIGHGGTLQQSW 114

Query: 117 GGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESL 176
            G+ + + GY   D  L+Y T G  V +               G   G GVE   LS  L
Sbjct: 115 NGNAKGKVGYAF-DKTLVYGTAGYGVTRFKAKDNTTSAPGWEGGVLIGAGVEQ-ALSGPL 172

Query: 177 VARLEYRASKYSKVEG-----------FYNTISLGVGMKF 205
             + EY   +++ V+              ++I  G+  KF
Sbjct: 173 SVKAEYDFQRFNDVKSQVNGIEQRNNLKNHSIKAGLNYKF 212


>gi|312270711|gb|ADQ55756.1| OmpA [Haemophilus parasuis]
 gi|312270713|gb|ADQ55757.1| OmpA [Haemophilus parasuis]
          Length = 365

 Score = 82.1 bits (201), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 44/228 (19%), Positives = 83/228 (36%), Gaps = 31/228 (13%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATN-RYVPIRHDFNGPYAG 59
           M+K  +A+ VS LA+AS   A AA      + G +    T   +   +  ++  +  YA 
Sbjct: 1   MKKSLIALAVSGLAVASV--ANAAPQANSFYVGAKAGWATFHNDINQLNFKYKNDARYAT 58

Query: 60  LSALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGS 119
            +  Y         ++    +F GY + D+  +               +     H   G+
Sbjct: 59  SANGYG-----INRNSVTYGVFGGYQIIDNLAVELGYDYFGRVRGNKQEFREFKHSAHGT 113

Query: 120 -LRIRGGYEVSDSLLLYATVGPDVAQKYE-----TGKAGEITPIAIGGTAGVGVEVGGLS 173
            L ++  YEV   L +Y  VG  + +        T +  +   +      G GVE   + 
Sbjct: 114 HLSLKPSYEVLSGLDVYGKVGAALVRNDYKRYFQTREPVKSHNLKTSLIVGAGVEY-AIL 172

Query: 174 ESLVARLEYRAS----KYSKVEG------------FYNTISLGVGMKF 205
             L  R+EY+       ++K E               ++++ G+  +F
Sbjct: 173 PELAFRVEYQWLSNVGNFTKAEMKENRRATYNYSPDSHSVTAGISYRF 220


>gi|323967204|gb|EGB62628.1| OmpA transmembrane domain-containing protein [Escherichia coli
           M863]
 gi|323976664|gb|EGB71752.1| OmpA transmembrane domain-containing protein [Escherichia coli
           TW10509]
 gi|327253749|gb|EGE65378.1| outer membrane protein A [Escherichia coli STEC_7v]
          Length = 350

 Score = 82.1 bits (201), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 37/216 (17%), Positives = 69/216 (31%), Gaps = 32/216 (14%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K  +A+ V+         AQAA                     Y   +  ++  +   
Sbjct: 1   MKKTAIAIAVALA--GFATVAQAA---------------PKDNTWYTGAKLGWSQYHDT- 42

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGSL 120
              +  + G    +  G   F GY V            +        +   +    G  L
Sbjct: 43  --GFINNNGPTHENQLGAGAFGGYQVNPYVGFEMGYDWLGRMPYKGDNINGAYKAQGVQL 100

Query: 121 RIRGGYEVSDSLLLYATVGPDVAQKYET-----GKAGEITPIAIGGTAGVGVEVGGLSES 175
             + GY ++D L +Y  +G  V +         G + +     +      GVE   ++  
Sbjct: 101 TAKLGYPITDDLDIYTRLGGMVWRADTKANVPGGASFKDHDTGVSPVFAGGVEY-AITPE 159

Query: 176 LVARLEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
           +  RLEY+ +        +    +   +SLGV  +F
Sbjct: 160 IATRLEYQWTNNIGDAHTIGTRPDNGLLSLGVSYRF 195


>gi|213580658|ref|ZP_03362484.1| outer membrane protein A [Salmonella enterica subsp. enterica
           serovar Typhi str. E98-0664]
          Length = 296

 Score = 82.1 bits (201), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 35/216 (16%), Positives = 70/216 (32%), Gaps = 32/216 (14%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K  +A+ V+         AQAA                     Y   +  ++  +   
Sbjct: 25  MKKTAIAIAVALA--GFATVAQAA---------------PKDNTWYAGAKLGWSQYHDT- 66

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGSL 120
              +  + G    +  G   F GY V            +        +   +    G  L
Sbjct: 67  --GFIHNDGPTHENQLGAGAFGGYQVNPYVGFEMGYDWLGRMPYKGDNTNGAYKAQGVQL 124

Query: 121 RIRGGYEVSDSLLLYATVGPDVAQKYET-----GKAGEITPIAIGGTAGVGVEVGGLSES 175
             + GY ++D L +Y  +G  V +         G + +     +      G+E   ++  
Sbjct: 125 TAKLGYPITDDLDVYTRLGGMVWRADTKSNVPGGASTKDHDTGVSPVFAGGIEY-AITPE 183

Query: 176 LVARLEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
           +  RLEY+ +      + +    +   +S+GV  +F
Sbjct: 184 IATRLEYQWTNNIGDANTIGTRPDNGLLSVGVSYRF 219


>gi|309786688|ref|ZP_07681308.1| outer membrane protein A [Shigella dysenteriae 1617]
 gi|129143|sp|P02935|OMPA_SHIDY RecName: Full=Outer membrane protein A; AltName: Full=Outer
           membrane protein II; Flags: Precursor
 gi|46945|emb|CAA24638.1| unnamed protein product [Shigella dysenteriae]
 gi|308925381|gb|EFP70868.1| outer membrane protein A [Shigella dysenteriae 1617]
          Length = 351

 Score = 82.1 bits (201), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 37/217 (17%), Positives = 70/217 (32%), Gaps = 33/217 (15%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K   A+ ++         AQAA                     Y   +  ++  +   
Sbjct: 1   MKKT--AIAITVALAGFATVAQAA---------------PKDNTWYTGAKLGWSQYHDT- 42

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGSL 120
              +  + G    +  G   F GY V            +       +    +    G  L
Sbjct: 43  --GFIDNNGPTHENQLGAGAFGGYQVNPYVGFEMGYDWLGRMPYKGSVENGAYKAQGVQL 100

Query: 121 RIRGGYEVSDSLLLYATVGPDVAQKYE------TGKAGEITPIAIGGTAGVGVEVGGLSE 174
             + GY ++D L +Y  +G  V +         TG++ +     +      GVE   ++ 
Sbjct: 101 TAKLGYPITDDLDVYTRLGGMVWRADTKAHNNVTGESEKNHDTGVSPVFAGGVE-WAITP 159

Query: 175 SLVARLEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
            +  RLEY+ +        +    +   +SLGV  +F
Sbjct: 160 EIATRLEYQWTNNIGDAHTIGTRPDNGLLSLGVSYRF 196


>gi|86749831|ref|YP_486327.1| outer membrane protein [Rhodopseudomonas palustris HaA2]
 gi|86572859|gb|ABD07416.1| outer membrane protein [Rhodopseudomonas palustris HaA2]
          Length = 243

 Score = 82.1 bits (201), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 36/192 (18%), Positives = 62/192 (32%), Gaps = 32/192 (16%)

Query: 38  VPTIATNRYVPIRHDFNGPYAGLSALYNGSF---------------GEEAHHNAGGSIFA 82
             T A    +   +D++G Y G +  +  S                G      A      
Sbjct: 28  PYTKAPPPMIVAIYDWSGFYIGANGGWGTSRKSWDFYAPGALLLSEGSHDASGATAGGQV 87

Query: 83  GYNVEDSCIMYGVEGDVRYTVPVLAD--------NIHSLHGIGGSLRIRGGYEVSDSLLL 134
           GYN +    ++GVE    +     ++        + HS     G    R GY  +++LL 
Sbjct: 88  GYNWQMGSWVFGVEAQGNWADFKGSNVTLLGGLFDNHSKVEAFGLFTGRVGYAWNNALL- 146

Query: 135 YATVGPDVAQKYETGKA-------GEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKY 187
           YA  G  V                G  +    G + G G+E G  + +    +EY     
Sbjct: 147 YAKGGAAVVNDKYEFVRRADGLVTGTASETRWGASVGAGLEYGF-TPNWSFAVEYNHLFL 205

Query: 188 SKVEGFYNTISL 199
            K +  +   ++
Sbjct: 206 DKKDVTFTNTAV 217


>gi|298292422|ref|YP_003694361.1| porin [Starkeya novella DSM 506]
 gi|296928933|gb|ADH89742.1| porin [Starkeya novella DSM 506]
          Length = 203

 Score = 82.1 bits (201), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 41/191 (21%), Positives = 57/191 (29%), Gaps = 20/191 (10%)

Query: 30  AHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSFGEEAHH--NAGGSIFAGYNVE 87
                    P             + G Y G +A Y     + +       G + AGYN +
Sbjct: 18  PAAAADLSYPPPVAAYAPAPVFTWTGFYIGANAGYGFGEADFSGDIDGFIGGLQAGYNWQ 77

Query: 88  --DSCIMYGVEGDVRYTVPVLADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQK 145
              S ++ GVE D +Y     +          G++R R GY   D  L+Y T G      
Sbjct: 78  GAGSPLVLGVETDFQYADVSSSV---FSLDYFGTVRARVGYAF-DQFLVYGTGGFAYGAG 133

Query: 146 YETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYS-----------KVEGFY 194
                         G T G G E   L  +   + EY                  V    
Sbjct: 134 SYELLGLTNDRNHFGWTVGAGAEY-ALGNNWSVKGEYLYLDMGEETYATFTGPRDVGLTS 192

Query: 195 NTISLGVGMKF 205
           N I  GV  +F
Sbjct: 193 NVIRAGVNYRF 203


>gi|312114546|ref|YP_004012142.1| outer membrane protein [Rhodomicrobium vannielii ATCC 17100]
 gi|311219675|gb|ADP71043.1| outer membrane protein [Rhodomicrobium vannielii ATCC 17100]
          Length = 250

 Score = 82.1 bits (201), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 55/255 (21%), Positives = 90/255 (35%), Gaps = 63/255 (24%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M +L +   VS++AL    SA AAD  R    GG    P +AT         + G YAG+
Sbjct: 1   MIRLGIIGTVSAIALT--VSANAADLYRAPAGGGLKDAPYVAT---------WTGFYAGV 49

Query: 61  SALYNGSFGEE-----AHHNAGGSI---------FAGYNVE---DSCIMYGVEGDVRYTV 103
           +  Y  S   +       +     +           GYN++      ++ G+E D++ + 
Sbjct: 50  NGGYAWSQSSDQLAYVDPNYPFYGLSPEGGFGGGQIGYNLQGFVHPNLVLGIEADIQGSD 109

Query: 104 PVLAD------NIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGK------- 150
              +          S     G++R R GY + DS L+YAT G                  
Sbjct: 110 ISDSGVDSATYKYSSKVDWFGTVRGRLGYAI-DSALVYATGGFAYGGIKNDYDARHLGAG 168

Query: 151 AGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSK--------------------V 190
             +    A G   G GVE   L+ +   + EY+     K                     
Sbjct: 169 EFKFDGNATGYVVGGGVEY-KLAPAWSLKAEYQYINLGKNNPVDTSTGQHYTDLEGTKLE 227

Query: 191 EGFYNTISLGVGMKF 205
           +  ++T+ +G+   F
Sbjct: 228 DDAFHTVRVGLNYHF 242


>gi|227884084|ref|ZP_04001889.1| OOP family OmpA-OmpF porin [Escherichia coli 83972]
 gi|300978356|ref|ZP_07174229.1| outer membrane protein A [Escherichia coli MS 45-1]
 gi|301047785|ref|ZP_07194839.1| outer membrane protein A [Escherichia coli MS 185-1]
 gi|227838836|gb|EEJ49302.1| OOP family OmpA-OmpF porin [Escherichia coli 83972]
 gi|300300348|gb|EFJ56733.1| outer membrane protein A [Escherichia coli MS 185-1]
 gi|300409701|gb|EFJ93239.1| outer membrane protein A [Escherichia coli MS 45-1]
 gi|315291176|gb|EFU50536.1| outer membrane protein A [Escherichia coli MS 153-1]
          Length = 358

 Score = 82.1 bits (201), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 38/219 (17%), Positives = 70/219 (31%), Gaps = 38/219 (17%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K  +A+ V+         AQAA                     Y   +  ++  +   
Sbjct: 9   MKKTAIAIAVALA--GFATVAQAA---------------PKDNTWYTGAKLGWSQYHDT- 50

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGG-- 118
              +  + G    +  G   F GY V       G E    +   +     +         
Sbjct: 51  --GFIPNNGPTHENQLGAGAFGGYQV---NPYVGFEMGYDWLGRMPYKGDNINGAYKAQG 105

Query: 119 -SLRIRGGYEVSDSLLLYATVGPDVAQKYET-----GKAGEITPIAIGGTAGVGVEVGGL 172
             L  + GY ++D L +Y  +G  V +         G + +     +      GVE   +
Sbjct: 106 VQLTAKLGYPITDDLDIYTRLGGMVWRADTKANVPGGASFKDHDTGVSPVFAGGVEY-AI 164

Query: 173 SESLVARLEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
           +  +  RLEY+ +        +    +   +SLGV  +F
Sbjct: 165 TPEIATRLEYQWTNNIGDAHTIGTRPDNGMLSLGVSYRF 203


>gi|259908883|ref|YP_002649239.1| outer membrane protein A [Erwinia pyrifoliae Ep1/96]
 gi|224964505|emb|CAX56015.1| Outer membrane protein A [Erwinia pyrifoliae Ep1/96]
 gi|283478876|emb|CAY74792.1| Outer membrane protein A precursor [Erwinia pyrifoliae DSM 12163]
          Length = 355

 Score = 82.1 bits (201), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 36/218 (16%), Positives = 65/218 (29%), Gaps = 31/218 (14%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K  +A+ V+         AQAA                     Y   +  ++  +   
Sbjct: 1   MKKTAIAIAVALA--GFATVAQAA---------------PKDDTWYTGGKLGWSQYHDTG 43

Query: 61  SAL--YNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGG 118
                Y  + G       G   F GY              +            +    G 
Sbjct: 44  YYGNGYENNDGPTHESQLGAGAFLGYQANQYLGFELGYDWLGRMPNKGDVTNGAFKAQGI 103

Query: 119 SLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGE-----ITPIAIGGTAGVGVEVGGLS 173
            +  +  Y ++D L +Y  +G  V +   T               +   A VGVE   ++
Sbjct: 104 QMAAKLSYPIADDLDVYTRLGGMVWRADATQTNPTFGRISNHDTGVSPLAAVGVEY-AVT 162

Query: 174 ESLVARLEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
           ++   RL+Y+          V    +   +S+GV  +F
Sbjct: 163 KNWATRLDYQWVNNIGDAGTVGARPDNSMLSVGVSYRF 200


>gi|299773251|gb|ADJ38700.1| outer membrane protein P5 [Haemophilus parasuis]
          Length = 365

 Score = 82.1 bits (201), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 43/228 (18%), Positives = 82/228 (35%), Gaps = 31/228 (13%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATN-RYVPIRHDFNGPYAG 59
           M+K  +A+ VS LA+AS     AA      + G +    T   +   +  ++  +  YA 
Sbjct: 1   MKKSLIALAVSGLAVASVS--NAAPQANSFYVGAKAGWATFHNDINQLNSKYKNDARYAT 58

Query: 60  LSALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGS 119
            +  Y         ++    +F GY + D+  +               +     H   G+
Sbjct: 59  SANGYV-----INRNSVTYGVFGGYQIIDNLAVELGYDYFGRVRGNKQEFRAFKHSAHGT 113

Query: 120 -LRIRGGYEVSDSLLLYATVGPD-----VAQKYETGKAGEITPIAIGGTAGVGVEVGGLS 173
            L ++  YEV + L +Y  VG         +   T +  +   +      G GVE   + 
Sbjct: 114 HLSLKPSYEVLNGLDVYGKVGAALVRNDYKRYSTTREPVKSHNLKTSLIVGAGVEY-AIL 172

Query: 174 ESLVARLEYRAS----KYSKVEG------------FYNTISLGVGMKF 205
             L  R+EY+       ++K E               ++++ G+  +F
Sbjct: 173 PELAFRVEYQWLSNVGNFTKAEAKENRRATYNYSPDSHSVTAGISYRF 220


>gi|148258633|ref|YP_001243218.1| OmpA-like transmembrane domain-containing protein [Bradyrhizobium
           sp. BTAi1]
 gi|146410806|gb|ABQ39312.1| OmpA-like transmembrane domain protein [Bradyrhizobium sp. BTAi1]
          Length = 710

 Score = 82.1 bits (201), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 45/240 (18%), Positives = 74/240 (30%), Gaps = 46/240 (19%)

Query: 10  VSSLALASFCSAQAADPVRRAHHGGR-------GVVPTIATNRYVPIRHDFNGPYAGLSA 62
           +  +A     +A A +    A   G               +   +   +D+ G Y G   
Sbjct: 42  LVLVAATGAGNAHAQEIPAGADRLGTERRLDVRTKADRPPSEAEMKRVYDWTGFYVGGHF 101

Query: 63  LYN--------------GSFGEEAHHNAGGSIFAGYNVEDSC-IMYGVEGDVRYTVPVLA 107
            Y               G F   +     G    GYN + +  ++ GVE D  +T P   
Sbjct: 102 GYGGGRLGDDSHPKPEQGVFLPHSPTGLIGGFQVGYNRQLANHLVLGVEADASFTSPTDE 161

Query: 108 DNI-----HSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEI---TPIAI 159
             +     +S     G+ R R GY   D  + Y T G      +     G          
Sbjct: 162 PALAPSPFNSTVDYVGTARGRVGYAF-DRWMPYVTGGFAWGHGHIEVNDGSGAQLGRYQT 220

Query: 160 GGTAGVGVEVGGLSESLVARLEYRA-------SKYSKVEG-------FYNTISLGVGMKF 205
           G TAG+G E   +S +  A++EY             + +          +   +G+   F
Sbjct: 221 GWTAGLGAEF-AVSGNWTAKVEYDYVNLSAATYDLGRFDLPNARLAPGLHLAKIGLNYHF 279


>gi|329296508|ref|ZP_08253844.1| outer membrane protein A [Plautia stali symbiont]
          Length = 356

 Score = 82.1 bits (201), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 37/218 (16%), Positives = 65/218 (29%), Gaps = 31/218 (14%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K   A+ ++         AQAA                     Y   +  ++  +   
Sbjct: 1   MKKT--AIAITVALAGFATVAQAA---------------PKDDTWYTGAKLGWSQYHDTG 43

Query: 61  SAL--YNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGG 118
                Y  + G       G   F GY              +            +    G 
Sbjct: 44  YYGNGYENNDGPTHESQLGAGAFLGYQANPYLGFELGYDWLGRMPNKGNVTNGAFKAQGV 103

Query: 119 SLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGE-----ITPIAIGGTAGVGVEVGGLS 173
            L  +  Y ++D L +Y  +G  V +   T    +          +   A VGVE   L+
Sbjct: 104 QLAAKLSYPIADDLDVYTRLGGMVWRADSTQTNPDNGRISNHNTGVSPLAAVGVEY-ALT 162

Query: 174 ESLVARLEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
           ++   RL+Y+          V    +   +S+GV  +F
Sbjct: 163 KNWATRLDYQWVNNIGDAGTVGARPDNSMLSVGVSYRF 200


>gi|90408691|ref|ZP_01216841.1| putative outer membrane protein OmpA [Psychromonas sp. CNPT3]
 gi|90310205|gb|EAS38340.1| putative outer membrane protein OmpA [Psychromonas sp. CNPT3]
          Length = 415

 Score = 82.1 bits (201), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 37/211 (17%), Positives = 59/211 (27%), Gaps = 12/211 (5%)

Query: 2   QKLFLAVGVSSLALASFCSAQAA-DPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
            K+      S++       A A  D                 ++ YV +R          
Sbjct: 42  NKIKKQALCSAVLFFLAVPAYAQVDNAVSREFSDYRDTRQNNSHVYVGLRGGGANFEKAC 101

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHG-IGGS 119
           S+       +      G   + GY       +     D                   G  
Sbjct: 102 SSG----SSKCNDDTLGYGFYGGYQFTSWFALEAALTDYGSISATYYGTNKVSVETWGSE 157

Query: 120 LRIRGGYEVSDSLLLYATVGPDVAQK-YETGKAGEITPIAIGGTAGVGVEVGGLSESLVA 178
           L     Y++ +SL  Y  VG        E+    E      G  + VG++   LS S   
Sbjct: 158 LSGVFSYDLFESLDAYLRVGASYQHAHKESIWPTEELVGDWGVVSAVGLDY-RLSTSWSL 216

Query: 179 RLEYRAS-KYSKVE---GFYNTISLGVGMKF 205
           R EY+      K +      + +SLG+   F
Sbjct: 217 RGEYQFIDDTGKNDLTHVDVHFVSLGLTYHF 247


>gi|299773249|gb|ADJ38699.1| outer membrane protein P5 [Haemophilus parasuis]
          Length = 365

 Score = 82.1 bits (201), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 43/228 (18%), Positives = 83/228 (36%), Gaps = 31/228 (13%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATN-RYVPIRHDFNGPYAG 59
           M+K  +A+ VS LA+AS     AA      + G +    T   +   +  ++  +  YA 
Sbjct: 1   MKKSLIALAVSGLAVASVS--NAAPQANSFYVGAKAGWATFHNDINQLNSKYANDARYAT 58

Query: 60  LSALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGS 119
            +  Y         ++    +F GY + D+  +               +     H   G+
Sbjct: 59  SANGYG-----INRNSVTYGVFGGYQIIDNLAVELGYDYFGRVRGNKQEFRAFKHSAHGT 113

Query: 120 -LRIRGGYEVSDSLLLYATVGPDVAQKYE-----TGKAGEITPIAIGGTAGVGVEVGGLS 173
            L ++  YEV + L +Y  VG  + +        T +  +   +      G GVE   + 
Sbjct: 114 HLSLKPSYEVLNGLDVYGKVGAALVRNDYKRYFQTREPVKSHNLKTSLIVGAGVEY-AIL 172

Query: 174 ESLVARLEYRAS----KYSKVEG------------FYNTISLGVGMKF 205
             L  R+EY+       ++K E               ++++ G+  +F
Sbjct: 173 PELAFRVEYQWLSNVGNFTKAEMKENRRATYNYSPDSHSVTAGISYRF 220


>gi|281178081|dbj|BAI54411.1| outer membrane protein OmpA [Escherichia coli SE15]
 gi|323190770|gb|EFZ76039.1| outer membrane protein A [Escherichia coli RN587/1]
          Length = 350

 Score = 82.1 bits (201), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 38/219 (17%), Positives = 70/219 (31%), Gaps = 38/219 (17%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K  +A+ V+         AQAA                     Y   +  ++  +   
Sbjct: 1   MKKTAIAIAVALA--GFATVAQAA---------------PKDNTWYTGAKLGWSQYHDT- 42

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGG-- 118
              +  + G    +  G   F GY V       G E    +   +     +         
Sbjct: 43  --GFIPNNGPTHENQLGAGAFGGYQV---NPYVGFEMGYDWLGRMPYKGDNINGAYKAQG 97

Query: 119 -SLRIRGGYEVSDSLLLYATVGPDVAQKYET-----GKAGEITPIAIGGTAGVGVEVGGL 172
             L  + GY ++D L +Y  +G  V +         G + +     +      GVE   +
Sbjct: 98  VQLTAKLGYPITDDLDIYTRLGGMVWRADTKANVPGGASFKDHDTGVSPVFAGGVEY-AI 156

Query: 173 SESLVARLEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
           +  +  RLEY+ +        +    +   +SLGV  +F
Sbjct: 157 TPEIATRLEYQWTNNIGDAHTIGTRPDNGMLSLGVSYRF 195


>gi|306840252|ref|ZP_07473026.1| 22 kDa outer membrane protein precursor [Brucella sp. BO2]
 gi|306289779|gb|EFM60961.1| 22 kDa outer membrane protein precursor [Brucella sp. BO2]
          Length = 212

 Score = 81.8 bits (200), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 45/220 (20%), Positives = 78/220 (35%), Gaps = 26/220 (11%)

Query: 2   QKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLS 61
           ++   A    +  +A   SA AAD +    +          ++      HD++G Y G  
Sbjct: 3   KRSITAAAFGAAVMAFAGSAFAADMMGGTDYT--------YSDPVAAGPHDWSGNYVGAQ 54

Query: 62  ALYNGSFGEE---AHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVP--VLADNIHSLHGI 116
              + S       +   A G I  G N+++  I++G E +  +      +          
Sbjct: 55  VGGSSSKFPSPFASRTGALGGIVVGKNMQNGNIVFGAELEGNFAEAEHRIGHGGTLQQSW 114

Query: 117 GGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESL 176
            G+ + + GY   D  L+Y T G  V +               G   G GVE   LS  L
Sbjct: 115 NGNAKGKVGYAF-DKTLVYGTAGYGVTRFKAKDNTTSAPGWEGGVLIGAGVEQ-ALSGPL 172

Query: 177 VARLEYRASKYSKVEG-----------FYNTISLGVGMKF 205
             + EY   +++ V+              ++I  G+  KF
Sbjct: 173 SVKAEYDFQRFNDVKSQVNGIEQRNNLKNHSIKAGLNYKF 212


>gi|306844187|ref|ZP_07476780.1| 22 kDa outer membrane protein precursor [Brucella sp. BO1]
 gi|306275462|gb|EFM57199.1| 22 kDa outer membrane protein precursor [Brucella sp. BO1]
          Length = 212

 Score = 81.8 bits (200), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 45/220 (20%), Positives = 78/220 (35%), Gaps = 26/220 (11%)

Query: 2   QKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLS 61
           ++   A    +  +A   SA AAD +    +          ++      HD++G Y G  
Sbjct: 3   KRSITAAAFGAAIMAFAGSAFAADMMGGTDYT--------YSDPVAAGPHDWSGNYVGAQ 54

Query: 62  ALYNGSFGEE---AHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVP--VLADNIHSLHGI 116
              + S       +   A G I  G N+++  I++G E +  +      +          
Sbjct: 55  VGGSSSKFPSPFASRTGALGGIVVGKNMQNGNIVFGAELEGNFAEAEHRIGHGGTLQQSW 114

Query: 117 GGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESL 176
            G+ + + GY   D  L+Y T G  V +               G   G GVE   LS  L
Sbjct: 115 NGNAKGKVGYAF-DKTLVYGTAGYGVTRFKAKDNTTSAPGWEGGVLIGAGVEQ-ALSGPL 172

Query: 177 VARLEYRASKYSKVEG-----------FYNTISLGVGMKF 205
             + EY   +++ V+              ++I  G+  KF
Sbjct: 173 SVKAEYDFQRFNDVKSQVNGIEQRNNLKNHSIKAGLNYKF 212


>gi|209883207|ref|YP_002287064.1| carbohydrate-selective porin OprB [Oligotropha carboxidovorans OM5]
 gi|209871403|gb|ACI91199.1| carbohydrate-selective porin OprB [Oligotropha carboxidovorans OM5]
          Length = 644

 Score = 81.8 bits (200), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 46/199 (23%), Positives = 64/199 (32%), Gaps = 21/199 (10%)

Query: 14  ALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSFGEEAH 73
           A     SAQAAD   +A               ++                 +        
Sbjct: 5   AAFPALSAQAADLPLKAPAIPAYDWNGAYVGAHIGYSFGTAHGEVID---GSAFPTHHHF 61

Query: 74  HNAGGSIFAGYNVEDS-CIMYGVEGDVRY-----------TVPVLADNIHSLHGIGGSLR 121
             A     AGYNV     I+ G E D+ +           T P   + +       GSLR
Sbjct: 62  GGAMAGFHAGYNVLLPSRILLGAEADISFPSYFESNALIATTPTAGNMLTERLDYAGSLR 121

Query: 122 IRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPI----AIGGTAGVGVEVGGLSESLV 177
            R GY  +   LLY T G   A +    +             G TAG G+E   ++    
Sbjct: 122 ARLGYA-TPQWLLYVTGGFAFAGERFENELAPFKDKRIAYRTGWTAGAGIEY-AIAPLWS 179

Query: 178 ARLEYRASKYSKVEGFYNT 196
           ARLEY  S + +     N+
Sbjct: 180 ARLEYLYSDFGRTSVVMNS 198


>gi|39936434|ref|NP_948710.1| putative outer membrane protein [Rhodopseudomonas palustris CGA009]
 gi|39650289|emb|CAE28812.1| putative outer membrane protein [Rhodopseudomonas palustris CGA009]
          Length = 240

 Score = 81.8 bits (200), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 36/238 (15%), Positives = 69/238 (28%), Gaps = 41/238 (17%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+ +   +  ++  +A    A AAD   R +                 + +++ G Y G 
Sbjct: 1   MKTMKNTLLGAAAVIALSAPAFAADLPPRPYTKAAPAYTAP------EVVYNWTGFYVGG 54

Query: 61  SALYNGSFGEE---AHHNAGGSIFAGYNVEDS-CIMYGVEGDVRYTVPV-------LADN 109
                 +             G +  G + + +   + G+E    +               
Sbjct: 55  HVGGAWAGDNNITGNSGRFFGGVQGGADYQFATNWVIGIEAQYSWMSSNNTGVIFPGGST 114

Query: 110 IHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYET--------GKAGEITPIAIGG 161
                   GS+  R GY    + L+YA  G        +                   G 
Sbjct: 115 ATEDTRGLGSVTGRLGYAWGPT-LVYAKGGYAWRDSDLSVASLGGVPSGYTTSGSRNDGY 173

Query: 162 TAGVGVEVGGLSESLVARLEYRASKYSKV--------------EGFYNTISLGVGMKF 205
           T G G+E    + S  A++EY+  K+                     +T+  G+  +F
Sbjct: 174 TVGAGLEY-MFAPSWSAKVEYQYYKFGDTTFTGGPADVVGTSFRNDEHTVKAGINYRF 230


>gi|238754341|ref|ZP_04615697.1| Outer membrane protein A [Yersinia ruckeri ATCC 29473]
 gi|238707374|gb|EEP99735.1| Outer membrane protein A [Yersinia ruckeri ATCC 29473]
          Length = 355

 Score = 81.8 bits (200), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 33/217 (15%), Positives = 63/217 (29%), Gaps = 30/217 (13%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K   A+ ++         AQAA                     Y   +  ++  +   
Sbjct: 1   MKKT--AIALAVALAGFATVAQAA---------------PKDNTWYTGGKLGWSQFHDVG 43

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGSL 120
           +     + G       G   F GY              +            +    G  L
Sbjct: 44  TGSDISNDGPTHKSQLGAGAFVGYQANQYLGFEMGYDWLGRMPYKGDTVNGAFKAQGVQL 103

Query: 121 RIRGGYEVSDSLLLYATVGPDVAQKYET------GKAGEITPIAIGGTAGVGVEVGGLSE 174
             +  Y ++  L LY  +G  V +   +                +   A VG+E   +++
Sbjct: 104 AAKLSYPIAQDLDLYTRLGGMVWRADASVNEPSTNSHASAHDTGVSPLAAVGLEY-AVTK 162

Query: 175 SLVARLEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
           +   RL+Y+          V    +   +S+GV  +F
Sbjct: 163 NWATRLDYQWVNNIGDRGTVGARPDNGMLSVGVSYRF 199


>gi|110804972|ref|YP_688492.1| outer membrane protein A [Shigella flexneri 5 str. 8401]
 gi|110614520|gb|ABF03187.1| outer membrane protein 3a [Shigella flexneri 5 str. 8401]
          Length = 348

 Score = 81.8 bits (200), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 37/216 (17%), Positives = 70/216 (32%), Gaps = 32/216 (14%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K  +A+ V+         AQAA                     Y   +  ++  +   
Sbjct: 1   MKKTAIAIAVALA--GFATVAQAA---------------PKDNTWYTGAKLGWSQYHDT- 42

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGSL 120
              +  + G    +  G   F GY V            +        +   +    G  L
Sbjct: 43  --GFIPNNGPTHENQLGAGAFGGYQVNPYVGFEMGYDWLGRMPYKGDNINGAYKAQGVQL 100

Query: 121 RIRGGYEVSDSLLLYATVGPDVAQKYET-----GKAGEITPIAIGGTAGVGVEVGGLSES 175
             + GY ++D L +Y  +G  V +         G + +     +      GVE   ++  
Sbjct: 101 TAKLGYPITDDLDIYTRLGGMVWRADTKANVPGGASFKDHDTGVSPVFAGGVEY-AITPE 159

Query: 176 LVARLEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
           +  RLEY+ +      + +    +   +SLGV  +F
Sbjct: 160 IATRLEYQWTNNIGDANTIGTRPDNGLLSLGVSYRF 195


>gi|30062494|ref|NP_836665.1| outer membrane protein A [Shigella flexneri 2a str. 2457T]
 gi|56479781|ref|NP_706879.2| outer membrane protein A [Shigella flexneri 2a str. 301]
 gi|82544719|ref|YP_408666.1| outer membrane protein A [Shigella boydii Sb227]
 gi|30040740|gb|AAP16471.1| outer membrane protein 3a (II*;G;d) [Shigella flexneri 2a str.
           2457T]
 gi|56383332|gb|AAN42586.2| outer membrane protein 3a (II*;G;d) [Shigella flexneri 2a str. 301]
 gi|81246130|gb|ABB66838.1| outer membrane protein 3a [Shigella boydii Sb227]
 gi|313650796|gb|EFS15197.1| outer membrane protein A [Shigella flexneri 2a str. 2457T]
 gi|332759051|gb|EGJ89361.1| outer membrane protein A [Shigella flexneri 4343-70]
 gi|332759932|gb|EGJ90233.1| outer membrane protein A [Shigella flexneri 2747-71]
 gi|332762738|gb|EGJ93001.1| outer membrane protein A [Shigella flexneri K-671]
 gi|332767750|gb|EGJ97941.1| outer membrane protein 3a [Shigella flexneri 2930-71]
 gi|333001202|gb|EGK20770.1| outer membrane protein A [Shigella flexneri VA-6]
 gi|333006193|gb|EGK25702.1| outer membrane protein A [Shigella flexneri K-218]
 gi|333008941|gb|EGK28401.1| outer membrane protein A [Shigella flexneri K-272]
 gi|333020097|gb|EGK39368.1| outer membrane protein A [Shigella flexneri K-304]
 gi|333020253|gb|EGK39523.1| outer membrane protein A [Shigella flexneri K-227]
          Length = 348

 Score = 81.8 bits (200), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 37/216 (17%), Positives = 70/216 (32%), Gaps = 32/216 (14%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K  +A+ V+         AQAA                     Y   +  ++  +   
Sbjct: 1   MKKTAIAIAVALA--GFATVAQAA---------------PKDNTWYTGAKLGWSQYHDT- 42

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGSL 120
              +  + G    +  G   F GY V            +        +   +    G  L
Sbjct: 43  --GFIPNNGPTHENQLGAGAFGGYQVNPYVGFEMGYDWLGRMPYKGDNINGAYKAQGVQL 100

Query: 121 RIRGGYEVSDSLLLYATVGPDVAQKYET-----GKAGEITPIAIGGTAGVGVEVGGLSES 175
             + GY ++D L +Y  +G  V +         G + +     +      GVE   ++  
Sbjct: 101 TAKLGYPITDDLDIYTRLGGMVWRADTKANVPGGASFKDHDTGVSPVFAGGVEY-AITPE 159

Query: 176 LVARLEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
           +  RLEY+ +      + +    +   +SLGV  +F
Sbjct: 160 IATRLEYQWTNNIGDANTIGTRPDNGLLSLGVSYRF 195


>gi|332342400|gb|AEE55734.1| outer membrane protein OmpA [Escherichia coli UMNK88]
          Length = 350

 Score = 81.8 bits (200), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 37/216 (17%), Positives = 69/216 (31%), Gaps = 32/216 (14%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K  +A+ V+         AQAA                     Y   +  ++  +   
Sbjct: 1   MKKTAIAIAVALA--GFATVAQAA---------------PKDNTWYTGAKLGWSQYHDT- 42

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGSL 120
              +  + G    +  G   F GY V            +        +   +    G  L
Sbjct: 43  --GFIPNNGPTHENQLGAGAFGGYQVNPYVGFEMGYDWLGRMPYKGDNINGAYKAQGVQL 100

Query: 121 RIRGGYEVSDSLLLYATVGPDVAQKYET-----GKAGEITPIAIGGTAGVGVEVGGLSES 175
             + GY ++D L +Y  +G  V +         G + +     +      GVE   ++  
Sbjct: 101 TAKLGYPITDDLDVYTRLGGMVWRADTKANVPGGASFKDHDTGVSPVFAGGVEY-AITPE 159

Query: 176 LVARLEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
           +  RLEY+ +        +    +   +SLGV  +F
Sbjct: 160 IATRLEYQWTNNIGDAHTIGTRPDNGMLSLGVSYRF 195


>gi|299773243|gb|ADJ38696.1| outer membrane protein P5 [Haemophilus parasuis]
          Length = 365

 Score = 81.8 bits (200), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 43/228 (18%), Positives = 82/228 (35%), Gaps = 31/228 (13%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATN-RYVPIRHDFNGPYAG 59
           M+K  +A+ VS LA+AS     AA      + G +    T   +   +  ++  +  YA 
Sbjct: 1   MKKSLIALAVSGLAVASVS--NAAPQADSFYVGAKAGWATFHNDINQLNFKYKNDARYAT 58

Query: 60  LSALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGS 119
            +  Y         ++    +F GY + D+  +               +     H   G+
Sbjct: 59  SANGYG-----INRNSVTYGVFGGYQIIDNLAVELGYDYFGRVRGNKQEFREFKHSAHGT 113

Query: 120 -LRIRGGYEVSDSLLLYATVGPDVAQKYE-----TGKAGEITPIAIGGTAGVGVEVGGLS 173
            L ++  YEV   L +Y  VG  + +        T +  +   +      G GVE   + 
Sbjct: 114 HLSLKPSYEVLSGLDVYGKVGAALVRNDYKRYFQTREPVKSHNLKTSLIVGAGVEY-AIL 172

Query: 174 ESLVARLEYRAS----KYSKVEG------------FYNTISLGVGMKF 205
             L  R+EY+       ++K E               ++++ G+  +F
Sbjct: 173 PELAFRVEYQWLSNVGNFTKAEMKENRRATYNYSPDSHSVTAGISYRF 220


>gi|256113839|ref|ZP_05454632.1| hypothetical membrane protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|265995187|ref|ZP_06107744.1| outer membrane protein [Brucella melitensis bv. 3 str. Ether]
 gi|262766300|gb|EEZ12089.1| outer membrane protein [Brucella melitensis bv. 3 str. Ether]
          Length = 212

 Score = 81.8 bits (200), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 46/220 (20%), Positives = 79/220 (35%), Gaps = 26/220 (11%)

Query: 2   QKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLS 61
           ++   A  + +  +A   SA AAD +    +     V            HD++G Y G  
Sbjct: 3   KRSITAAALGAAVMAFAGSAFAADMMGGTDYTYYDPVAAGP--------HDWSGNYVGAQ 54

Query: 62  ALYNGSFGEE---AHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVP--VLADNIHSLHGI 116
              + S       +   A G I  G N+++  I++G E +  +      +          
Sbjct: 55  VGGSSSKFPSPFASRTGALGGIVVGKNMQNGNIVFGAELEGNFAEAEHRIGHGGTLQQSW 114

Query: 117 GGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESL 176
            G+ + + GY   D  L+Y T G  V +          +    G   G GVE   LS  L
Sbjct: 115 NGNAKGKVGYTF-DKTLVYGTAGYGVTRFKAKDNTTSASGCEGGVLIGAGVEQ-ALSGPL 172

Query: 177 VARLEYRASKYSKVEG-----------FYNTISLGVGMKF 205
             + EY   +++ V+              ++I  G+  KF
Sbjct: 173 SVKAEYDFQRFNDVKSQVNGIEQRNNLKNHSIKAGLNYKF 212


>gi|39935611|ref|NP_947887.1| outer membrane protein [Rhodopseudomonas palustris CGA009]
 gi|39649464|emb|CAE27986.1| possible outer membrane protein [Rhodopseudomonas palustris CGA009]
          Length = 997

 Score = 81.8 bits (200), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 43/240 (17%), Positives = 72/240 (30%), Gaps = 38/240 (15%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADP---VRRAHHGGRGVVPTIATNRYVPIRHDFNGPY 57
           M+     + V S+   +  SA AAD       +               +V      +   
Sbjct: 1   MKNFPAWLSVWSVVAVACGSAHAADLQNVAVPSAVPAATNWTGFYIGTHVGAAASESAWN 60

Query: 58  AGLSALYNGSFGEEAHHNAGG----SIFAGYNVEDSCIMYGVEGDVRYTVPV-------L 106
           +   +    + G    H   G     I  GYN +    + G+EGD  +            
Sbjct: 61  SIAGSGAGLAAGPFPGHGVSGNAIAGIQGGYNAQFGNYVLGIEGDASFGSINGLARCLHG 120

Query: 107 ADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEI------TPIAIG 160
                S      +L  R GY   D LL+Y   G   A  +    +G        +    G
Sbjct: 121 TFACTSRIDELWTLAARFGYAAGD-LLVYGKAGAAWADVHRRMASGNFVNVLEASETRSG 179

Query: 161 GTAGVGVEVGGLSESLVARLEYRASKYSK----------------VEGFYNTISLGVGMK 204
              G GVE   L   L A++EY  + +                  +    + + +G+  +
Sbjct: 180 WLLGAGVEYAFL-PGLSAKIEYNYADFGNRSLTMADQFGDVSDVSIGQTAHLVKVGLNYR 238



 Score = 69.8 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 36/218 (16%), Positives = 56/218 (25%), Gaps = 45/218 (20%)

Query: 31  HHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSFGE-------------------- 70
           +  G   V           +  + G Y G+ A       +                    
Sbjct: 237 YRIGAASVSAAPLPGVPLPQWSWTGIYLGVHAGGGFGSNDWDSATGALLAASTSGGFPGR 296

Query: 71  EAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLAD------------NIHSLHGIGG 118
                  G    G N +    + GVE                          H+     G
Sbjct: 297 GDSSGLFGGGQIGANYQFGRWVAGVEASAAAADIGGYAKCATDVGTRRNFTCHNELSSLG 356

Query: 119 SLRIRGGYEVSDSLLLYATVGPDVAQKYE------TGKAGEITPIAIGGTAGVGVEVGGL 172
           ++  R G    + LL+Y   G   A          +      +    G   G G+E   L
Sbjct: 357 TITGRLGQTWGN-LLIYGKAGAAWATGSSDAQRAGSASRFTESGTRWGWVTGTGLEY-AL 414

Query: 173 SESLVARLEYRASKYSKVEGFY-----NTISLGVGMKF 205
           S +L A +EY    +   +  Y     N   +G   KF
Sbjct: 415 SPNLSAFVEYNHVDFGTQDTAYVDQFGNASEVGFKQKF 452



 Score = 68.7 bits (166), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 45/226 (19%), Positives = 61/226 (26%), Gaps = 55/226 (24%)

Query: 33  GGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSFGEEAH-------------HNAGGS 79
                   IA         ++ G Y G S          A                A   
Sbjct: 766 AAETSAHGIAKAPQRIAPTNWTGLYVGASVGAGWGRTTYADPFPTPTTGDRADLGGALLG 825

Query: 80  IFAGYNVEDSCIMYGVEGDVRYTVPVLAD--------------NIHSLHGIGGSLRIRGG 125
              G N +   ++ GVE    +      D              N  S     G+   RGG
Sbjct: 826 GQIGANYQFGHLVAGVEASANWANIRGTDTCFGAYPNPVVAGFNCGSRIDAIGAFTARGG 885

Query: 126 YEVSDSLLLYATVGPDVAQKYET-------GKAGEITPIAIGGTAGVGVEVGGLSESLVA 178
           Y + D  LLY   G    ++ +        G     T    G T G G+E   L+ S   
Sbjct: 886 YAI-DRTLLYVKGGAAWDRQQDQFNTVGVGGTTLASTSTNWGWTVGGGLEY-ALAPSWSM 943

Query: 179 RLEYRASKYS-------------------KVEGFYNTISLGVGMKF 205
            LEY+   +                           T+SLGV  KF
Sbjct: 944 ALEYKYFDFGASPAFSTSVTPALDGVNLAPQTNKLQTVSLGVNYKF 989


>gi|119383169|ref|YP_914225.1| outer membrane protein [Paracoccus denitrificans PD1222]
 gi|119372936|gb|ABL68529.1| outer membrane protein [Paracoccus denitrificans PD1222]
          Length = 255

 Score = 81.8 bits (200), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 50/250 (20%), Positives = 78/250 (31%), Gaps = 47/250 (18%)

Query: 2   QKLFLAVGVSSLALASFCSAQA-------------ADPVRRAHHGGRGVVPTIATNRYVP 48
           +    A  V+SLAL +  +A A             A  V  A  G         T  Y  
Sbjct: 7   KASLTAGAVASLALGTALAANAGGYTPPVVDTDVTAPVVESAPVGDWAGAYAGLTLGYAF 66

Query: 49  IRHDFNGPYAGLSALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPV--- 105
              D  G     +  Y G  G+     A   +  GY  +    ++G E            
Sbjct: 67  GGDDRVGFTEVDTGTYLGDAGKLELGGANAGLHVGYRWQRDRWVFGPELGFEAGNIKDTI 126

Query: 106 -------LADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITP-- 156
                   + ++ S      +LR++ GY +   LLLY   G   A         + +   
Sbjct: 127 TFDNQLGGSTDVSSKIRNVLALRLKTGYALRPDLLLYGIAGIARADVEYKVAGTDGSGGS 186

Query: 157 -------IAIGGTAGVGVEVGGLSESLVARLEYRASKYSKV--------------EGFYN 195
                   + G   G+GVE   LS+ +    EY  + + K                  Y+
Sbjct: 187 MSESRDFKSNGYIVGLGVE-RKLSDRMSVTGEYEYANFGKTTRTFQVDGGVSTQATPDYH 245

Query: 196 TISLGVGMKF 205
            + LG+  KF
Sbjct: 246 NVKLGLNFKF 255


>gi|293409335|ref|ZP_06652911.1| outer membrane protein A [Escherichia coli B354]
 gi|291469803|gb|EFF12287.1| outer membrane protein A [Escherichia coli B354]
          Length = 350

 Score = 81.8 bits (200), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 38/219 (17%), Positives = 70/219 (31%), Gaps = 38/219 (17%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K  +A+ V+         AQAA                     Y   +  ++  +   
Sbjct: 1   MKKTAIAIAVALA--GFATVAQAA---------------PKDNTWYTGAKLGWSQYHDT- 42

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGG-- 118
              +  + G    +  G   F GY V       G E    +   +     +         
Sbjct: 43  --GFIPNNGPTHENQLGAGAFGGYQV---NPYVGFEMGYDWLGRMPYKGDNINGAYKAQG 97

Query: 119 -SLRIRGGYEVSDSLLLYATVGPDVAQKYET-----GKAGEITPIAIGGTAGVGVEVGGL 172
             L  + GY ++D L +Y  +G  V +         G + +     +      GVE   +
Sbjct: 98  VQLTAKLGYPITDDLDIYTRLGGMVWRADTKANVPGGASFKDHDTGVSPVFAGGVEY-AI 156

Query: 173 SESLVARLEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
           +  +  RLEY+ +        +    +   +SLGV  +F
Sbjct: 157 TPEIATRLEYQWTNNIGDAHTIGTRPDNGMLSLGVSYRF 195


>gi|283784777|ref|YP_003364642.1| outer membrane protein A [Citrobacter rodentium ICC168]
 gi|282948231|emb|CBG87798.1| outer membrane protein A [Citrobacter rodentium ICC168]
          Length = 351

 Score = 81.8 bits (200), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 35/217 (16%), Positives = 70/217 (32%), Gaps = 33/217 (15%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K   A+ ++         AQAA                     Y   +  ++  +   
Sbjct: 1   MKKT--AIAIAVALAGFATVAQAA---------------PKDNTWYTGAKLGWSQYHDT- 42

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGSL 120
              +  + G    +  G   F GY V            +       +    +    G  L
Sbjct: 43  --GFIDNNGPTHENQLGAGAFGGYQVNPYVGFEMGYDWLGRMPYKGSVENGAYKAQGVQL 100

Query: 121 RIRGGYEVSDSLLLYATVGPDVAQKYE------TGKAGEITPIAIGGTAGVGVEVGGLSE 174
             + GY ++D L +Y  +G  V +         TG + +     +      G+E   ++ 
Sbjct: 101 TAKLGYPITDDLDIYTRLGGMVWRADTKSHNNLTGASTKDHDTGVSPVFAGGIE-WAMTR 159

Query: 175 SLVARLEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
            +  RLEY+ +      + +    +   +S+GV  +F
Sbjct: 160 DIATRLEYQWTNNIGDANTIGTRPDNGLLSVGVSYRF 196


>gi|82776247|ref|YP_402596.1| outer membrane protein A [Shigella dysenteriae Sd197]
 gi|81240395|gb|ABB61105.1| outer membrane protein 3a [Shigella dysenteriae Sd197]
          Length = 350

 Score = 81.8 bits (200), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 36/216 (16%), Positives = 68/216 (31%), Gaps = 32/216 (14%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K   A+ ++         AQAA                     Y   +  ++  +   
Sbjct: 1   MKKT--AIAITVALAGFATVAQAA---------------PKDNTWYTGAKLGWSQYHDT- 42

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGSL 120
              +  + G    +  G   F GY V            +       +    +    G  L
Sbjct: 43  --GFIDNNGPTHENQLGAGAFGGYQVNPYVGFEMGYDWLGRMPYKGSVENGAYKAQGVQL 100

Query: 121 RIRGGYEVSDSLLLYATVGPDVAQKYET-----GKAGEITPIAIGGTAGVGVEVGGLSES 175
             + GY ++D L +Y  +G  V +         G + +     +      GVE   ++  
Sbjct: 101 TAKLGYPITDDLDIYTRLGGMVWRADTKANVPGGASFKDHDTGVSPVFAGGVEY-AITPE 159

Query: 176 LVARLEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
           +  RLEY+ +        +    +   +SLGV  +F
Sbjct: 160 IATRLEYQWTNNIGDAHTIGTRPDNGLLSLGVSYRF 195


>gi|320540573|ref|ZP_08040223.1| putative outer membrane protein A (3a;II*;G;d) [Serratia symbiotica
           str. Tucson]
 gi|320029504|gb|EFW11533.1| putative outer membrane protein A (3a;II*;G;d) [Serratia symbiotica
           str. Tucson]
          Length = 382

 Score = 81.8 bits (200), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 38/220 (17%), Positives = 65/220 (29%), Gaps = 33/220 (15%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K   A+ ++         AQAA                     Y   +  ++  +   
Sbjct: 26  MKKT--AIALAVALAGFATVAQAA---------------PKDNTWYTGAKLGWSQYHDVG 68

Query: 61  SALYNG----SFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGI 116
                       G    +  G   F GY              +       + N  +    
Sbjct: 69  FYGNGYQDGIGNGPTHKNELGAGAFLGYQANQYLGFELGYDWLGRMPYKGSVNNGAFKAQ 128

Query: 117 GGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGE-----ITPIAIGGTAGVGVEVGG 171
           G  L  +  Y + D+L +Y  +G  V +                   +   A VGVE   
Sbjct: 129 GVQLAAKLSYPIVDNLDIYTRLGGMVWRADSKASYDNVRRLSANDTGVSPLAAVGVEY-A 187

Query: 172 LSESLVARLEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
           L+++L  RL+Y+          V    +   +SLGV  +F
Sbjct: 188 LTKNLATRLDYQFVSNIGDAGTVGARPDNTMLSLGVSYRF 227


>gi|218513075|ref|ZP_03509915.1| outer membrane protein [Rhizobium etli 8C-3]
          Length = 134

 Score = 81.8 bits (200), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 37/122 (30%), Positives = 61/122 (50%), Gaps = 3/122 (2%)

Query: 83  GYNVEDSCIMYGVEGDVRYTVPV-LADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPD 141
           GYN +   I+YGVE D+ Y+     +  + + +G  GS+R R GY+++   LLY T G  
Sbjct: 2   GYNWQQGQIVYGVESDLGYSGDDVSSGGVKNKYGWNGSVRGRVGYDMNP-FLLYGTAGLA 60

Query: 142 VAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFYNTISLGV 201
           +     +    + +  A G T G GVE   ++ ++  RLEYR + Y   +   ++ S   
Sbjct: 61  LGNIKVSDGTSDESKTAYGYTVGAGVE-AFVTNNITTRLEYRYTDYQSKDYDLDSGSFSR 119

Query: 202 GM 203
           G 
Sbjct: 120 GY 121


>gi|262039986|ref|ZP_06013251.1| outer membrane protein A [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|259042654|gb|EEW43660.1| outer membrane protein A [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
          Length = 364

 Score = 81.8 bits (200), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 38/219 (17%), Positives = 66/219 (30%), Gaps = 32/219 (14%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K  +A+ V+         AQAA                     Y   +  ++  +   
Sbjct: 9   MKKTAIAIAVALA--GFATVAQAA---------------PKDNTWYAGGKLGWSQYHDTG 51

Query: 61  SALYNG--SFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGG 118
                   + G   +   G   F GY V            +       + +  +    G 
Sbjct: 52  FYGNGFQNNNGPTRNDQLGAGAFGGYQVNPYLGFEMGYDWLGRMAYKGSVDNGAFKAQGV 111

Query: 119 SLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAG------EITPIAIGGTAGVGVEVGGL 172
            L  + GY ++D L +Y  +G  V +    G               +      GVE   +
Sbjct: 112 QLTAKLGYPITDDLDIYTRLGGMVWRADSKGNYASTGVSRSEHDTGVSPVFAGGVE-WAV 170

Query: 173 SESLVARLEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
           +  +  RLEY+          V    +   +SLGV  +F
Sbjct: 171 TRDIATRLEYQWVNNIGDAGTVGTRPDNGMLSLGVSYRF 209


>gi|330010302|ref|ZP_08306729.1| outer membrane protein A [Klebsiella sp. MS 92-3]
 gi|328534592|gb|EGF61172.1| outer membrane protein A [Klebsiella sp. MS 92-3]
          Length = 364

 Score = 81.4 bits (199), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 38/219 (17%), Positives = 66/219 (30%), Gaps = 32/219 (14%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K  +A+ V+         AQAA                     Y   +  ++  +   
Sbjct: 9   MKKTAIAIAVALA--GFATVAQAA---------------PKDNTWYAGGKLGWSQYHDTG 51

Query: 61  SALYNG--SFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGG 118
                   + G   +   G   F GY V            +       + +  +    G 
Sbjct: 52  FYGNGFQNNNGPTRNDQLGAGAFGGYQVNPYLGFEMGYDWLGRMAYKGSVDNGAFKAQGV 111

Query: 119 SLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAG------EITPIAIGGTAGVGVEVGGL 172
            L  + GY ++D L +Y  +G  V +    G               +      GVE   +
Sbjct: 112 QLTAKLGYPITDDLDIYTRLGGMVWRADSKGNYASTGVSRSEHDTGVSPVFAGGVE-WAV 170

Query: 173 SESLVARLEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
           +  +  RLEY+          V    +   +SLGV  +F
Sbjct: 171 TRDIATRLEYQWVNNIGDAGTVGTRPDNGMLSLGVSYRF 209


>gi|192291194|ref|YP_001991799.1| outer membrane insertion C-terminal signal [Rhodopseudomonas
           palustris TIE-1]
 gi|192284943|gb|ACF01324.1| outer membrane insertion C-terminal signal [Rhodopseudomonas
           palustris TIE-1]
          Length = 997

 Score = 81.4 bits (199), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 43/240 (17%), Positives = 72/240 (30%), Gaps = 38/240 (15%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADP---VRRAHHGGRGVVPTIATNRYVPIRHDFNGPY 57
           M+     + V S+   +  SA AAD       +               +V      +   
Sbjct: 1   MKNFPAWLSVWSVVAVACGSAHAADLQNGAVPSAVPAATNWTGFYIGTHVGAAASDSAWN 60

Query: 58  AGLSALYNGSFGEEAHHNAGG----SIFAGYNVEDSCIMYGVEGDVRYTVPV-------L 106
           +   +    + G    H   G     I  GYN +    + G+EGD  +            
Sbjct: 61  SIAGSGAGLAAGPFPGHGVSGNAIAGIQGGYNAQFGNYVLGIEGDASFGSINGLARCLHG 120

Query: 107 ADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEI------TPIAIG 160
                S      +L  R GY   D LL+Y   G   A  +    +G        +    G
Sbjct: 121 TFACTSRIDELWTLAARFGYAAGD-LLVYGKAGAAWADVHRRMASGNFVNVLEASETRSG 179

Query: 161 GTAGVGVEVGGLSESLVARLEYRASKYS----------------KVEGFYNTISLGVGMK 204
              G GVE   L   L A++EY  + +                  +    + + +G+  +
Sbjct: 180 WLLGAGVEYAFL-PGLSAKIEYNYADFGSRSLTMADQFGDVSDVSIGQTAHLVKVGLNYR 238



 Score = 70.6 bits (171), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 41/228 (17%), Positives = 57/228 (25%), Gaps = 44/228 (19%)

Query: 18  FCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSFGEEAHHNAG 77
              A A    +            +     V                   +        A 
Sbjct: 766 AAEASAHGITKAPPRIAPTNWTGLYVGASVGAGWGRTTYADPFPT--PTTGDRADLGGAL 823

Query: 78  GSIFAGYNVEDSCIMYGVEGDVRYTVPVLAD--------------NIHSLHGIGGSLRIR 123
                G N +   ++ GVE    +      D              N  S     G+   R
Sbjct: 824 LGGQIGANYQFGHLVAGVEASANWANIRGTDTCFGAYPNPVVAGFNCGSRIDAIGAFTAR 883

Query: 124 GGYEVSDSLLLYATVGPDVAQKYET-------GKAGEITPIAIGGTAGVGVEVGGLSESL 176
           GGY + D  LLY   G    ++ +        G     T    G T G G+E   L+ S 
Sbjct: 884 GGYAI-DRTLLYVKGGAAWDRQQDQFNTVGVGGTTLANTSTNWGWTVGGGLEY-ALAPSW 941

Query: 177 VARLEYRASKYS-------------------KVEGFYNTISLGVGMKF 205
              LEY+   +                           T SLGV  KF
Sbjct: 942 SMALEYKYFDFGASPAFSTSVTPALDGVNLAPQSNKLQTASLGVNYKF 989



 Score = 69.4 bits (168), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 36/218 (16%), Positives = 56/218 (25%), Gaps = 45/218 (20%)

Query: 31  HHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSFGE-------------------- 70
           +  G   V           +  + G Y G+ A       +                    
Sbjct: 237 YRLGAASVSAAPLPGVPLPQWSWTGIYLGVHAGGGFGSNDWDSATGALLAASTSGGFPGR 296

Query: 71  EAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLAD------------NIHSLHGIGG 118
                  G    G N +    + GVE                          H+     G
Sbjct: 297 GDSSGLFGGGQIGANYQFGRWVAGVEASAAAADIGGYAKCATDVGTRRNFTCHNELSSLG 356

Query: 119 SLRIRGGYEVSDSLLLYATVGPDVAQKYE------TGKAGEITPIAIGGTAGVGVEVGGL 172
           ++  R G    + LL+Y   G   A          +      +    G   G G+E   L
Sbjct: 357 TITGRLGQTWGN-LLIYGKAGAAWATGSSDAQRAGSASRFTESGTRWGWVTGTGLEY-AL 414

Query: 173 SESLVARLEYRASKYSKVEGFY-----NTISLGVGMKF 205
           S +L A +EY    +   +  Y     N   +G   KF
Sbjct: 415 SPNLSAFVEYNHVDFGTQDTAYVDQFGNASEVGFKQKF 452


>gi|254504423|ref|ZP_05116574.1| OmpA-like transmembrane domain, putative [Labrenzia alexandrii
           DFL-11]
 gi|222440494|gb|EEE47173.1| OmpA-like transmembrane domain, putative [Labrenzia alexandrii
           DFL-11]
          Length = 221

 Score = 81.4 bits (199), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 38/200 (19%), Positives = 67/200 (33%), Gaps = 28/200 (14%)

Query: 32  HGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSFGEEAHHNAGGSI---------FA 82
                  P            D+ G Y G    +     + +   A  S          +A
Sbjct: 24  PQSPAPAPAYDAVPAGQQSIDWTGFYVGTQLGWAFGNFDNSTGGASSSFSNNGVGGGAYA 83

Query: 83  GYNVED-SCIMYGVEGDVRYTVPVLADNIH-----SLHGIGGSLRIRGGYEVSDSLLLYA 136
           GYN +    ++ G+E D   T    +  ++     S      + R R GY   D  ++Y 
Sbjct: 84  GYNFQVTPNVVVGLESDFSLTDLEKSGTVNGLSLKSSSDWNANFRGRLGYAF-DRYMIYG 142

Query: 137 TVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFY-- 194
             G  +A    T      +  A+G T G G E   +++++VAR +Y    +   +     
Sbjct: 143 AGGLAIADLEATANGVSDSKTALGWTLGAGAE-AAITQNVVARFDYSYQDFGDQDFNLGG 201

Query: 195 ---------NTISLGVGMKF 205
                    + +  G+  KF
Sbjct: 202 TGVSTEFNDHQVRAGIAYKF 221


>gi|308186299|ref|YP_003930430.1| Outer membrane protein A precursor [Pantoea vagans C9-1]
 gi|308056809|gb|ADO08981.1| Outer membrane protein A precursor [Pantoea vagans C9-1]
          Length = 356

 Score = 81.4 bits (199), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 38/218 (17%), Positives = 64/218 (29%), Gaps = 31/218 (14%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K  +A+ V+         AQAA                     Y   +  ++  +   
Sbjct: 1   MKKTAIAIAVALA--GFATVAQAA---------------PKDDTWYTGAKLGWSQYHDTG 43

Query: 61  SAL--YNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGG 118
                Y  + G       G   F GY              +            +    G 
Sbjct: 44  YYGNGYENNNGPTHESQLGAGAFVGYQANPYLGFELGYDWLGRMPNKGTVTNGAFKAQGV 103

Query: 119 SLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGE-----ITPIAIGGTAGVGVEVGGLS 173
            L  +  Y + D L +Y  +G  V +   T               +   A VGVE   L+
Sbjct: 104 QLAAKLSYPIYDDLDVYTRLGGMVWRADATQTNPTTGRISDHDTGVSPLAAVGVEY-ALT 162

Query: 174 ESLVARLEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
           ++   RL+Y+          V    +   +S+GV  +F
Sbjct: 163 KNWATRLDYQWVNNIGDAQTVGTRPDNGMLSVGVSYRF 200


>gi|167622915|ref|YP_001673209.1| OmpA/MotB domain-containing protein [Shewanella halifaxensis
           HAW-EB4]
 gi|167352937|gb|ABZ75550.1| OmpA/MotB domain protein [Shewanella halifaxensis HAW-EB4]
          Length = 356

 Score = 81.4 bits (199), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 41/217 (18%), Positives = 64/217 (29%), Gaps = 23/217 (10%)

Query: 1   MQKLFLAVGVS----SLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGP 56
           M KL     VS    +L   S  +  AA+             P           H  N  
Sbjct: 1   MVKLRSIANVSIVFSTLLYLSLGAVYAAETDNSE--AANEFDPYFYLGAKAGQMHYQNAC 58

Query: 57  YAGLSALYNGSFGEEAHHNAGGSIFAGYN-VE---DSCIMYGVEGDVRYTVPVLADNIHS 112
            +               ++ G   F GY   +          +   V +      +N ++
Sbjct: 59  ESW--------SISCDGNDVGFGGFVGYQAWQYLGFETAYLDLGEAVAHYSESGVNNTYT 110

Query: 113 LHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGL 172
               G  +     + +S+S  L+A  G         G     +        G GVE   L
Sbjct: 111 GSMKGWEISAVTRFSLSESFELFAKAGSVYWDGDNRGPQSRNSDSDWAPMLGAGVEY-QL 169

Query: 173 SESLVARLEYRASK-YSKV---EGFYNTISLGVGMKF 205
           S S VARLEY+               +  +LG+  +F
Sbjct: 170 SPSWVARLEYQYIDSLGSDLIGGSNGHLTTLGISYRF 206


>gi|192292221|ref|YP_001992826.1| porin [Rhodopseudomonas palustris TIE-1]
 gi|192285970|gb|ACF02351.1| porin [Rhodopseudomonas palustris TIE-1]
          Length = 240

 Score = 81.4 bits (199), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 36/238 (15%), Positives = 69/238 (28%), Gaps = 41/238 (17%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+ +   +  ++  +A    A AAD   R +                 + +++ G Y G 
Sbjct: 1   MKTMKNTLLGAAAVIALSAPAFAADLPPRPYTKAAPAYTAP------EVVYNWTGFYVGG 54

Query: 61  SALYNGSFGEE---AHHNAGGSIFAGYNVEDS-CIMYGVEGDVRYTVPV-------LADN 109
                 +             G +  G + + +   + G+E    +               
Sbjct: 55  HVGGAWAGDNNITGNSGRFFGGVQGGADYQFATNWVIGIEAQYSWMSSNNTGVIFPGGST 114

Query: 110 IHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYET--------GKAGEITPIAIGG 161
                   GS+  R GY    + L+YA  G        +                   G 
Sbjct: 115 ATEDTRGLGSVTGRLGYAWGPT-LVYAKGGYAWRDSDLSVASLGGVPSGYTASGSRNDGY 173

Query: 162 TAGVGVEVGGLSESLVARLEYRASKYSKV--------------EGFYNTISLGVGMKF 205
           T G G+E    + S  A++EY+  K+                     +T+  G+  +F
Sbjct: 174 TVGAGLEY-MFAPSWSAKVEYQYYKFGDTTFTGGPADVVGTSFRNDEHTVKAGINYRF 230


>gi|90422268|ref|YP_530638.1| putative outer membrane protein [Rhodopseudomonas palustris BisB18]
 gi|90104282|gb|ABD86319.1| putative outer membrane protein [Rhodopseudomonas palustris BisB18]
          Length = 447

 Score = 81.4 bits (199), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 37/203 (18%), Positives = 59/203 (29%), Gaps = 44/203 (21%)

Query: 46  YVPIRHDFNGPYAGLSALYNGSFGEEAH-------------HNAGGSIFAGYNVEDSCIM 92
                 ++ G Y G +     +                       G    GYN + S  +
Sbjct: 238 APAPVANWTGFYLGGNFGSAFARNRTTASIGPFSEQFNLGLDGFAGGGQVGYNWQASNWV 297

Query: 93  YGVEGDVRYTVPVLADN--------IHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQ 144
           YG+E D + +     D           +     G++R R GY +  S L Y T G     
Sbjct: 298 YGLEADFQGSTQRDNDTAVLFGLAAYDAKLPWFGTVRGRLGYSLG-STLFYGTGGYAYGN 356

Query: 145 KYETGKAGEI----TPIAIGGTAGVGVEVGG-----LSESLVARLEYRASKYSKVEGFY- 194
              T  AG      +  A G TAG G+E        +  +  ++ EY           + 
Sbjct: 357 VKTTITAGTGSETISKTASGWTAGAGIETPFTLLGLVGPNWTSKTEYLYVDLGSTTSDFA 416

Query: 195 ------------NTISLGVGMKF 205
                       +    G+   F
Sbjct: 417 GGLAPNTIKVTEHIFRTGINYHF 439



 Score = 76.0 bits (185), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 44/236 (18%), Positives = 69/236 (29%), Gaps = 38/236 (16%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPY--- 57
           M+++   V +    + +  SAQAAD   +A +    +V       +    +   G     
Sbjct: 1   MKRILAGVAL----IGTAVSAQAADLATKAPYYKAPIVAVYDWTGFYVGVNAGAGLGRDR 56

Query: 58  -AGLSALYNGSFGEEAHHNAGGSIFAGYNVE----DSCIMYGVEGDVRYTVPVLAD---- 108
                A    S        A G    GYN +       ++ G+EGD +            
Sbjct: 57  AIQNFAPGLTSTTYLQPFGALGGGQIGYNYQTNSLFGPLVIGLEGDFQGADLSDTRTTLS 116

Query: 109 ---NIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEIT------PIAI 159
              N         + R R G      +L Y T G        T   G  T          
Sbjct: 117 GPVNYSQKLDWFATARGRIGIARGP-VLNYFTGGFAAGDVRTTVTEGGFTAFDSGKRTLT 175

Query: 160 GGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFY-----------NTISLGVGMK 204
           G T G GVE   L  +   ++EY           +           N   +G+  +
Sbjct: 176 GWTIGSGVE-AALGGNWTGKIEYLHLDLGNKTDSFLGQTLQTSVRENIFRVGLNYR 230


>gi|86749266|ref|YP_485762.1| outer membrane protein [Rhodopseudomonas palustris HaA2]
 gi|86572294|gb|ABD06851.1| outer membrane protein [Rhodopseudomonas palustris HaA2]
          Length = 274

 Score = 81.4 bits (199), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 30/171 (17%), Positives = 51/171 (29%), Gaps = 33/171 (19%)

Query: 66  GSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLA------------DNIHSL 113
               +            GYN +   +++G+EGD  +                  D   + 
Sbjct: 96  FGSQKYDTSGGFAGGVVGYNWQSGAVVFGLEGDYHWADINGTSSVINVGPPNLGDTYSTK 155

Query: 114 HGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGE-----ITPIAIGGTAGVGVE 168
               G ++ R GY      L + + G  V         G            G T G GVE
Sbjct: 156 LRGFGDIKGRLGYAAGP-ALWFVSGGAAVGDLQHRYDGGAANTFVQNKTKWGYTVGAGVE 214

Query: 169 VGGLSESLVARLEYRASKYSKV--------------EGFYNTISLGVGMKF 205
               + S  A+LEY      +               +  ++T+ +G+   F
Sbjct: 215 Y-MFAPSWSAKLEYNYIDLGRSTIQYTAAPTNRSEWKDTFHTVKVGINYHF 264


>gi|27379811|ref|NP_771340.1| outer-membrane immunogenic protein [Bradyrhizobium japonicum USDA
           110]
 gi|27352964|dbj|BAC49965.1| blr4700 [Bradyrhizobium japonicum USDA 110]
          Length = 229

 Score = 81.4 bits (199), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 40/197 (20%), Positives = 65/197 (32%), Gaps = 32/197 (16%)

Query: 39  PTIATNRYVPIRHDFNGPYAGLSALYNG--SFGEEAHHNAGGSIFAGYNVEDSCIMYGVE 96
           P       V   +++ G Y G+          G+           AGYN +   +++GVE
Sbjct: 27  PYTKAPVAVASVYNWTGFYLGIVGGGAWENGSGDPKMKGGFVGGTAGYNWQTGNVVFGVE 86

Query: 97  GDVRYTVPVLA--------------DNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDV 142
            D  +     +                + S     G++R R GY V++ +L Y T G   
Sbjct: 87  ADGTWADVSASATGATVVPGFGVATATVSSKTDAMGTVRGRIGYAVNN-VLFYGTGGYAW 145

Query: 143 AQKYET----GKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGF----- 193
                T    G +   +    G T G GVE    +     + EY          F     
Sbjct: 146 IDNKITLSALGVSVSDSKFHSGWTVGAGVE-AFFAPQWSVKGEYLYRSLGGETYFSGALP 204

Query: 194 -----YNTISLGVGMKF 205
                ++T+ +GV   F
Sbjct: 205 TGTLNFHTVQVGVNYHF 221


>gi|146341076|ref|YP_001206124.1| putative outer-membrane protein [Bradyrhizobium sp. ORS278]
 gi|146193882|emb|CAL77899.1| putative outer-membrane protein precursor [Bradyrhizobium sp.
           ORS278]
          Length = 237

 Score = 81.0 bits (198), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 39/242 (16%), Positives = 72/242 (29%), Gaps = 50/242 (20%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+KL L   +++  +       AAD   R +      +        +   +D++G Y G 
Sbjct: 1   MKKLLL---MTTALVVLASPTLAADLAARPYTKAPAPM--------MAAIYDWSGFYIGA 49

Query: 61  SALYNGSF-----------GEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLAD- 108
           +     S            G             GY  +   +++GVE    +      + 
Sbjct: 50  NGGGGWSHNTWDLVGGGREGSHDSSGGTIGGQFGYRWQMGPVVFGVEAQGNWADFTGDNV 109

Query: 109 ------NIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKA-------GEIT 155
                    +     G    + GY  ++ +LLYA  G  V     T             T
Sbjct: 110 SALFATRNRTKTDAFGLFTGQVGYAFNN-VLLYAKGGAAVTSNKYTITNAVTGAFLASNT 168

Query: 156 PIAIGGTAGVGVEVGGLSESLVARLEYRASKY------------SKVEGFYNTISLGVGM 203
               GG  G G+E G  + +    +EY                   ++   +  +  +  
Sbjct: 169 DSRWGGVVGAGLEYGF-APNWSVGVEYDHLFMDRQTVSFGALGSDSIKQDVDLFTARLNY 227

Query: 204 KF 205
           +F
Sbjct: 228 RF 229


>gi|332288152|ref|YP_004419004.1| outer membrane protein A [Gallibacterium anatis UMN179]
 gi|330431048|gb|AEC16107.1| outer membrane protein A [Gallibacterium anatis UMN179]
          Length = 361

 Score = 81.0 bits (198), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 46/222 (20%), Positives = 80/222 (36%), Gaps = 23/222 (10%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K  +A+ +S LA  S   AQAA      + G +    +   +            Y+ L
Sbjct: 1   MKKTAIALAISGLAFVSV--AQAAPQANTFYAGAKAGWASFHNDVKQLDNIYGQDAYSSL 58

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGG-S 119
                        ++    +F GY + D+  +               DN+   H   G +
Sbjct: 59  EQDEKFG---VHRNSVTYGVFGGYQITDNFAVEAGYDFYGQLKAHQGDNVRFRHTAHGLN 115

Query: 120 LRIRGGYEVS--DSLLLYATVGPDVAQKYETGKAG-----EITPIAIGGTAGVGVEVGGL 172
           L ++  Y V+  D L +Y  +G  + +                 + +      GVE   +
Sbjct: 116 LSLKASYPVAYVDGLDVYGRLGAALIRSDYAVHTNGEKTLSEHKLKVSPVFAAGVEY-AI 174

Query: 173 SESLVARLEYRAS-KYSKVEGFYN--------TISLGVGMKF 205
              L ARLEY+   K  KV+ F +        ++SLG+  +F
Sbjct: 175 LPELAARLEYQWIAKVGKVDQFEDISYSPSIGSVSLGLSYRF 216


>gi|307552789|gb|ADN45564.1| outer membrane protein A [Escherichia coli ABU 83972]
          Length = 350

 Score = 81.0 bits (198), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 38/219 (17%), Positives = 70/219 (31%), Gaps = 38/219 (17%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K  +A+ V+         AQAA                     Y   +  ++  +   
Sbjct: 1   MKKTAIAIAVALA--GFATVAQAA---------------PKDNTWYTGAKLGWSQYHDT- 42

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGG-- 118
              +  + G    +  G   F GY V       G E    +   +     +         
Sbjct: 43  --GFIPNNGPTHENQLGAGAFGGYQV---NPYVGFEMGYDWLGRMPYKGDNINGAYKAQG 97

Query: 119 -SLRIRGGYEVSDSLLLYATVGPDVAQKYET-----GKAGEITPIAIGGTAGVGVEVGGL 172
             L  + GY ++D L +Y  +G  V +         G + +     +      GVE   +
Sbjct: 98  VQLTAKLGYPITDDLDIYTRLGGMVWRADTKANVPGGASFKDHDTGVSPVFAGGVEY-AI 156

Query: 173 SESLVARLEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
           +  +  RLEY+ +        +    +   +SLGV  +F
Sbjct: 157 TPEIATRLEYQWTNNIGDAHTIGTRPDNGMLSLGVSYRF 195


>gi|206577508|ref|YP_002239403.1| outer membrane protein A [Klebsiella pneumoniae 342]
 gi|288936252|ref|YP_003440311.1| OmpA domain protein transmembrane region-containing protein
           [Klebsiella variicola At-22]
 gi|290510692|ref|ZP_06550062.1| OOP family OmpA-OmpF porin [Klebsiella sp. 1_1_55]
 gi|206566566|gb|ACI08342.1| outer membrane protein A [Klebsiella pneumoniae 342]
 gi|288890961|gb|ADC59279.1| OmpA domain protein transmembrane region-containing protein
           [Klebsiella variicola At-22]
 gi|289777408|gb|EFD85406.1| OOP family OmpA-OmpF porin [Klebsiella sp. 1_1_55]
          Length = 350

 Score = 81.0 bits (198), Expect = 9e-14,   Method: Composition-based stats.
 Identities = 36/213 (16%), Positives = 63/213 (29%), Gaps = 26/213 (12%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAG- 59
           M+K  +A+ V+         AQAA                     Y   +  ++  +   
Sbjct: 1   MKKTAIAIAVALA--GFATVAQAA---------------PKDNTWYAGGKLGWSQFHDTG 43

Query: 60  LSALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGS 119
                  + G       G   F GY V            +            +    G  
Sbjct: 44  WYNSSLNNNGPTHESQLGAGAFGGYQVNPYLGFEMGYDWLGRMPYKGDQVNGAFKAQGVQ 103

Query: 120 LRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEIT-PIAIGGTAGVGVEVGGLSESLVA 178
           L  + GY ++D L +Y  +G  V +   +           +      GVE   ++  +  
Sbjct: 104 LTAKLGYPITDDLDIYTRLGGMVWRADSSNSIAGDNHDTGVSPVFAGGVE-WAVTRDIAT 162

Query: 179 RLEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
           RLEY+          V    +   +S+GV  +F
Sbjct: 163 RLEYQWVNNIGDAGTVGVRPDNGMLSVGVSYRF 195


>gi|316936292|ref|YP_004111274.1| hypothetical protein Rpdx1_5001 [Rhodopseudomonas palustris DX-1]
 gi|315604006|gb|ADU46541.1| hypothetical protein Rpdx1_5001 [Rhodopseudomonas palustris DX-1]
          Length = 561

 Score = 81.0 bits (198), Expect = 9e-14,   Method: Composition-based stats.
 Identities = 43/241 (17%), Positives = 71/241 (29%), Gaps = 53/241 (21%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+++ +     +  +     A AAD                      P++ ++ G Y G+
Sbjct: 1   MRRILVTAAALATVI---SPAAAADMPGFPPLMPA-----------APVQWNWTGLYWGV 46

Query: 61  SA-------------LYNGSFGEEAHHNAGGSIFAGYNVEDS-CIMYGVEGDVRYTVPVL 106
                                G      A   I  GYN + +   + GVE D+       
Sbjct: 47  HVGGSFGSSSFSDPAGPGLYGGNVRSPAALAGIQVGYNYQPNANWLIGVEADLSSMNAKG 106

Query: 107 AD------------NIHSLHGIGGSLRIRGGYEVSD--SLLLYATVGPDVAQKYET---- 148
            D            N         +L  R G         LLYA  G     +       
Sbjct: 107 TDTCMASSGLFISSNCRVRQDALATLTGRAGLVTGPGGRTLLYAKGGAAFLSERLDITTG 166

Query: 149 ---GKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVE-GFYNTISL--GVG 202
              G + +      G T G G+E   L+ +   +LEY  + +   +    ++  L  GVG
Sbjct: 167 NPLGNSTDTNDGRWGWTVGAGIE-RALAPAWSVKLEYGYADFGSRDMATPSSFRLVPGVG 225

Query: 203 M 203
            
Sbjct: 226 Y 226


>gi|319403667|emb|CBI77252.1| Hemin binding protein d [Bartonella rochalimae ATCC BAA-1498]
          Length = 295

 Score = 81.0 bits (198), Expect = 9e-14,   Method: Composition-based stats.
 Identities = 52/306 (16%), Positives = 83/306 (27%), Gaps = 112/306 (36%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M  +   +  S +AL +  + QAAD       G   VV              + G Y G 
Sbjct: 1   MNNMKCLITTSVVALITASAVQAADIRVPQEIGETIVVAPA---------FSWTGFYLGA 51

Query: 61  SALYNGSFGEEAH--------------------HNAGGSIFAGYNVEDSC-IMYGVEGDV 99
                 S    +                         G  +AG NV+    ++ GV+ DV
Sbjct: 52  QIGGFSSKTSFSGPADDDSKKWLPLDKKLSPKPSGFIGGFYAGSNVDLGNGLILGVDTDV 111

Query: 100 RYTVPVLADNIHS----------------------------------------------L 113
            ++      N                                                  
Sbjct: 112 VFSGQKDTKNDKVTSELDKDNNNNNAPAGAKDKDNGKPEPEKEPEKEKDVKFTQYDHTLK 171

Query: 114 HGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYET------------------------- 148
               G+ RIR G+  +D ++ Y   G    Q  +T                         
Sbjct: 172 AKWAGATRIRIGFA-ADRIMPYVAGGVAYTQLQDTFTTLTGIKKVPAQKAEGTDKETSGK 230

Query: 149 GKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSK---------VEGFYNTISL 199
               + +   IG T   GV+   ++++++ R EYR S + K         V    N   +
Sbjct: 231 SNTVDESKTMIGYTLAAGVDF-AMTDNVLLRAEYRYSDFGKKKLHNDKFEVNYKANDFRV 289

Query: 200 GVGMKF 205
           GV  KF
Sbjct: 290 GVAYKF 295


>gi|27379826|ref|NP_771355.1| outer-membrane immunogenic protein [Bradyrhizobium japonicum USDA
           110]
 gi|27352979|dbj|BAC49980.1| blr4715 [Bradyrhizobium japonicum USDA 110]
          Length = 283

 Score = 81.0 bits (198), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 43/261 (16%), Positives = 75/261 (28%), Gaps = 73/261 (27%)

Query: 1   MQKLFLAVGVSSLALASF-CSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAG 59
           M+     V    +A+ +   +A AAD         + + P             +NG Y G
Sbjct: 1   MKNFEKLVLAGVVAVGAAWGTAHAADLAPTYKMPVKAIAPVQ----------TWNGFYVG 50

Query: 60  LSALYNGSFGEE------------------------------AHHNAGGSIFAGYNVED- 88
            +  Y+ S G                                +     G + AGYN +  
Sbjct: 51  GNVGYDWSTGSTGISVLSTDPALAAPLAALVAAGSFPTALSPSAKGVIGGVQAGYNWQVA 110

Query: 89  SCIMYGVEGDVRYTVPVL--------------ADNIHSLHGIGGSLRIRGGYEVSDSLLL 134
              + G+E D +                    +  +       G++R R G  V+   LL
Sbjct: 111 PQWLVGLEADFQGADVKGTTTQALAPVGFDATSTTVSKGIDWFGTVRGRVGVLVAPQWLL 170

Query: 135 YATVGPDVAQKYETGKA----------------GEITPIAIGGTAGVGVEVGGLSESLVA 178
           Y T G    +   +                   G  +  + G TAG G EV   + +   
Sbjct: 171 YGTGGFAYGRTKSSFSTTDVTGGCIVGATICASGASSGTSTGWTAGAGTEV-MFAPNWSF 229

Query: 179 RLEYRASKYSKVEGFYNTISL 199
           + EY      +      + ++
Sbjct: 230 KAEYLYVDLGRRTLNVASSTV 250


>gi|254717240|ref|ZP_05179051.1| 22 kDa outer membrane protein precursor [Brucella ceti M13/05/1]
 gi|261219057|ref|ZP_05933338.1| conserved hypothetical protein [Brucella ceti M13/05/1]
 gi|260924146|gb|EEX90714.1| conserved hypothetical protein [Brucella ceti M13/05/1]
          Length = 221

 Score = 81.0 bits (198), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 44/219 (20%), Positives = 77/219 (35%), Gaps = 26/219 (11%)

Query: 2   QKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLS 61
           ++   A  + +  +A   SA AAD +    +           +      HD++G Y G  
Sbjct: 13  KRSITAAALGAAVMAFAGSAFAADMMGGTDYT--------YNDPVAAGPHDWSGNYVGAR 64

Query: 62  ALYNGSFGEE---AHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVP--VLADNIHSLHGI 116
              + S       +   A G I  G N+++  I++G E +  +      +          
Sbjct: 65  VGGSSSKFPSPFASRTGALGGIVVGKNMQNGNIVFGAELEGNFAEAEHRIGHGGTLQQSW 124

Query: 117 GGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESL 176
            G+ + + GY   D  L+Y T G  V +               G   G GVE   LS  L
Sbjct: 125 NGNAKGKVGYAF-DKTLVYGTAGYGVTRFKAKDNTTSAPGWEGGVLIGAGVEQ-ALSGPL 182

Query: 177 VARLEYRASKYSKVEG-----------FYNTISLGVGMK 204
             + EY   +++ V+              ++I  G+  K
Sbjct: 183 SVKAEYDFQRFNDVKSQVNGIEQRNNLKNHSIKAGLNYK 221


>gi|299773247|gb|ADJ38698.1| outer membrane protein P5 [Haemophilus parasuis]
          Length = 369

 Score = 81.0 bits (198), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 43/232 (18%), Positives = 82/232 (35%), Gaps = 35/232 (15%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATN-RYVPIRHDFNGPYAG 59
           M+K  +A+ VS LA+AS   A AA      + G +    T   +   +  +++ +  YA 
Sbjct: 1   MKKSLIALAVSGLAVASV--ANAAPQANSFYVGAKAGWATFHNDINQLNSKYENDARYAT 58

Query: 60  LSALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGS 119
            +  Y         ++    +F GY + D+  +               +     H   G+
Sbjct: 59  SANGYG-----INRNSVTYGVFGGYQIIDNLAVELGYDYFGRVRGKEQEFRAFKHSAHGT 113

Query: 120 -LRIRGGYEVSDSLLLYATVGPDVAQKYE-----TGKAGEITPIAIGGTAGVGVEVGGLS 173
            L ++  YEV + L +Y  VG  + +        T +  +   +      G GVE   + 
Sbjct: 114 HLSLKPSYEVLNGLDVYGKVGAALVRNDYKRYFQTREPVKSHNLKTSLIVGAGVEY-AIL 172

Query: 174 ESLVARLEYRASK-----------------YSKVEG---FYNTISLGVGMKF 205
             L  R+EY+                    +          +++S G+  +F
Sbjct: 173 PELAFRVEYQWLSRVGNANKAAQKRGDTAMFGPGSTYSPDAHSVSAGISYRF 224


>gi|83308665|emb|CAJ01573.1| outer membrane protein [uncultured bacterium]
          Length = 275

 Score = 81.0 bits (198), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 35/183 (19%), Positives = 55/183 (30%), Gaps = 43/183 (23%)

Query: 50  RHDFNGPYAGLSALYNGSFGEEAH------------------HNAGGSIFAGYNVEDSCI 91
              ++G Y G+   Y                               G    GYN++ +  
Sbjct: 50  IFTWSGLYLGVQVGYAWGSDPVDEVDVLTPRFANNAFFNLQPKGVLGGAHVGYNLQFTNW 109

Query: 92  --------MYGVEGDVRYTVPVLADNIHSLH------GIGGSLRIRGGYEVSDSLLLYAT 137
                   + G+EG V  +         S           GSLR R G    D LL+Y T
Sbjct: 110 NWLSSSGVVIGLEGSVDGSSLSGTRTSASGLTMRLRTETQGSLRARIGLAW-DRLLIYGT 168

Query: 138 VGPDVAQKYETGK---------AGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYS 188
            G   A   +              + +    G T G GV+   ++ +    +EYR S + 
Sbjct: 169 GGAAFAGFDDNYVTVFGTPFFVDEQDSKTRTGWTVGGGVDY-AITPNWSIGVEYRYSDFG 227

Query: 189 KVE 191
           +  
Sbjct: 228 RTT 230


>gi|192291549|ref|YP_001992154.1| hypothetical protein Rpal_3175 [Rhodopseudomonas palustris TIE-1]
 gi|192285298|gb|ACF01679.1| conserved hypothetical protein [Rhodopseudomonas palustris TIE-1]
          Length = 566

 Score = 81.0 bits (198), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 42/232 (18%), Positives = 65/232 (28%), Gaps = 55/232 (23%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+     + VS++   S  +A+AAD  R                       ++ G Y G 
Sbjct: 1   MRTSI--ICVSAVLAVSCGAAEAADLSRAPATKAIT-------------AWNWTGFYLGG 45

Query: 61  SALYNGSFGEEAHHN-------------AGGSIFAGYNVEDSC--IMYGVEGDVRYTVPV 105
                    +  +               A   + AGYN +      + GVE D       
Sbjct: 46  HLGAGFGTAKVDNPFGPSIYGDTVRAPKALAGLQAGYNWQAHGSPWVLGVEVDASAIDAD 105

Query: 106 LAD------------NIHSLHGIGGSLRIRGGYEVSD--SLLLYATVGPDV--------- 142
             +            N      + G+L  R G+        L+Y   G            
Sbjct: 106 GTNTCLAYSGQFVSANCRVREHVVGTLTGRLGHAFGPDGRSLMYVKGGGAFLFGNFRMTT 165

Query: 143 -AQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGF 193
            A  Y    + E+     G T G G+E   LS     R EY  + +      
Sbjct: 166 NAPDYLNQPSAELDTTRWGWTVGAGIE-HALSSRWAVRAEYDYANFGHRGID 216


>gi|129136|sp|P09146|OMPA_ENTAE RecName: Full=Outer membrane protein A; Flags: Precursor
 gi|40838|emb|CAA25062.1| unnamed protein product [Enterobacter aerogenes]
          Length = 350

 Score = 81.0 bits (198), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 37/216 (17%), Positives = 65/216 (30%), Gaps = 32/216 (14%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAG- 59
           M+K  +A+ V+         AQAA                     Y   +  ++  +   
Sbjct: 1   MKKTAIAIAVALA--GFATVAQAA---------------PKDNTWYAGGKLGWSQFHDTG 43

Query: 60  LSALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGG- 118
                  + G       G   F GY V       G E    +   +    +         
Sbjct: 44  WYNSNLNNNGPTHESQLGAGAFGGYQV---NPYLGFEMGYDWLGRMPYKGVKVNGAFSSQ 100

Query: 119 --SLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEIT-PIAIGGTAGVGVEVGGLSES 175
              L  + GY ++D L +Y  +G  V +   +           +      GVE   ++  
Sbjct: 101 AVQLTAKLGYPITDDLDIYTRLGGMVWRADSSNSIAGDNHDTGVSPVFAGGVE-WAMTRD 159

Query: 176 LVARLEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
           +  RLEY+          V    +   +S+GV  +F
Sbjct: 160 IATRLEYQWVNNIGDAGTVGVRPDNGMLSVGVSYRF 195


>gi|217979266|ref|YP_002363413.1| OmpA domain protein transmembrane region-containing protein
           [Methylocella silvestris BL2]
 gi|217504642|gb|ACK52051.1| OmpA domain protein transmembrane region-containing protein
           [Methylocella silvestris BL2]
          Length = 240

 Score = 80.6 bits (197), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 43/225 (19%), Positives = 61/225 (27%), Gaps = 47/225 (20%)

Query: 25  DPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSFGEEAHHN--------- 75
                A           A     P    + G Y G    Y                    
Sbjct: 5   PLSALAGLLALAGPSLAAEPPPSPPPLTWAGFYLGGQVGYGWGSDSGNVTGGFPLSPTIQ 64

Query: 76  ----------AGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIG-------- 117
                     A G    G N +    + G+EGDV  T           +           
Sbjct: 65  TASTSTQTQGAIGGAHIGNNWQIQNFVIGLEGDVNGTTLSKMSTPLFNNLYFPYTQSPVQ 124

Query: 118 GSLRIRGGYEVSDSLLLYATVGPDVA----QKYETGKAGEITPIAIGGTAGVGVEVGGLS 173
           G++R R GY + D  LLYAT G             G     +    G T G GVE   ++
Sbjct: 125 GTVRGRLGYAL-DRTLLYATGGLAYGWIHNDYNIFGSRSSFSTTKAGWTIGGGVEF-AVN 182

Query: 174 ESLVARLEYRASKYS--------------KVEGFYNTISLGVGMK 204
           ++   R EYR +++                     N + +G   K
Sbjct: 183 DNWSVRAEYRYTRFGYFSDGPIAYPTVSQSHSSTQNQLQVGFSYK 227


>gi|299773283|gb|ADJ38716.1| outer membrane protein P5 [Haemophilus parasuis]
          Length = 367

 Score = 80.6 bits (197), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 43/230 (18%), Positives = 84/230 (36%), Gaps = 33/230 (14%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATN-RYVPIRHDFNGPYAG 59
           M+K  +A+ VS +A+AS   AQAA      + G +    T   +   +  ++  +  Y  
Sbjct: 1   MKKSLIALAVSGIAVASV--AQAAPQANTFYVGAKAGWATFHNDINQIDSKYANDARYDA 58

Query: 60  LSALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGS 119
            +  Y       + ++    +F GY + D+  +               +     H   G+
Sbjct: 59  TNLKYG-----ISRNSVTYGVFGGYQIIDNLAVELGYDYFGRVRGNKQEFRAFKHSAHGT 113

Query: 120 -LRIRGGYEVSDSLLLYATVGPDVAQKYET-------GKAGEITPIAIGGTAGVGVEVGG 171
            L ++  YEV + L +Y  VGP + +               +   +      G GVE   
Sbjct: 114 HLSLKPSYEVLNGLDVYGKVGPALVRNDYKRSTQTGGAPPQKAHNLQTSLVLGAGVEY-A 172

Query: 172 LSESLVARLEYRAS----KYSKVEG------------FYNTISLGVGMKF 205
           +   L  R+EY+       ++K E               ++++ G+  +F
Sbjct: 173 ILPELALRVEYQWLSNVGNFTKAEAKENRRATYNYSPDSHSVTAGISYRF 222


>gi|209968914|gb|ACJ02818.1| outer membrane protein P5 [Haemophilus parasuis]
          Length = 365

 Score = 80.6 bits (197), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 44/228 (19%), Positives = 83/228 (36%), Gaps = 31/228 (13%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATN-RYVPIRHDFNGPYAG 59
           M+K  +A+ VS LA+AS   A AA      + G +    T   +   +  ++  +  YA 
Sbjct: 1   MKKSLIALAVSGLAVASV--ANAAPQANSFYVGAKAGWATFHNDINQLNSKYKNDARYAT 58

Query: 60  LSALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGS 119
            +  Y         ++    +F GY + D+  +               +     H   G+
Sbjct: 59  SANRYG-----INRNSVTYGVFGGYQIIDNLAVELGYDYFGRVRGNKQEFREFKHSAHGT 113

Query: 120 -LRIRGGYEVSDSLLLYATVGPDVAQKYE-----TGKAGEITPIAIGGTAGVGVEVGGLS 173
            L ++  YEV   L +Y  VG  + +        T +  +   +      G GVE   + 
Sbjct: 114 HLSLKPSYEVLSGLDVYGKVGAALVRNDYKRYFQTREPVKSHNLKTSLIVGAGVEY-AIL 172

Query: 174 ESLVARLEYRAS----KYSKVEG------------FYNTISLGVGMKF 205
             L  R+EY+       ++K E               ++++ G+  +F
Sbjct: 173 PELAFRVEYQWLSNVGNFTKAEVKENRRATYNYSPDSHSVTAGISYRF 220


>gi|39935901|ref|NP_948177.1| hypothetical protein RPA2834 [Rhodopseudomonas palustris CGA009]
 gi|39649755|emb|CAE28276.1| conserved hypothetical protein [Rhodopseudomonas palustris CGA009]
          Length = 566

 Score = 80.6 bits (197), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 42/232 (18%), Positives = 65/232 (28%), Gaps = 55/232 (23%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+     + VS++   S  +A+AAD  R                       ++ G Y G 
Sbjct: 1   MRTSI--ICVSAVLAVSCGAAEAADLSRAPATKAIT-------------AWNWTGFYLGG 45

Query: 61  SALYNGSFGEEAHHN-------------AGGSIFAGYNVEDSC--IMYGVEGDVRYTVPV 105
                    +  +               A   + AGYN +      + GVE D       
Sbjct: 46  HLGAGFGTAKVDNPFGPSIYGDTVRAPKALAGLQAGYNWQAHGSPWVLGVEVDASAIDAD 105

Query: 106 LAD------------NIHSLHGIGGSLRIRGGYEVSD--SLLLYATVGPDV--------- 142
             +            N      + G+L  R G+        L+Y   G            
Sbjct: 106 GTNTCLAYSGQFVSANCRVREHVVGTLTGRLGHAFGPDGRSLMYVKGGGAFLFGNFRMTT 165

Query: 143 -AQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGF 193
            A  Y    + E+     G T G G+E   LS     R EY  + +      
Sbjct: 166 NAPDYLNQPSAELDTTRWGWTVGAGIE-HALSSRWAVRAEYDYANFGHRGID 216


>gi|320577122|gb|ADW54070.1| outer membrane protein A [Sodalis glossinidius]
          Length = 358

 Score = 80.6 bits (197), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 36/222 (16%), Positives = 64/222 (28%), Gaps = 35/222 (15%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K   A+ ++         AQAA                     Y   +  ++  +   
Sbjct: 1   MKKT--AIALAVALAGFATVAQAA---------------PKDDTWYTGGKLGWSQYHDTG 43

Query: 61  SALYNGSF----GEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGI 116
                       G       G   F GY              +       + N  +    
Sbjct: 44  FYGNGFDNRIANGPTRDDQLGAGAFLGYQANPYLGFELGYDWLGRMAYKGSVNNGAFKAQ 103

Query: 117 GGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGE-------ITPIAIGGTAGVGVEV 169
           G SL  +  Y ++D L +Y  +G  V +    G                +   A VG+E 
Sbjct: 104 GISLAAKLSYPLTDDLDIYTRLGGMVWRADSKGAYDNGNAGRVSDHDTGVSPLAAVGLEY 163

Query: 170 GGLSESLVARLEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
              +++   RL+Y+          V    +   +S+GV  +F
Sbjct: 164 -AWTKNWATRLDYQWVNNIGDAGTVGTRPDNSMLSVGVSYRF 204


>gi|85059008|ref|YP_454710.1| outer membrane protein A [Sodalis glossinidius str. 'morsitans']
 gi|84779528|dbj|BAE74305.1| outer membrane protein A precursor [Sodalis glossinidius str.
           'morsitans']
          Length = 356

 Score = 80.6 bits (197), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 36/222 (16%), Positives = 64/222 (28%), Gaps = 35/222 (15%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K   A+ ++         AQAA                     Y   +  ++  +   
Sbjct: 1   MKKT--AIALAVALAGFATVAQAA---------------PKDDTWYTGGKLGWSQYHDTG 43

Query: 61  SALYNGSF----GEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGI 116
                       G       G   F GY              +       + N  +    
Sbjct: 44  FYGNGFDNRIANGPTRDDQLGAGAFLGYQANPYLGFELGYDWLGRMAYKGSVNNGAFKAQ 103

Query: 117 GGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGE-------ITPIAIGGTAGVGVEV 169
           G SL  +  Y ++D L +Y  +G  V +    G                +   A VG+E 
Sbjct: 104 GISLAAKLSYPLTDDLDIYTRLGGMVWRADSKGAYDNGNAGRVSDHDTGVSPLAAVGLEY 163

Query: 170 GGLSESLVARLEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
              +++   RL+Y+          V    +   +S+GV  +F
Sbjct: 164 -AWTKNWATRLDYQWVNNIGDAGTVGTRPDNSMLSVGVSYRF 204


>gi|209968924|gb|ACJ02823.1| outer membrane protein P5 [Haemophilus parasuis]
          Length = 367

 Score = 80.6 bits (197), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 43/229 (18%), Positives = 79/229 (34%), Gaps = 32/229 (13%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATN-RYVPIRHDFNGPYAG 59
           M+K  +A+ VS LA+AS   A AA      + G +    T   +   +  ++  +  YA 
Sbjct: 1   MKKSLIALAVSGLAVASV--ANAAPQADSFYVGAKAGWATFHNDINQLNFKYKNDARYAT 58

Query: 60  LSALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGS 119
            +  Y         ++    +F GY + D+  +               +     H   G+
Sbjct: 59  SANGYG-----INRNSVTYGVFGGYQIIDNLAVELGYDYFGRVRGNKQEFREFKHSAHGT 113

Query: 120 -LRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEI--TPIAIGGTAGVGVEVGGLSESL 176
            L ++  YEV + L +Y  VG  + +        E     +      G GVE   +   L
Sbjct: 114 HLSLKPSYEVLNGLDVYGKVGAALVRNDYKFYDTEDKAHNLKTSLLLGAGVEY-AILPEL 172

Query: 177 VARLEYRASK-----------------YSKVEG---FYNTISLGVGMKF 205
             R+EY+                    +          +++S G+  +F
Sbjct: 173 AFRVEYQWLSRVGNANKAAQKRGDTAMFGPGSTYSPDAHSVSAGISYRF 221


>gi|27379978|ref|NP_771507.1| outer-membrane immunogenic protein [Bradyrhizobium japonicum USDA
           110]
 gi|27353131|dbj|BAC50132.1| bll4867 [Bradyrhizobium japonicum USDA 110]
          Length = 258

 Score = 80.6 bits (197), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 42/210 (20%), Positives = 71/210 (33%), Gaps = 18/210 (8%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIA--TNRYVPIRHDFNGPYA 58
           M+K  L   VS +AL++   A AAD   R +     +V  I   +  Y+ I       ++
Sbjct: 19  MKKNLLLAAVSLVALSAAAPAVAADLAARPYTKAPAMVAAIYDWSGFYIGINGGGGSAHS 78

Query: 59  GLSALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLAD-------NIH 111
               +  G  G             GY  +    ++GVEG   +      +          
Sbjct: 79  TWDLVGGGREGSHDATGGTVGGQIGYRWQSGQWVFGVEGQGNWADFSGDNVSALFATRNR 138

Query: 112 SLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKA-------GEITPIAIGGTAG 164
           S     G +  + GY  ++ +L+Y   G  VA       +               GGT G
Sbjct: 139 SKIDSFGLITGQVGYAWNN-VLIYVKGGAAVAGTKYEVFSTASGALLSSNDQTRWGGTVG 197

Query: 165 VGVEVGGLSESLVARLEYRASKYSKVEGFY 194
            G+E G  + +    +EY        +  +
Sbjct: 198 AGLEYGF-APNWSVGVEYNHIFLQDKDVTF 226


>gi|293396726|ref|ZP_06641002.1| outer membrane protein A [Serratia odorifera DSM 4582]
 gi|291420990|gb|EFE94243.1| outer membrane protein A [Serratia odorifera DSM 4582]
          Length = 364

 Score = 80.6 bits (197), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 37/221 (16%), Positives = 64/221 (28%), Gaps = 34/221 (15%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K   A+ ++         AQAA                     Y   +  ++  +   
Sbjct: 7   MKKT--AIALAVALAGFATVAQAA---------------PKDNTWYTGAKLGWSQYHDVG 49

Query: 61  SALYNG----SFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGI 116
                       G       G   F GY              +       + N  +    
Sbjct: 50  FYGNGYEKGIGNGPTHESQLGAGAFLGYQANQYLGFELGYDWLGRMPYKGSVNNGAFKAQ 109

Query: 117 GGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGE------ITPIAIGGTAGVGVEVG 170
           G  L  +  Y ++D L +Y  +G  + +       G            +   A VGVE  
Sbjct: 110 GVQLAAKLSYPIADDLDIYTRLGGMIWRADSKANYGRTGERLSNHDTGVSPLAAVGVEY- 168

Query: 171 GLSESLVARLEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
            L+++   RL+Y+          V    +   +SLGV  +F
Sbjct: 169 ALTKNWATRLDYQFVSNIGDAGTVGARPDNTMLSLGVSYRF 209


>gi|312270745|gb|ADQ55773.1| OmpA [Haemophilus parasuis]
          Length = 367

 Score = 80.6 bits (197), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 42/230 (18%), Positives = 83/230 (36%), Gaps = 33/230 (14%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATN-RYVPIRHDFNGPYAG 59
           M+K  +A+ VS LA+AS   AQAA      + G +    T   +   +  ++  +  Y  
Sbjct: 1   MKKSLIALAVSGLAVASV--AQAAPQANTFYVGAKAGWATFHNDINQIDSKYANDARYDA 58

Query: 60  LSALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGS 119
            +  Y       + ++    +F GY + D+  +               +     H   G+
Sbjct: 59  TNLKYG-----ISRNSVTYGVFGGYQIIDNLAVELGYDYFGRVRGNKQEFRAFKHSAHGT 113

Query: 120 -LRIRGGYEVSDSLLLYATVGPDVAQKYETGK-------AGEITPIAIGGTAGVGVEVGG 171
            L ++  YEV + L +Y  VG  + +               +   +      G GVE   
Sbjct: 114 HLSLKPSYEVLNGLDVYGKVGAALVRNDYKRYSQTAGVQTQKAHNLKTSLVLGAGVEY-A 172

Query: 172 LSESLVARLEYRAS----KYSKVEG------------FYNTISLGVGMKF 205
           +   L  R+EY+       ++K +               ++++ G+  +F
Sbjct: 173 ILPELAFRVEYQWLSNVGNFTKAKAKENRRATYNYSPDSHSVTAGISYRF 222


>gi|90418791|ref|ZP_01226702.1| hypothetical protein SI859A1_00696 [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90336871|gb|EAS50576.1| hypothetical protein SI859A1_00696 [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 263

 Score = 80.6 bits (197), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 40/235 (17%), Positives = 69/235 (29%), Gaps = 55/235 (23%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M++L L +  ++        A AAD +           P       V     + G Y G 
Sbjct: 1   MKRLALLLATTAF----VTPALAADVIYEEPPA-----PAPMAIEPVATTATWTGLYIGG 51

Query: 61  SALYNGS---------------------FGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDV 99
            A                            ++ +    G    GY+ + +  + G   D+
Sbjct: 52  QAGVAFGNESDGATFNPGGGGPFGTGTYSEDDDNAGFIGGGHIGYDYQINDFVVGAVADI 111

Query: 100 RYTVPVLADNIHSL----------HGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYET- 148
            Y       +  +               G++R R GY + DS+LLY T G   A      
Sbjct: 112 NYIDAETNRSYTTGGGSTFSTSSDINYLGTVRARVGYAM-DSVLLYGTGGLAYAGVDNNA 170

Query: 149 ------------GKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVE 191
                           +     IG   G GV+V   + ++   +EY  +     +
Sbjct: 171 SAPASSGTFTNYTFEQDENDTDIGYAVGGGVDVMA-TNNISFGVEYLYTNLGSND 224


>gi|146340933|ref|YP_001205981.1| putative outer-membrane protein [Bradyrhizobium sp. ORS278]
 gi|146193739|emb|CAL77756.1| putative outer-membrane protein; putative secreted protein
           [Bradyrhizobium sp. ORS278]
          Length = 251

 Score = 80.2 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 43/228 (18%), Positives = 69/228 (30%), Gaps = 28/228 (12%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIA---------TNRYVPIRH 51
           M++L L    S         A AAD   R      G++ TI                 R 
Sbjct: 1   MRRLLLGATTSLAL--GLAPAIAADLPARTFTKAPGMIATIYDWSGFYLGLNAGGGSART 58

Query: 52  DFNGPYAGLSALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLAD--- 108
            +             + G      A      GY  +    ++GVEG   +     ++   
Sbjct: 59  CWTNNVTVGGVAATNAEGCHDATGALAGGQIGYRWQAGSWVFGVEGQGNWANLKGSNTSQ 118

Query: 109 -----NIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETG-------KAGEITP 156
                   +     G L  + GY  ++ +L Y   G  VA +   G          + + 
Sbjct: 119 LAPAVTNQTKVNGVGLLTGQIGYAWNN-VLWYVKGGAAVAGEKYNGLATATGTAFDQASA 177

Query: 157 IAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFYNTISLGVGMK 204
              G T G GVEVG  +++     EY           ++ I  G   +
Sbjct: 178 TRWGATVGTGVEVGF-AKNWSVGAEYEHIFMGNKNLNFSGIPAGAATR 224


>gi|152969543|ref|YP_001334652.1| outer membrane protein A [Klebsiella pneumoniae subsp. pneumoniae
           MGH 78578]
 gi|238894012|ref|YP_002918746.1| outer membrane protein A [Klebsiella pneumoniae NTUH-K2044]
 gi|7442975|pir||JC6558 outer membrane protein A precursor - Klebsiella pneumoniae
 gi|150954392|gb|ABR76422.1| outer membrane protein 3a (II*;G;d) [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
 gi|238546328|dbj|BAH62679.1| outer membrane protein A [Klebsiella pneumoniae subsp. pneumoniae
           NTUH-K2044]
          Length = 356

 Score = 80.2 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 38/219 (17%), Positives = 66/219 (30%), Gaps = 32/219 (14%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K  +A+ V+         AQAA                     Y   +  ++  +   
Sbjct: 1   MKKTAIAIAVALA--GFATVAQAA---------------PKDNTWYAGGKLGWSQYHDTG 43

Query: 61  SALYNG--SFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGG 118
                   + G   +   G   F GY V            +       + +  +    G 
Sbjct: 44  FYGNGFQNNNGPTRNDQLGAGAFGGYQVNPYLGFEMGYDWLGRMAYKGSVDNGAFKAQGV 103

Query: 119 SLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAG------EITPIAIGGTAGVGVEVGGL 172
            L  + GY ++D L +Y  +G  V +    G               +      GVE   +
Sbjct: 104 QLTAKLGYPITDDLDIYTRLGGMVWRADSKGNYASTGVSRSEHDTGVSPVFAGGVE-WAV 162

Query: 173 SESLVARLEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
           +  +  RLEY+          V    +   +SLGV  +F
Sbjct: 163 TRDIATRLEYQWVNNIGDAGTVGTRPDNGMLSLGVSYRF 201


>gi|298292293|ref|YP_003694232.1| porin [Starkeya novella DSM 506]
 gi|296928804|gb|ADH89613.1| porin [Starkeya novella DSM 506]
          Length = 257

 Score = 80.2 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 43/233 (18%), Positives = 66/233 (28%), Gaps = 67/233 (28%)

Query: 38  VPTIATNRYVPIRHDFNGPYAGLSALYNGS----------------------FGEEAHHN 75
            P  A    V     + G Y G +A Y                          G      
Sbjct: 27  YPVKAPPMMVVPAFTWTGLYLGGNAGYGWGEGSAPWLGYLDYYYGALDQYGYSGGSDPQG 86

Query: 76  AGGSIFAGYNVEDSC-IMYGVEGDVRYTVPVLA-----------------DNIHSLHGIG 117
             G +  GYN +    ++ G+E D ++     +                   I +     
Sbjct: 87  WFGGVQVGYNYQFDNNVVLGIEADAQFGELKDSLSYYGTDLFSGVPDLDLGGIETKIEAF 146

Query: 118 GSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEI---------------TPIAIGGT 162
           G++R R GY V D LL Y T G        + +                        G T
Sbjct: 147 GTVRARLGYAV-DRLLPYVTGGLAWGNVKMSERWDTYMGGVFQPGLTGTASADETLWGWT 205

Query: 163 AGVGVEVGGLSESLVARLEYRASKYSK----------VEGFYNTISLGVGMKF 205
            G GVE    +++   + EY  +              V+    T+ LG+  KF
Sbjct: 206 VGGGVEY-AFTDNWTVKAEYLYADLGDINWDGDAGTKVDVKLQTVKLGINYKF 257


>gi|49473904|ref|YP_031946.1| hemin binding protein a [Bartonella quintana str. Toulouse]
 gi|8575707|gb|AAF78059.1|AF266281_1 hemin-binding surface protein A precursor [Bartonella quintana]
 gi|21689904|gb|AAM68129.1| hemin-binding protein A [Bartonella quintana]
 gi|49239407|emb|CAF25745.1| Hemin binding protein a [Bartonella quintana str. Toulouse]
          Length = 272

 Score = 80.2 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 51/278 (18%), Positives = 82/278 (29%), Gaps = 90/278 (32%)

Query: 7   AVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNG 66
            +  S +AL S  +AQAAD +           P             + G Y G       
Sbjct: 6   LITTSVIALVSASAAQAADVIATHEAAPVITTP----------NFSWTGFYIGGQIGNFT 55

Query: 67  SFGEEAH----------------HNAGGSIFAGYNVEDSC-IMYGVEGDVRYTV------ 103
           S  +                       G I+AG N++    ++ GVE D  +        
Sbjct: 56  SDNKIKGLGKETSIFTKELTPQLSGIVGGIYAGSNIDLGSGLILGVETDAIWADCEATKT 115

Query: 104 --------------------------------PVLADNIHSLHGIGGSLRIRGGYEVSDS 131
                                             ++D+        G+ R R G+   D 
Sbjct: 116 SAIRTLSVPQANSLNDEFKAAGITLKDKFSENDTMSDHYTYKAKWSGATRARIGFSAFDR 175

Query: 132 LLLYATVGPDVAQK---------------YETGKAGEITPIAIGGTAGVGVEVGGLSESL 176
           ++ Y   G   A+                   G   + T + +G T   GV+V  ++ ++
Sbjct: 176 VMPYFAGGVAYARMQGMKSVSGMNAAKNKKLGGGLYDETKMMVGFTVSGGVDV-AMTGNV 234

Query: 177 VARLEYRASKYSKVEGFYNT---------ISLGVGMKF 205
           + R EYR S + K +   NT            GV  KF
Sbjct: 235 LLRGEYRYSDFGKKKFLNNTQEFNYKTNDFRFGVAYKF 272


>gi|209968918|gb|ACJ02820.1| outer membrane protein P5 [Haemophilus parasuis]
 gi|209968922|gb|ACJ02822.1| outer membrane protein P5 [Haemophilus parasuis]
 gi|224714277|gb|ACN62133.1| outer membrane protein A [Haemophilus parasuis]
 gi|224714281|gb|ACN62135.1| outer membrane protein A [Haemophilus parasuis]
          Length = 367

 Score = 80.2 bits (196), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 43/229 (18%), Positives = 80/229 (34%), Gaps = 32/229 (13%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATN-RYVPIRHDFNGPYAG 59
           M+K  +A+ VS LA+AS   A AA      + G +    T   +   +  +++ +  YA 
Sbjct: 1   MKKSLIALAVSGLAVASV--ANAAPQANSFYVGAKAGWATFHNDINQLNSKYENDARYAT 58

Query: 60  LSALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGS 119
            +  Y         ++    +F GY + D+  +               +     H   G+
Sbjct: 59  SANGYG-----INRNSVTYGVFGGYQIIDNLAVELGYDYFGRVRGKEQEFRAFKHSAHGT 113

Query: 120 -LRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEI--TPIAIGGTAGVGVEVGGLSESL 176
            L ++  YEV + L +Y  VG  + +        E     +      G GVE   +   L
Sbjct: 114 HLSLKPSYEVLNGLDVYGKVGAALVRNDYKFYDTEDKAHNLKTSLLLGAGVEY-AILPEL 172

Query: 177 VARLEYRASK-----------------YSKVEG---FYNTISLGVGMKF 205
             R+EY+                    +          +++S G+  +F
Sbjct: 173 AFRVEYQWLSRVGNANKAAQKRGDTAMFGPGSTYSPDAHSVSAGISYRF 221


>gi|299773235|gb|ADJ38692.1| outer membrane protein P5 [Haemophilus parasuis]
          Length = 365

 Score = 80.2 bits (196), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 43/228 (18%), Positives = 84/228 (36%), Gaps = 31/228 (13%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATN-RYVPIRHDFNGPYAG 59
           M+K  +A+ V  LA+AS   A AA      + G +    T   +   +  +++ +  YA 
Sbjct: 1   MKKSLIALKVQGLAVASV--ANAAPQANSFYVGAKAGWATFHNDINQLNSKYENDARYAT 58

Query: 60  LSALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGS 119
            +  Y         ++    +F GY + D+  +               +     H   G+
Sbjct: 59  SANGYG-----INRNSVTYGVFGGYQIIDNLAVELGYDYFGRVRGNKQEFRAFKHSAHGT 113

Query: 120 -LRIRGGYEVSDSLLLYATVGPDVAQKYE-----TGKAGEITPIAIGGTAGVGVEVGGLS 173
            L ++  YEV + L +Y  VG  + +        T +  +   +      G GVE   + 
Sbjct: 114 HLSLKPSYEVLNGLDVYGKVGAALVRNDYKRYFQTREPVKSHNLKTSLIVGAGVEY-AIL 172

Query: 174 ESLVARLEYRAS----KYSKVEG------------FYNTISLGVGMKF 205
             L  R+EY+       ++K E               ++++ G+  +F
Sbjct: 173 PELAFRVEYQWLSNVGNFTKAEVKENRRATYNYSPDSHSVTAGISYRF 220


>gi|209968934|gb|ACJ02828.1| outer membrane protein P5 [Haemophilus parasuis]
 gi|222831779|gb|ACJ23249.2| OmpA [Haemophilus parasuis]
 gi|224714293|gb|ACN62141.1| outer membrane protein A [Haemophilus parasuis]
 gi|224714317|gb|ACN62153.1| outer membrane protein A [Haemophilus parasuis]
 gi|224714319|gb|ACN62154.1| outer membrane protein A [Haemophilus parasuis]
 gi|224714321|gb|ACN62155.1| outer membrane protein A [Haemophilus parasuis]
 gi|224714335|gb|ACN62162.1| outer membrane protein A [Haemophilus parasuis]
 gi|299773259|gb|ADJ38704.1| outer membrane protein P5 [Haemophilus parasuis]
 gi|299773265|gb|ADJ38707.1| outer membrane protein P5 [Haemophilus parasuis]
 gi|299773271|gb|ADJ38710.1| outer membrane protein P5 [Haemophilus parasuis]
 gi|299773273|gb|ADJ38711.1| outer membrane protein P5 [Haemophilus parasuis]
 gi|299773275|gb|ADJ38712.1| outer membrane protein P5 [Haemophilus parasuis]
 gi|299773279|gb|ADJ38714.1| outer membrane protein P5 [Haemophilus parasuis]
 gi|299773287|gb|ADJ38718.1| outer membrane protein P5 [Haemophilus parasuis]
 gi|312270747|gb|ADQ55774.1| OmpA [Haemophilus parasuis]
 gi|312270749|gb|ADQ55775.1| OmpA [Haemophilus parasuis]
 gi|312270753|gb|ADQ55777.1| OmpA [Haemophilus parasuis]
 gi|312270755|gb|ADQ55778.1| OmpA [Haemophilus parasuis]
 gi|312270757|gb|ADQ55779.1| OmpA [Haemophilus parasuis]
 gi|312270759|gb|ADQ55780.1| OmpA [Haemophilus parasuis]
 gi|312270761|gb|ADQ55781.1| OmpA [Haemophilus parasuis]
 gi|312270763|gb|ADQ55782.1| OmpA [Haemophilus parasuis]
 gi|312270765|gb|ADQ55783.1| OmpA [Haemophilus parasuis]
 gi|312270767|gb|ADQ55784.1| OmpA [Haemophilus parasuis]
 gi|312270769|gb|ADQ55785.1| OmpA [Haemophilus parasuis]
 gi|312270771|gb|ADQ55786.1| OmpA [Haemophilus parasuis]
          Length = 367

 Score = 80.2 bits (196), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 43/230 (18%), Positives = 83/230 (36%), Gaps = 33/230 (14%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATN-RYVPIRHDFNGPYAG 59
           M+K  +A+ VS LA+AS   AQAA      + G +    T   +   +  ++  +  Y  
Sbjct: 1   MKKSLIALAVSGLAVASV--AQAAPQANTFYVGAKAGWATFHNDINQIDSKYANDARYDA 58

Query: 60  LSALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGS 119
            +  Y       + ++    +F GY + D+  +               +     H   G+
Sbjct: 59  TNLKYG-----ISRNSVTYGVFGGYQIIDNLAVELGYDYFGRVRGNKQEFRAFKHSAHGT 113

Query: 120 -LRIRGGYEVSDSLLLYATVGPDVAQKYETGK-------AGEITPIAIGGTAGVGVEVGG 171
            L ++  YEV + L +Y  VG  + +               +   +      G GVE   
Sbjct: 114 HLSLKPSYEVLNGLDVYGKVGAALVRNDYKRYSQTAGVQTQKAHNLKTSLVLGAGVEY-A 172

Query: 172 LSESLVARLEYRAS----KYSKVEG------------FYNTISLGVGMKF 205
           +   L  R+EY+       ++K E               ++++ G+  +F
Sbjct: 173 ILPELAFRVEYQWLSNVGNFTKAEAKENRRATYNYSPDSHSVTAGISYRF 222


>gi|209968908|gb|ACJ02815.1| outer membrane protein P5 [Haemophilus parasuis]
 gi|224714283|gb|ACN62136.1| outer membrane protein A [Haemophilus parasuis]
          Length = 369

 Score = 80.2 bits (196), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 43/232 (18%), Positives = 82/232 (35%), Gaps = 35/232 (15%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATN-RYVPIRHDFNGPYAG 59
           M+K  +A+ VS LA+AS   A AA      + G +    T   +   +  +++ +  YA 
Sbjct: 1   MKKSLIALAVSGLAVASV--ANAAPQANSFYVGAKAGWATFHNDINQLNSKYENDARYAT 58

Query: 60  LSALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGS 119
            +  Y         ++    +F GY + D+  +               +     H   G+
Sbjct: 59  SANGYG-----INRNSVTYGVFGGYQIIDNLAVELGYDYFGRVRGKEQEFRAFKHSAHGT 113

Query: 120 -LRIRGGYEVSDSLLLYATVGPDVAQKYE-----TGKAGEITPIAIGGTAGVGVEVGGLS 173
            L ++  YEV + L +Y  VG  + +        T +  +   +      G GVE   + 
Sbjct: 114 HLSLKPSYEVLNGLDVYGKVGAALVRNDYKRYFQTREPVKSHNLKTSLIVGAGVEY-AIL 172

Query: 174 ESLVARLEYRASK-----------------YSKVEG---FYNTISLGVGMKF 205
             L  R+EY+                    +          +++S G+  +F
Sbjct: 173 PELAFRVEYQWLSRVGNANKAAQKRGDTAMFGPGSTYSPDAHSVSAGISYRF 224


>gi|148255736|ref|YP_001240321.1| putative outer-membrane protein [Bradyrhizobium sp. BTAi1]
 gi|146407909|gb|ABQ36415.1| putative outer-membrane protein [Bradyrhizobium sp. BTAi1]
          Length = 248

 Score = 80.2 bits (196), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 32/183 (17%), Positives = 58/183 (31%), Gaps = 32/183 (17%)

Query: 52  DFNGPYAGLSALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVL----- 106
           D     A     + G+   + +    G +  GYN +   I++G+EGD  +          
Sbjct: 61  DETFFNAPNGFGFAGTQRYDINGGFAGGV-IGYNWQVDNIVFGLEGDYHWADINGRSGVI 119

Query: 107 ----ADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQ----KYETGKAGEITPIA 158
                D+  +     G ++ R G+      L + + G  V            +       
Sbjct: 120 TAGLGDSYFTKLRGFGDIKGRLGWAAGP-ALFFVSGGAAVGDLQHRYDNPAFSTIQNDWR 178

Query: 159 IGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFY----------------NTISLGVG 202
            G T G G E    + +  A++EY    + K    Y                +T+  G+ 
Sbjct: 179 WGWTIGAGAEY-MFAPNWSAKVEYNYLDFGKSTLQYNNPLVASNRSEWSDTVHTVKAGIS 237

Query: 203 MKF 205
             F
Sbjct: 238 YHF 240


>gi|224714275|gb|ACN62132.1| outer membrane protein A [Haemophilus parasuis]
          Length = 367

 Score = 80.2 bits (196), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 43/230 (18%), Positives = 82/230 (35%), Gaps = 33/230 (14%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATN-RYVPIRHDFNGPYAG 59
           M+K  +A+ VS LA+AS   AQAA      + G +    T   +   +  ++  +  Y  
Sbjct: 1   MKKSLIALAVSGLAVASV--AQAAPQANTFYVGAKAGWATFHNDINQIDSKYANDARYDA 58

Query: 60  LSALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGS 119
            +  Y       + ++    +F GY + D+  +                     H   G+
Sbjct: 59  TNLKYG-----ISRNSVTYGVFGGYQIIDNLAVELGYDYFGRVRGNKQKFRAFKHSAHGT 113

Query: 120 -LRIRGGYEVSDSLLLYATVGPDVAQKYETGK-------AGEITPIAIGGTAGVGVEVGG 171
            L ++  YEV + L +Y  VG  + +               +   +      G GVE   
Sbjct: 114 HLSLKPSYEVLNGLDVYGKVGAALVRNDYKRYSQTAGVQTQKAHNLKTSLVLGAGVEY-A 172

Query: 172 LSESLVARLEYRAS----KYSKVEG------------FYNTISLGVGMKF 205
           +   L  R+EY+       ++K E               ++++ G+  +F
Sbjct: 173 ILPELAFRVEYQWLSNVGNFTKAEAKENRRATYNYSPDSHSVTAGISYRF 222


>gi|299773255|gb|ADJ38702.1| outer membrane protein P5 [Haemophilus parasuis]
          Length = 367

 Score = 80.2 bits (196), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 44/230 (19%), Positives = 83/230 (36%), Gaps = 33/230 (14%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATN-RYVPIRHDFNGPYAG 59
           M+K  +A+ VS LA+AS   AQAA      + G +    T   +   +  ++  +  YA 
Sbjct: 1   MKKSLIALAVSGLAVASV--AQAAPQANTFYVGAKAGWATFHNDINQLNSKYKNDARYAT 58

Query: 60  LSALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGS 119
            +  Y         ++    +F GY + D+  +               +     H   G+
Sbjct: 59  SANGYV-----INRNSVTYGVFGGYQIIDNLAVELGYDYFGRVRGNKQEFRAFKHSAHGT 113

Query: 120 -LRIRGGYEVSDSLLLYATVGPDVAQKYETGK-------AGEITPIAIGGTAGVGVEVGG 171
            L ++  YEV + L +Y  VG  + +               +   +      G GVE   
Sbjct: 114 HLSLKPSYEVLNGLDVYGKVGAALVRNDYKRYSQTAGVQTQKAHNLKTSLVLGAGVEY-A 172

Query: 172 LSESLVARLEYRAS----KYSKVEG------------FYNTISLGVGMKF 205
           +   L  R+EY+       ++K E               ++++ G+  +F
Sbjct: 173 ILPELAFRVEYQWLSNVGNFTKAEAKENRRATYNYSPDSHSVTAGISYRF 222


>gi|167856409|ref|ZP_02479133.1| outer membrane protein P5 precursor [Haemophilus parasuis 29755]
 gi|167852469|gb|EDS23759.1| outer membrane protein P5 precursor [Haemophilus parasuis 29755]
 gi|209968896|gb|ACJ02809.1| outer membrane protein P5 [Haemophilus parasuis]
 gi|209968900|gb|ACJ02811.1| outer membrane protein P5 [Haemophilus parasuis]
 gi|209968904|gb|ACJ02813.1| outer membrane protein P5 [Haemophilus parasuis]
 gi|209968916|gb|ACJ02819.1| outer membrane protein P5 [Haemophilus parasuis]
 gi|209968932|gb|ACJ02827.1| outer membrane protein P5 [Haemophilus parasuis]
 gi|209968960|gb|ACJ02841.1| outer membrane protein P5 [Haemophilus parasuis]
 gi|209968964|gb|ACJ02843.1| outer membrane protein P5 [Haemophilus parasuis]
 gi|222831781|gb|ACJ23250.2| OmpA [Haemophilus parasuis]
 gi|224714297|gb|ACN62143.1| outer membrane protein A [Haemophilus parasuis]
 gi|224714299|gb|ACN62144.1| outer membrane protein A [Haemophilus parasuis]
 gi|224714301|gb|ACN62145.1| outer membrane protein A [Haemophilus parasuis]
 gi|224714309|gb|ACN62149.1| outer membrane protein A [Haemophilus parasuis]
 gi|224714313|gb|ACN62151.1| outer membrane protein A [Haemophilus parasuis]
 gi|224714315|gb|ACN62152.1| outer membrane protein A [Haemophilus parasuis]
 gi|224714323|gb|ACN62156.1| outer membrane protein A [Haemophilus parasuis]
 gi|224714325|gb|ACN62157.1| outer membrane protein A [Haemophilus parasuis]
 gi|224714327|gb|ACN62158.1| outer membrane protein A [Haemophilus parasuis]
 gi|224714329|gb|ACN62159.1| outer membrane protein A [Haemophilus parasuis]
 gi|224714331|gb|ACN62160.1| outer membrane protein A [Haemophilus parasuis]
 gi|224714333|gb|ACN62161.1| outer membrane protein A [Haemophilus parasuis]
 gi|299773239|gb|ADJ38694.1| outer membrane protein P5 [Haemophilus parasuis]
 gi|299773269|gb|ADJ38709.1| outer membrane protein P5 [Haemophilus parasuis]
 gi|312270735|gb|ADQ55768.1| OmpA [Haemophilus parasuis]
 gi|312270737|gb|ADQ55769.1| OmpA [Haemophilus parasuis]
 gi|312270739|gb|ADQ55770.1| OmpA [Haemophilus parasuis]
          Length = 367

 Score = 79.8 bits (195), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 44/230 (19%), Positives = 83/230 (36%), Gaps = 33/230 (14%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATN-RYVPIRHDFNGPYAG 59
           M+K  +A+ VS LA+AS   AQAA      + G +    T   +   +  ++  +  YA 
Sbjct: 1   MKKSLIALAVSGLAVASV--AQAAPQANTFYVGAKAGWATFHNDINQLNSKYKNDARYAT 58

Query: 60  LSALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGS 119
            +  Y         ++    +F GY + D+  +               +     H   G+
Sbjct: 59  SANGYV-----INRNSVTYGVFGGYQIIDNLAVELGYDYFGRVRGNKQEFRAFKHSAHGT 113

Query: 120 -LRIRGGYEVSDSLLLYATVGPDVAQKYETGK-------AGEITPIAIGGTAGVGVEVGG 171
            L ++  YEV + L +Y  VG  + +               +   +      G GVE   
Sbjct: 114 HLSLKPSYEVLNGLDVYGKVGAALVRNDYKRYSQTAGVQTQKAHNLKTSLVLGAGVEY-A 172

Query: 172 LSESLVARLEYRAS----KYSKVEG------------FYNTISLGVGMKF 205
           +   L  R+EY+       ++K E               ++++ G+  +F
Sbjct: 173 ILPELAFRVEYQWLSNVGNFTKAEAKENRRATYNYSPDSHSVTAGISYRF 222


>gi|7188820|gb|AAF37888.1|AF234270_1 outer membrane protein A [Salmonella enterica subsp. enterica
           serovar Typhimurium]
          Length = 249

 Score = 79.8 bits (195), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 35/216 (16%), Positives = 70/216 (32%), Gaps = 32/216 (14%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K  +A+ V+         AQAA                     Y   +  ++  +   
Sbjct: 1   MKKTAIAIAVALA--GFATVAQAA---------------PKDNTWYAGAKLGWSQYHDT- 42

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGSL 120
              +  + G    +  G   F GY V            +        +   +    G  L
Sbjct: 43  --GFIHNDGPTHENQLGAGAFGGYQVNPYVGFEMGYDWLGRMPYKGDNINGAYKAQGVQL 100

Query: 121 RIRGGYEVSDSLLLYATVGPDVAQKYET-----GKAGEITPIAIGGTAGVGVEVGGLSES 175
             + GY ++D L +Y  +G  V +         G + +     +      G+E   ++  
Sbjct: 101 TAKLGYPITDDLDVYTRLGGMVWRADTKSNVPGGPSTKDHDTGVSPVFAGGIEY-AITPE 159

Query: 176 LVARLEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
           +  RLEY+ +      + +    +   +S+GV  +F
Sbjct: 160 IATRLEYQWTNNIGDANTIGTRPDNGLLSVGVSYRF 195


>gi|299773281|gb|ADJ38715.1| outer membrane protein P5 [Haemophilus parasuis]
          Length = 367

 Score = 79.8 bits (195), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 43/230 (18%), Positives = 83/230 (36%), Gaps = 33/230 (14%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATN-RYVPIRHDFNGPYAG 59
           M+K  +A+ VS LA+AS   AQAA      + G +    T   +   +  ++  +  Y  
Sbjct: 1   MKKSLIALAVSGLAVASV--AQAAPQANTFYVGAKAGWATFHNDINQIDSKYANDARYDA 58

Query: 60  LSALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGS 119
            +  Y       + ++    +F GY + D+  +               +     H   G+
Sbjct: 59  TNLKYG-----ISRNSVTYGVFGGYQIIDNLAVELGYDYFGRVRGNKQEFRAFKHSAHGT 113

Query: 120 -LRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEI-------TPIAIGGTAGVGVEVGG 171
            L ++  YEV + L +Y  VG  + +      +            +      G GVE   
Sbjct: 114 HLSLKPSYEVLNGLDVYGKVGAALVRNDYKRYSQTGGVQTQKAHNLKTSLVLGAGVEY-A 172

Query: 172 LSESLVARLEYRAS----KYSKVEG------------FYNTISLGVGMKF 205
           +   L  R+EY+       ++K E               ++++ G+  +F
Sbjct: 173 ILPELAFRVEYQWLSNVGNFTKAEAKENRRATYNYSPDSHSVTAGISYRF 222


>gi|154246283|ref|YP_001417241.1| porin [Xanthobacter autotrophicus Py2]
 gi|154160368|gb|ABS67584.1| porin [Xanthobacter autotrophicus Py2]
          Length = 236

 Score = 79.8 bits (195), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 39/197 (19%), Positives = 63/197 (31%), Gaps = 30/197 (15%)

Query: 37  VVPTIATNRYVPIRHDFNGPYAGLSALYNGSFGEE-------AHHNAGGSIFAGYNVED- 88
                           + G Y G +A Y    G++             G   AGYN +  
Sbjct: 42  PTQPAIPAAVPAPVFSWTGFYIGGNAGYGWGSGQDELGVAGVDPKGWFGGGQAGYNYQFS 101

Query: 89  SCIMYGVEGDVRYTVPVLADN-----------IHSLHGIGGSLRIRGGYEVSDSLLLYAT 137
           + I+ G+E D++      + +           + S     G++R R GY     +L Y T
Sbjct: 102 NNIVAGIEADIQGGDIGASASGPLGGQLGVLGLSSTLDSFGTVRGRLGYAFGP-ILPYVT 160

Query: 138 VGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKV------- 190
            G               +    G TAG G+E   L++   A+ EY  +            
Sbjct: 161 GGFAWGNNSIDYLGASQSQTHTGWTAGAGIEY-ALTDHWTAKTEYLYTDLGSKFYDTLGA 219

Query: 191 --EGFYNTISLGVGMKF 205
                  T  +G+  KF
Sbjct: 220 SAGVTAQTARIGINYKF 236


>gi|254706545|ref|ZP_05168373.1| 22 kDa outer membrane protein precursor [Brucella pinnipedialis
           M163/99/10]
 gi|256031839|ref|ZP_05445453.1| 22 kDa outer membrane protein precursor [Brucella pinnipedialis
           M292/94/1]
 gi|256160030|ref|ZP_05457728.1| 22 kDa outer membrane protein precursor [Brucella ceti M490/95/1]
 gi|261314005|ref|ZP_05953202.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10]
 gi|265988937|ref|ZP_06101494.1| outer membrane protein 22 [Brucella pinnipedialis M292/94/1]
 gi|265998403|ref|ZP_06110960.1| Omp22 [Brucella ceti M490/95/1]
 gi|261303031|gb|EEY06528.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10]
 gi|262553010|gb|EEZ08861.1| Omp22 [Brucella ceti M490/95/1]
 gi|264661134|gb|EEZ31395.1| outer membrane protein 22 [Brucella pinnipedialis M292/94/1]
          Length = 211

 Score = 79.8 bits (195), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 44/219 (20%), Positives = 77/219 (35%), Gaps = 26/219 (11%)

Query: 2   QKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLS 61
           ++   A  + +  +A   SA AAD +    +           +      HD++G Y G  
Sbjct: 3   KRSITAAALGAAVMAFAGSAFAADMMGGTDYT--------YNDPVAAGPHDWSGNYVGAR 54

Query: 62  ALYNGSFGEE---AHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVP--VLADNIHSLHGI 116
              + S       +   A G I  G N+++  I++G E +  +      +          
Sbjct: 55  VGGSSSKFPSPFASRTGALGGIVVGKNMQNGNIVFGAELEGNFAEAEHRIGHGGTLQQSW 114

Query: 117 GGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESL 176
            G+ + + GY   D  L+Y T G  V +               G   G GVE   LS  L
Sbjct: 115 NGNAKGKVGYAF-DKTLVYGTAGYGVTRFKAKDNTTSAPGWEGGVLIGAGVEQ-ALSGPL 172

Query: 177 VARLEYRASKYSKVEG-----------FYNTISLGVGMK 204
             + EY   +++ V+              ++I  G+  K
Sbjct: 173 SVKAEYDFQRFNDVKSQVNGIEQRNNLKNHSIKAGLNYK 211


>gi|299773289|gb|ADJ38719.1| outer membrane protein P5 [Haemophilus parasuis]
          Length = 367

 Score = 79.8 bits (195), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 44/230 (19%), Positives = 83/230 (36%), Gaps = 33/230 (14%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATN-RYVPIRHDFNGPYAG 59
           M+K  +A+ VS LA+AS   AQAA      + G +    T   +   +  ++  +  YA 
Sbjct: 1   MKKSLIALAVSGLAVASV--AQAAPQANTFYVGAKAGWATFHNDINQLNSKYKNDARYAT 58

Query: 60  LSALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGS 119
            +  Y         ++    +F GY + D+  +               +     H   G+
Sbjct: 59  SANGYV-----INRNSVTYGVFGGYQIIDNLAVELGYDYFGRVRGNKQEFRAFKHSAHGT 113

Query: 120 -LRIRGGYEVSDSLLLYATVGPDVAQKYETGK-------AGEITPIAIGGTAGVGVEVGG 171
            L ++  YEV + L +Y  VG  + +               +   +      G GVE   
Sbjct: 114 HLSLKPSYEVLNGLDVYGKVGAALVRNDYKRYSQTAGVQTQKAHNLKTSLVLGAGVEY-A 172

Query: 172 LSESLVARLEYRAS----KYSKVEG------------FYNTISLGVGMKF 205
           +   L  R+EY+       ++K E               ++++ G+  +F
Sbjct: 173 ILPELAFRVEYQWLSNVGNFTKAEAKENRRAAYNYSQDSHSVTAGISYRF 222


>gi|319408048|emb|CBI81702.1| Hemin binding protein C [Bartonella schoenbuchensis R1]
          Length = 296

 Score = 79.8 bits (195), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 47/298 (15%), Positives = 83/298 (27%), Gaps = 108/298 (36%)

Query: 8   VGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGS 67
           +  S  AL S  +AQAAD   +           +A          + G Y G       S
Sbjct: 7   ITASIFALVSASAAQAADMPVQERPTTVLPQVVVAPA------FSWTGFYLGGQIGGFSS 60

Query: 68  FGEEAH----------------------HNAGGSIFAGYNVEDSC-IMYGVEGDVRYTVP 104
                                           G ++AG NV+     + GV+ D+ ++  
Sbjct: 61  NSSSKGTYNNVPNGTKEILVDNKAFPKFSGFVGGLYAGSNVDFGNGFVLGVDTDIVWSGD 120

Query: 105 VLA------------------------------------------------DNIHSLHGI 116
             +                                                 ++      
Sbjct: 121 KASKSKSYEVAAKPDTPIGDFNPADGVSGGGYLGVATRAKDEGSQIAKPAKGDVTFSDKW 180

Query: 117 GGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGE--------------------ITP 156
            G+ R+R G    D ++ Y   G   +Q   + +  +                     + 
Sbjct: 181 SGATRVRLGAAF-DRVMPYVAGGVAYSQLKASVENAKASGAQKAEGTSVEKPLEGLSDSK 239

Query: 157 IAIGGTAGVGVEVGGLSESLVARLEYRASKYSK---------VEGFYNTISLGVGMKF 205
             +G T G GV+   ++++++ R EYR S + K         V+   N   +GV  KF
Sbjct: 240 TMVGYTLGAGVDF-AMTDTVMLRAEYRYSDFGKKKFVKDKVEVDLKTNDFRVGVAYKF 296


>gi|319899124|ref|YP_004159217.1| Hemin binding protein d [Bartonella clarridgeiae 73]
 gi|319403088|emb|CBI76643.1| Hemin binding protein d [Bartonella clarridgeiae 73]
          Length = 303

 Score = 79.8 bits (195), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 48/309 (15%), Positives = 85/309 (27%), Gaps = 110/309 (35%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRH-DFNGPYAG 59
           M++L      S  AL     AQAAD V          V +     +  I      G + G
Sbjct: 1   MKRL----TTSIFALLLVSEAQAADFVIPYQSSTIPTVISPPHFSWTGIYFGGHVGGFEG 56

Query: 60  LSALYNGSFGEE-----------AHHNAGGSIFAGYNVEDSC-IMYGVEGDVRYTVPVLA 107
            S  Y  + GE                  G ++AG + + +  ++ G + D+ ++     
Sbjct: 57  PSTSYMSTQGERQKLLFKNNPSPKFSGVIGGLYAGASFDVNNGLVLGFDTDINWSGAKDE 116

Query: 108 DNIHS---------------------------------------LHGIGGSLRIRGGYEV 128
            ++                                              G+ R+R G+  
Sbjct: 117 KSVDMDSFVMALRKMDNVSNKDNVSNKIFPGFSLEQFISLKQTLKQKWVGATRVRIGFGF 176

Query: 129 SDSLLLYATVGPDVAQKYE----------------------------------------- 147
            D ++ Y   G       +                                         
Sbjct: 177 -DRIMPYVAGGVAYTHLKDVYVMETVTQETLKTGIRQSSQSSQSSQSSQSSQSSQSSQSS 235

Query: 148 --TGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSK---------VEGFYNT 196
                        IG T G G++   ++++L+ R EYR S ++          ++   N 
Sbjct: 236 QLDFSMESEKKTMIGFTIGGGLD-LAVTDNLILRAEYRYSDFNNKEFTKERFTIKYKSNG 294

Query: 197 ISLGVGMKF 205
            S+GV  KF
Sbjct: 295 FSVGVAYKF 303


>gi|27382806|ref|NP_774335.1| outer-membrane immunogenic protein [Bradyrhizobium japonicum USDA
           110]
 gi|27355979|dbj|BAC52960.1| blr7695 [Bradyrhizobium japonicum USDA 110]
          Length = 288

 Score = 79.8 bits (195), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 42/226 (18%), Positives = 67/226 (29%), Gaps = 40/226 (17%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+KL +A     +A+     A AAD   R +      V        V   +D+ G Y G 
Sbjct: 36  MKKLLIA-AAGMMAVGLSAPASAADLAARPYTKAPPPV--------VAPIYDWTGFYIGA 86

Query: 61  SALYNGS--------------FGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVL 106
           +  +  S               G             GY  + S  ++G+E    +     
Sbjct: 87  NGGWGQSHSCVDFVTALGTVASGCGDRSGGVVGGQIGYRWQTSQFVFGLEAQGDWADLKN 146

Query: 107 AD--------NIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEI---- 154
                     +  +     G    + G+  + S LLY   G  V     T          
Sbjct: 147 TRVSLFNPTLSTTAKTDAIGLFTGQLGWAWN-SALLYVKGGAAVTSNRLTIFDNTTGIGL 205

Query: 155 ---TPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFYNTI 197
                   GGT GVG E G  + +    +EY           ++ +
Sbjct: 206 VSADNTRWGGTLGVGFEYGF-TPNWSVGVEYDHLWMGHANNSFSVV 250


>gi|27380404|ref|NP_771933.1| outer-membrane immunogenic protein [Bradyrhizobium japonicum USDA
           110]
 gi|27353568|dbj|BAC50558.1| bll5293 [Bradyrhizobium japonicum USDA 110]
          Length = 277

 Score = 79.8 bits (195), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 50/270 (18%), Positives = 76/270 (28%), Gaps = 66/270 (24%)

Query: 1   MQKLFLAVGVSSLALASFCSA-QAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAG 59
           M+K  LAV    L  AS  +A  AA   +                  V  +   + P   
Sbjct: 1   MKKFLLAVASVVLGTASVQAADLAAHYTKAPMMAPAYNWTGFYVGGNVGGQWGSSDPSTS 60

Query: 60  LSALYNGSFGEEA-------------HHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVL 106
                 G F   +               +  G   AGYN + +  + G+EGD+ Y     
Sbjct: 61  TVFSPTGYFAASSVPAINTVGAQGINSSSVTGGFTAGYNWQVNHAVLGLEGDINYFGFKG 120

Query: 107 ADN----------------IHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGK 150
           +                           ++R R G+  + + LLYAT G  +A+      
Sbjct: 121 SATGSALYPCCAPTGFTVSSSVSADWLATIRGRIGFLAAPTWLLYATGGAAIAEVKGNFN 180

Query: 151 AGEI----------TPIAIGGTAGVGVEVGGLSESLVARLEYRASKYS------------ 188
             +               +G TAGVG E          + EY                  
Sbjct: 181 FTDTFAGATESSAIRDTRLGWTAGVGTEY-AFGGGWSLKAEYLYVDLGRASATSTNLAAF 239

Query: 189 -------------KVEGFYNTISLGVGMKF 205
                         V+   N + +GV  KF
Sbjct: 240 VPAIAFPSNVYTHSVDLKSNIVRVGVNYKF 269


>gi|115524895|ref|YP_781806.1| putative outer membrane protein [Rhodopseudomonas palustris BisA53]
 gi|115518842|gb|ABJ06826.1| putative outer membrane protein [Rhodopseudomonas palustris BisA53]
          Length = 247

 Score = 79.8 bits (195), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 43/224 (19%), Positives = 72/224 (32%), Gaps = 42/224 (18%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+++ L   V  +AL     A AAD   R +     +         +   +D++G Y G 
Sbjct: 1   MKRILLG-SVGLIALGMAAPAFAADLPARTYTKAPPM---------IAAIYDWSGFYIGA 50

Query: 61  SALYN---------------GSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPV 105
           +  +                GS G      A      GY  +    ++G+E    +    
Sbjct: 51  NGGWGSSRSSWDYLGPGLAVGSEGSHDADGAVAGGQIGYRWQAGTWVFGLEAQGNWADLS 110

Query: 106 LAD--------NIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKA------ 151
            ++         I +     G    + GY  +++LL Y   G  V               
Sbjct: 111 GSNISSLFITDTIRTKVDAFGLFTGQFGYAWNNALL-YVKGGAGVVSSKYDAFTTATGAA 169

Query: 152 -GEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFY 194
            G       GGTAGVG+E G  + +    +EY           +
Sbjct: 170 LGSANSTRWGGTAGVGLEYGF-APNWSVAVEYDHVWLDTKSADF 212


>gi|319785546|ref|YP_004145022.1| outer membrane protein [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
 gi|317171434|gb|ADV14972.1| outer membrane protein [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
          Length = 205

 Score = 79.8 bits (195), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 42/216 (19%), Positives = 71/216 (32%), Gaps = 33/216 (15%)

Query: 6   LAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYN 65
           + +  S+LA+     A AAD                      P    ++G Y G+     
Sbjct: 7   IILTASALAMCLLGPAMAADLS---------------PAYNDPPAFQWSGAYVGVHGGTA 51

Query: 66  GSFGEE---AHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLAD--NIHSLHGIGGSL 120
            +         +   G   AGYN +    + G E +  Y      D           G+ 
Sbjct: 52  FTGMPNPFAGRNGLSGGFQAGYNQQMGPAVLGAEIEGSYLGGAEHDVRGGKIKEKWRGAA 111

Query: 121 RIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARL 180
           + + G    D  LL+ T G  + +  +  K   I    +G   G G+E G  +  L A++
Sbjct: 112 KAKAGLSF-DQTLLFGTGGVAMTKFDKGDKVNGIDGWKLGYLVGGGIEQGF-AGGLSAKV 169

Query: 181 EYRASKY-----------SKVEGFYNTISLGVGMKF 205
           EY   +            SK     + +  G+  +F
Sbjct: 170 EYDYVRTPGVETTSALGKSKATIGSHELKAGINYRF 205


>gi|312270751|gb|ADQ55776.1| OmpA [Haemophilus parasuis]
          Length = 367

 Score = 79.8 bits (195), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 43/230 (18%), Positives = 83/230 (36%), Gaps = 33/230 (14%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATN-RYVPIRHDFNGPYAG 59
           M+K  +A+ VS LA+AS   AQAA      + G +    T   +   +  ++  +  Y  
Sbjct: 1   MKKSLIALAVSGLAVASV--AQAAPQANTFYVGAKAGWATFHNDINQIDSKYAKDARYDA 58

Query: 60  LSALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGS 119
            +  Y       + ++    +F GY + D+  +               +     H   G+
Sbjct: 59  TNLKYG-----ISRNSVTYGVFGGYQIIDNLAVELGYDYFGRVRGNKQEFRAFKHSAHGT 113

Query: 120 -LRIRGGYEVSDSLLLYATVGPDVAQKYETGK-------AGEITPIAIGGTAGVGVEVGG 171
            L ++  YEV + L +Y  VG  + +               +   +      G GVE   
Sbjct: 114 HLSLKPSYEVLNGLDVYGKVGAALVRNDYKRYSQTAGVQTQKAHNLKTSLVLGAGVEY-A 172

Query: 172 LSESLVARLEYRAS----KYSKVEG------------FYNTISLGVGMKF 205
           +   L  R+EY+       ++K E               ++++ G+  +F
Sbjct: 173 ILPELAFRVEYQWLSNVGNFTKAEAKENRRATYNYSPDSHSVTAGISYRF 222


>gi|299132804|ref|ZP_07025999.1| Carbohydrate-selective porin OprB [Afipia sp. 1NLS2]
 gi|298592941|gb|EFI53141.1| Carbohydrate-selective porin OprB [Afipia sp. 1NLS2]
          Length = 694

 Score = 79.8 bits (195), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 45/205 (21%), Positives = 62/205 (30%), Gaps = 42/205 (20%)

Query: 40  TIATNRYVPIRHDFNGPYAGLSALYNGSFGEEA------------HHNAGGSIFAGYNVE 87
                       D++G Y G    Y       +               A   + AGYNV 
Sbjct: 69  AADFPVKAAPVFDWSGAYVGAHFAYGFGSSHASVFDGASFNTRNHFGTATAGVQAGYNVV 128

Query: 88  DSCIMY-GVEGDVRYTVPVLADN-----------IHSLHGIGGSLRIRGGYEVSDSLLLY 135
               +  GVE D+ +   + +             +       GSLR R GY  +   LLY
Sbjct: 129 LPSRVLLGVEADLSFPNYIESSGGVAVTPTMNGTLTERLDYAGSLRARLGYA-APRWLLY 187

Query: 136 ATVGPDVAQKYETGKAGEITPI----AIGGTAGVGVEVGGLSESLVARLEYRASKYSK-- 189
            T G   A +     +            G  AGVG E   +     AR+EY  S Y +  
Sbjct: 188 VTGGLAFAGERFEYTSPAFDDKKLSLRTGWIAGVGAEY-AIGPKWSARVEYLYSDYGRDH 246

Query: 190 ----------VEGFYNTISLGVGMK 204
                           TI LG+  K
Sbjct: 247 VQLGSGLQSASTFDVQTIRLGLNRK 271


>gi|89076013|ref|ZP_01162376.1| hypothetical outer membrane protein OmpA [Photobacterium sp. SKA34]
 gi|89048248|gb|EAR53829.1| hypothetical outer membrane protein OmpA [Photobacterium sp. SKA34]
          Length = 355

 Score = 79.4 bits (194), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 33/188 (17%), Positives = 60/188 (31%), Gaps = 14/188 (7%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M K   A+   +L ++   +A   +P       G        +  Y    +D        
Sbjct: 1   MSKARFAILPLALLISGAVNAATVNPFYAGVRAGGVHYSDFDSKNYANGTYDQE------ 54

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSL--HGIGG 118
                 +       +    +F GYNV     + G    +        ++ +         
Sbjct: 55  ----LQNRNAIDRDDFAAGLFMGYNVTPWFAIEGGYTWLGEATLKGDEHHNLGKVEQQAI 110

Query: 119 SLRIRGGYEVSDSLLLYATVGPDVAQKYETG-KAGEITPIAIGGTAGVGVEVGGLSESLV 177
            L  +  Y+ +D + LY  VG             G     ++  TAG+G E    +++L 
Sbjct: 111 DLVGKFTYQATDKVDLYTKVGGAWQFTRAKVEGVGSDRDDSLIATAGLGAEYHF-TDNLS 169

Query: 178 ARLEYRAS 185
           AR EY+  
Sbjct: 170 ARAEYQYY 177


>gi|312270715|gb|ADQ55758.1| OmpA [Haemophilus parasuis]
          Length = 365

 Score = 79.4 bits (194), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 44/228 (19%), Positives = 83/228 (36%), Gaps = 31/228 (13%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATN-RYVPIRHDFNGPYAG 59
           M+K  +A+ VS LA+AS   A AA      + G +    T   +   +  ++  +  YA 
Sbjct: 1   MKKSLIALAVSGLAVASV--ANAAPQANSFYVGAKAGWATFHNDINQLNSKYKNDARYAT 58

Query: 60  LSALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGS 119
            +  Y         ++    +F GY + D+  +               +     H   G+
Sbjct: 59  SANRYG-----INRNSVTYGVFGGYQIIDNLAVELGYDYFGRVRGNNQEFREFKHSAHGT 113

Query: 120 -LRIRGGYEVSDSLLLYATVGPDVAQKYE-----TGKAGEITPIAIGGTAGVGVEVGGLS 173
            L ++  YEV   L +Y  VG  + +        T +  +   +      G GVE   + 
Sbjct: 114 HLSLKPSYEVLSGLDVYGKVGAALVRNDYKRYFQTREPVKSHNLKTSLIVGAGVEY-AIL 172

Query: 174 ESLVARLEYRAS----KYSKVEG------------FYNTISLGVGMKF 205
             L  R+EY+       ++K E               ++++ G+  +F
Sbjct: 173 PELAFRVEYQWLSNVGNFTKAEMKENRRATYNYSPDSHSVTAGISYRF 220


>gi|182679250|ref|YP_001833396.1| porin [Beijerinckia indica subsp. indica ATCC 9039]
 gi|182635133|gb|ACB95907.1| porin [Beijerinckia indica subsp. indica ATCC 9039]
          Length = 250

 Score = 79.4 bits (194), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 45/211 (21%), Positives = 65/211 (30%), Gaps = 47/211 (22%)

Query: 40  TIATNRYVPIRHDFNGPYAGLSALYNGS----------------FGEEAHHNAGGSIFAG 83
                        + G Y G    Y                   FG  +     G    G
Sbjct: 29  APPVYVPPVPIFTWTGVYVGGDIGYAWGNTSYNSQIFSAPARFAFGSYSPDGVTGGAHVG 88

Query: 84  YNVE-------DSCIMYGVEGDVRYTVPVLA------DNIHSLHGIGGSLRIRGGYEVSD 130
           YN +           + G+EGDV+ +    +      D   S   I GS+R R G    D
Sbjct: 89  YNFQAGPSFIGTGNFVIGIEGDVQGSNYSKSVVGFANDIYTSKLDITGSIRGRLGIAF-D 147

Query: 131 SLLLYATVGPDVAQKYE-----TGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRAS 185
             L+YAT G              G        A+G T G G+E   ++ +   R +Y  S
Sbjct: 148 RALIYATGGAAFGGITNQLQLRNGAFFSNDRTAVGWTVGGGIEY-AVTNNWSVRAQYLYS 206

Query: 186 KYSKVEGFY-----------NTISLGVGMKF 205
            Y     F+           N +++G   KF
Sbjct: 207 DYGHTNSFFPNAQVHKHDTQNKVTVGFSYKF 237


>gi|242240116|ref|YP_002988297.1| outer membrane protein A [Dickeya dadantii Ech703]
 gi|242132173|gb|ACS86475.1| OmpA domain protein transmembrane region-containing protein
           [Dickeya dadantii Ech703]
          Length = 354

 Score = 79.4 bits (194), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 40/216 (18%), Positives = 74/216 (34%), Gaps = 34/216 (15%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K  +A+ V+  A      AQAA                     Y   +  ++  +   
Sbjct: 1   MKKTAIAIAVAGFA----TVAQAA---------------PNDNTWYAGGKLGWSQFHDTG 41

Query: 61  SALYNGSFGEEA-HHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLH--GIG 117
                     +A  +  G  +F GY    +    G E    +   +    ++  +    G
Sbjct: 42  LNGSGYQTTNDAQENQLGAGVFGGYQ---ANPYLGFEMGYDWLGRMKYTGVNRGNFKAQG 98

Query: 118 GSLRIRGGYEVSDSLLLYATVGPDVAQKY--ETGKAGEITPIAIGGTAGVGVEVGGLSES 175
             L  +  Y + D L +Y  +G  V +    +           +   A VGVE   ++++
Sbjct: 99  VQLAAKLSYPIVDDLDVYTRLGGFVWRADSHDDVSGNSGHDTGVSPLAAVGVEY-AITKN 157

Query: 176 LVARLEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
              RL+Y+        S V G  +   +S+GV  +F
Sbjct: 158 WATRLDYQWVNNIGDASTVGGRPDNGLLSVGVSYRF 193


>gi|163869043|ref|YP_001610277.1| hemin binding protein [Bartonella tribocorum CIP 105476]
 gi|161018724|emb|CAK02282.1| hemin binding protein [Bartonella tribocorum CIP 105476]
          Length = 296

 Score = 79.4 bits (194), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 44/299 (14%), Positives = 81/299 (27%), Gaps = 97/299 (32%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPV----RRAHHGGRGVVPTIATNRYVPIRHDFNGP 56
           M+   L V +S     +  +AQAAD V     +        + +  +   V     ++G 
Sbjct: 1   MKTKCLFV-LSLFTFMTTSTAQAADTVISQQSQPSVSAPSSLSSRLSPVTVSAPFSWSGF 59

Query: 57  YAGLSALYNGSFG--------------------EEAHHNAGGSIFAGYNVEDSC-IMYGV 95
           Y G    +  S                                 +AG N++    ++   
Sbjct: 60  YFGGQLGHLSSKSTLNYAPESQGGKWALVDRGLSPKPTGFVAGFYAGSNIDLGNSLVVSF 119

Query: 96  EGDVRYTVPVLADNIHSL------------------------------------------ 113
           + D+ ++        +                                            
Sbjct: 120 DTDMIWSGKKNTQTDNGKKILDKLDSVHAAFHDAGIPIITSEVQDETIPNYSDIIVSSVT 179

Query: 114 --HGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYE----------------TGKAGEIT 155
                 G+ R R G+  S  L+ Y   G    Q                   +G   + T
Sbjct: 180 LKEKWAGAARARIGFA-SHRLMPYIAGGVAYTQMQYILSLLTKSQEDSTVFASGDVFDKT 238

Query: 156 PIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFY---------NTISLGVGMKF 205
              IG T G G +   +++ ++ R EYR + + K +            +   LG+  KF
Sbjct: 239 KTMIGYTVGGGFD-LAMTDDIIMRTEYRYTDFFKQKFANDELKMSVQTHNFRLGIAYKF 296


>gi|19881367|gb|AAM00926.1|AF491818_1 hemagglutinin antigen [Avibacterium paragallinarum]
 gi|19881373|gb|AAM00929.1|AF491821_1 hemagglutinin antigen [Avibacterium paragallinarum]
 gi|19881385|gb|AAM00935.1|AF491827_1 hemagglutinin antigen [Avibacterium paragallinarum]
          Length = 341

 Score = 79.4 bits (194), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 35/221 (15%), Positives = 70/221 (31%), Gaps = 33/221 (14%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAG- 59
           M+K   A+ ++   L +   AQAA                 A   Y   +  +   + G 
Sbjct: 1   MKKT--AIALAIAGLTAASVAQAA---------------PQANTFYAGAKAGWASFHDGL 43

Query: 60  LSALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGS 119
                + +      ++    +F GY + D+  +     D               H   G+
Sbjct: 44  NQFENSQNAYGTLRNSVTYGVFGGYQITDNFAVELGYDDFGRAKFRQDGETVIKHTNHGA 103

Query: 120 -LRIRGGYEVSDSLLLYATVGPDVAQKYET------GKAGEITPIAIGGTAGVGVEVGGL 172
            L ++  Y V + L +YA VG  + +                  + +      G+E    
Sbjct: 104 HLSLKASYPVLEGLDVYARVGAALIRSDYKPTKRAAPNETHEHSLKVSPVFAGGLEYNLP 163

Query: 173 S-ESLVARLEYRASK-YSKVEGFYN------TISLGVGMKF 205
           S   L  R+EY+      +     +      +++ G+  +F
Sbjct: 164 SLPELALRVEYQWVNKVGRDGSRVDYTPSIGSVTAGLSYRF 204


>gi|58200723|gb|AAW66611.1| hemagglutinin antigen [Avibacterium paragallinarum]
          Length = 344

 Score = 79.4 bits (194), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 37/224 (16%), Positives = 73/224 (32%), Gaps = 36/224 (16%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAG- 59
           M+K   A+ ++   L +   AQAA                 A   Y   +  +   + G 
Sbjct: 1   MKKT--AIALAIAGLTAASVAQAA---------------PQANTFYAGAKAGWASFHDGL 43

Query: 60  LSALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGS 119
                + +      ++    +F GY + D+  +     D               H   G+
Sbjct: 44  NQFENSQNADGTLRNSVTYGVFGGYQITDNFAVELGYDDFGRAKRRQGGETVIKHTNHGA 103

Query: 120 -LRIRGGYEVSDSLLLYATVGPDVAQKYET------GKAGEITPIAIGGTAGVGVEVGGL 172
            L ++  Y V + L +YA VG  + +                  + +      G+E    
Sbjct: 104 HLSLKASYPVLEGLDVYARVGAALIRSDYKPTKRAAPNQTHEHSLKVSPVFAGGLEYNLP 163

Query: 173 S-ESLVARLEYRAS--------KYSKVEGFYN--TISLGVGMKF 205
           S   L  R+EY+            S+V+   +  +++ G+  +F
Sbjct: 164 SLPELALRVEYQWVNKVGRVEKDGSRVDYTLSIGSVTAGLSYRF 207


>gi|299773241|gb|ADJ38695.1| outer membrane protein P5 [Haemophilus parasuis]
 gi|299773245|gb|ADJ38697.1| outer membrane protein P5 [Haemophilus parasuis]
          Length = 367

 Score = 79.4 bits (194), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 42/229 (18%), Positives = 79/229 (34%), Gaps = 32/229 (13%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATN-RYVPIRHDFNGPYAG 59
           M+K  +A+ VS LA+AS     AA      + G +    T   +   +  +++ +  YA 
Sbjct: 1   MKKSLIALAVSGLAVASVS--NAAPQANSFYVGAKAGWATFHNDINQLNSKYENDARYAT 58

Query: 60  LSALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGS 119
            +  Y         ++    +F GY + D+  +               +     H   G+
Sbjct: 59  SANGYG-----INRNSVTYGVFGGYQIIDNLAVELGYDYFGRVRGKEQEFRAFKHSAHGT 113

Query: 120 -LRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEI--TPIAIGGTAGVGVEVGGLSESL 176
            L ++  YEV + L +Y  VG  + +        E     +      G GVE   +   L
Sbjct: 114 HLSLKPSYEVLNGLDVYGKVGAALVRNDYKFYDTEDKAHNLKTSLLLGAGVEY-AILPEL 172

Query: 177 VARLEYRASK-----------------YSKVEG---FYNTISLGVGMKF 205
             R+EY+                    +          +++S G+  +F
Sbjct: 173 AFRVEYQWLSRVGNANKAAQKRGDTAMFGPGSTYSPDAHSVSAGISYRF 221


>gi|27377055|ref|NP_768584.1| hypothetical protein bll1944 [Bradyrhizobium japonicum USDA 110]
 gi|27350198|dbj|BAC47209.1| bll1944 [Bradyrhizobium japonicum USDA 110]
          Length = 825

 Score = 79.4 bits (194), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 38/224 (16%), Positives = 60/224 (26%), Gaps = 41/224 (18%)

Query: 18  FCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSFGEEAHHNAG 77
              A+A    +            +     +      +          +G + +     A 
Sbjct: 599 TAQAKANGIDKEPPPVMPTNWAGVYLGGTIGAGKGRSHYADPFPTPVSGDYADL--GGAM 656

Query: 78  GSIFAGYNVEDSCIMYGVEGDVRYTVPVLAD--------------NIHSLHGIGGSLRIR 123
                G N +    + G+E    +      +              N  S     G+L  R
Sbjct: 657 FGGQIGINYQTGSWVLGLEASGYWANVQGTNTCFGAFPSPQIAGFNCGSQIDALGALTGR 716

Query: 124 GGYEVSDSLLLYATVGPDVAQKYETGKAGEITP-------IAIGGTAGVGVEVGGLSESL 176
            GY   D  LLY   G    ++      G I+           G T G G+E   L  + 
Sbjct: 717 VGYAF-DRTLLYVKGGSAWDRQTNQFNTGGISGTILTNGNTNWGWTVGGGLEY-ALLPNW 774

Query: 177 VARLEYRASKYSKV----------------EGFYNTISLGVGMK 204
              LEY+   + K                      T+SLGV  K
Sbjct: 775 SMALEYKYYDFGKSPVFTTAGLGSVPLSPNSTTVQTVSLGVNYK 818



 Score = 77.1 bits (188), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 37/248 (14%), Positives = 62/248 (25%), Gaps = 56/248 (22%)

Query: 3   KLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSA 62
           K  LA          +  A AAD   +          T+          ++ G Y G   
Sbjct: 59  KALLASNSICWMAGLYGPAHAADLPVKTAPPITAAPSTL---------WNWTGIYVGAHL 109

Query: 63  LYNGSFGE-------------------EAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTV 103
                  +                          G    G N +    + G+E       
Sbjct: 110 GGAFGSSDWQTATGLQADFSNRGFPGSGNAEGLLGGGQIGVNYQFGTWVTGLEIAASAAD 169

Query: 104 PVL---------------ADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYET 148
                             +    +     G++  R G    + LL+Y   G   A     
Sbjct: 170 VDGFAKCANRADNRYGVISFTCDNRVTSLGTIAGRLGQTWGN-LLIYGKAGAAWATDESD 228

Query: 149 G------KAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFY-----NTI 197
                       +    G   G+G+E    S +L A +EY    +   +  Y     N  
Sbjct: 229 ARTSHYINKFNQSGTRWGWMGGLGLEY-AFSPNLSAFVEYDHFDFGSKDSNYVDQFNNAS 287

Query: 198 SLGVGMKF 205
           ++G   +F
Sbjct: 288 TVGFRQRF 295


>gi|312270729|gb|ADQ55765.1| OmpA [Haemophilus parasuis]
          Length = 365

 Score = 79.1 bits (193), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 43/229 (18%), Positives = 80/229 (34%), Gaps = 33/229 (14%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K  +A+ VS LA+AS   A AA      + G +    T   +       +        
Sbjct: 1   MKKSLIALAVSGLAVASV--ANAAPQANSFYVGAKAGWATFHNDI------NQLNFKYKN 52

Query: 61  SALYNGSFGE--EAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGG 118
            A Y     +     ++    +F GY + D+  +               +     H   G
Sbjct: 53  DARYATGRTDLGINRNSVTYGVFGGYQIIDNLAVELGYDYFGRVRGNKQEFRAFKHSAHG 112

Query: 119 S-LRIRGGYEVSDSLLLYATVGPDVAQKYE-----TGKAGEITPIAIGGTAGVGVEVGGL 172
           + L ++  YEV + L +Y  VG  + +        T +  +   +      G GVE   +
Sbjct: 113 THLSLKPSYEVLNGLDVYGKVGAALVRNDYKRYFQTREPVKSHNLKTSLIVGAGVEY-AI 171

Query: 173 SESLVARLEYRAS----KYSKVEG------------FYNTISLGVGMKF 205
              L  R+EY+       ++K E               ++++ G+  +F
Sbjct: 172 LPELAFRVEYQWLSNVGNFTKAEMKENRRATYNYSPDSHSVTAGISYRF 220


>gi|209968898|gb|ACJ02810.1| outer membrane protein P5 [Haemophilus parasuis]
          Length = 365

 Score = 79.1 bits (193), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 44/228 (19%), Positives = 83/228 (36%), Gaps = 31/228 (13%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATN-RYVPIRHDFNGPYAG 59
           M+K  +A+ VS LA+AS   A AA      + G +    T   +   +  ++  +  YA 
Sbjct: 1   MKKSLIALAVSGLAVASV--ANAAPQANSFYVGAKAGWATFHNDINQLNFKYKNDARYAT 58

Query: 60  LSALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGS 119
            +  Y         ++    +F GY + D+  +               +     H   G+
Sbjct: 59  SANRYG-----INRNSVTYGVFGGYQIIDNLAVELGYDYFGRVRGNKQEFREFKHSAHGT 113

Query: 120 -LRIRGGYEVSDSLLLYATVGPDVAQKYE-----TGKAGEITPIAIGGTAGVGVEVGGLS 173
            L ++  YEV   L +Y  VG  + +        T +  +   +      G GVE   + 
Sbjct: 114 HLSLKPSYEVLSGLDVYGKVGAALVRNDYKRYFQTREPVKSHNLKTSLIVGAGVEY-AIL 172

Query: 174 ESLVARLEYRAS----KYSKVEG------------FYNTISLGVGMKF 205
             L  R+EY+       ++K E               ++++ G+  +F
Sbjct: 173 PELAFRVEYQWLSNVGNFTKAEMKENRRATYNYSPDSHSVTAGISYRF 220


>gi|312113068|ref|YP_004010664.1| hypothetical protein Rvan_0276 [Rhodomicrobium vannielii ATCC
           17100]
 gi|311218197|gb|ADP69565.1| hypothetical protein Rvan_0276 [Rhodomicrobium vannielii ATCC
           17100]
          Length = 260

 Score = 79.1 bits (193), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 42/235 (17%), Positives = 70/235 (29%), Gaps = 41/235 (17%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M  +    G +     +   A AADP     +GG G        + V     + G Y G 
Sbjct: 1   MSVVKSVGGAALGMFLAAQVAYAADPYYGGGYGGYGGYKDPYPPQPVAPIPLWQGFYIGG 60

Query: 61  SALYNGSFGEEAHH-------------------NAGGSIFAGYNVEDSCIMYGVEGDVRY 101
           +     S  E A +                      G +  GYN+     ++G+EGD+  
Sbjct: 61  NIGGAWSTIETASNVVFVNGATTVLSDRSVEGSGFLGGLQLGYNIPIGNFLWGIEGDLGG 120

Query: 102 TVPVLAD------------NIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETG 149
                +              + S  G  G + +RGG+   +  L+Y   G          
Sbjct: 121 LGNDASKSFAVGGVLPSVLTVSSDGGWYGDVTVRGGFLYGN-ALIYLKGGFGFYTGETNV 179

Query: 150 KAGEI--------TPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFYNT 196
                        +    G T G G+E   +S     + EY    +      ++ 
Sbjct: 180 TLVTDNISALRQSSGTFTGWTLGGGLEY-QVSPRWSIKAEYLYFDFGDSTLNFDD 233


>gi|19881365|gb|AAM00925.1|AF491817_1 hemagglutinin antigen [Avibacterium paragallinarum]
          Length = 344

 Score = 79.1 bits (193), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 37/224 (16%), Positives = 73/224 (32%), Gaps = 36/224 (16%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAG- 59
           M+K   A+ ++   L +   AQAA                 A   Y   +  +   + G 
Sbjct: 1   MKKT--AIALAIAGLTAASVAQAA---------------PQANTFYAGAKAGWASFHDGL 43

Query: 60  LSALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGS 119
                + +      ++    +F GY + D+  +     D               H   G+
Sbjct: 44  NQFENSQNADGTLRNSVTYGVFGGYQITDNFAVELGYDDFGRAKSRQGGETVIKHTNHGA 103

Query: 120 -LRIRGGYEVSDSLLLYATVGPDVAQKYET------GKAGEITPIAIGGTAGVGVEVGGL 172
            L ++  Y V + L +YA VG  + +                  + +      G+E    
Sbjct: 104 HLSLKASYPVLEGLDVYARVGAALIRSDYKPTKRAAPNQTHEHSLKVSPVFAGGLEYNLP 163

Query: 173 S-ESLVARLEYRAS--------KYSKVEGFYN--TISLGVGMKF 205
           S   L  R+EY+            S+V+   +  +++ G+  +F
Sbjct: 164 SLPELALRVEYQWVNKVGRVEKDGSRVDYTPSIGSVTAGLSYRF 207


>gi|19881375|gb|AAM00930.1|AF491822_1 hemagglutinin antigen [Avibacterium paragallinarum]
          Length = 344

 Score = 79.1 bits (193), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 37/224 (16%), Positives = 73/224 (32%), Gaps = 36/224 (16%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAG- 59
           M+K   A+ ++   L +   AQAA                 A   Y   +  +   + G 
Sbjct: 1   MKKT--AIALAIAGLTAASVAQAA---------------PQANTFYAGAKAGWASFHDGL 43

Query: 60  LSALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGS 119
                + +      ++    +F GY + D+  +     D               H   G+
Sbjct: 44  NQFENSQNADGTLRNSVTYGVFGGYQITDNFAVELGYDDFGRAKRRQGGETVIKHTNHGA 103

Query: 120 -LRIRGGYEVSDSLLLYATVGPDVAQKYET------GKAGEITPIAIGGTAGVGVEVGGL 172
            L ++  Y V + L +YA VG  + +                  + +      G+E    
Sbjct: 104 HLSLKASYPVLEGLDVYARVGAALIRSDYKPTKRAAPNQTHEHSLKVSPVFAGGLEYNLP 163

Query: 173 S-ESLVARLEYRAS--------KYSKVEGFYN--TISLGVGMKF 205
           S   L  R+EY+            S+V+   +  +++ G+  +F
Sbjct: 164 SLPELALRVEYQWVNKVGRVEKDGSRVDYTPSIGSVTAGLSYRF 207


>gi|319406585|emb|CBI80227.1| Hemin binding protein D [Bartonella sp. 1-1C]
          Length = 274

 Score = 79.1 bits (193), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 49/275 (17%), Positives = 83/275 (30%), Gaps = 82/275 (29%)

Query: 7   AVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNG 66
            +   S         QAAD +R         VP I+++        + G Y G       
Sbjct: 6   LLVACSWTFIPVSMVQAADIMRPHQSQSYQPVPVISSSN----NFSWTGFYVGAQIGGFS 61

Query: 67  SFGEEAH----------------------HNAGGSIFAGYNVEDS-CIMYGVEGDVRYTV 103
                +                           G I+AG NV  +  ++ G++ DV ++ 
Sbjct: 62  GEATRSPTQDSVEEDSEGQEFSKIKSPKLSGFIGGIYAGSNVSLNKGLILGIDADVVWSG 121

Query: 104 PVLADNIHSLH----------------------GIGGSLRIRGGYEVSDSLLLYATVGPD 141
                                               G+ R+R G+ V D ++ Y + G  
Sbjct: 122 KKNTKVFDVQDMNILERSSTDVSSISISHSLQEKWAGATRMRVGFAV-DRVVPYVSGGVS 180

Query: 142 VAQKYE----------------------TGKAGEITPIAIGGTAGVGVEVGGLSESLVAR 179
             Q                           K  + T I +G + G GV+V  ++++++ R
Sbjct: 181 YVQLQNVFTAKGLARALAQARSASPSGSETKVLDETKILVGYSVGGGVDV-AMTDNVIMR 239

Query: 180 LEYRASKYSKVEG---------FYNTISLGVGMKF 205
            EYR S + K +            N   +GV  KF
Sbjct: 240 AEYRYSDFGKKKFAKDNVDLSYKTNDFRVGVAYKF 274


>gi|148252036|ref|YP_001236621.1| putative 31 kDa outer-membrane immunogenic protein [Bradyrhizobium
           sp. BTAi1]
 gi|146404209|gb|ABQ32715.1| putative 31 kDa outer-membrane immunogenic protein precursor
           [Bradyrhizobium sp. BTAi1]
          Length = 219

 Score = 78.7 bits (192), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 37/200 (18%), Positives = 63/200 (31%), Gaps = 18/200 (9%)

Query: 19  CSAQAADPVRRAH--HGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSFGEEAHHNA 76
             A+AAD     +            +   +    +         S               
Sbjct: 21  TGARAADMPATTYKAPAYASAPAPFSWTGFYAGANVGGAFTGNDSVTNLAGGNGGKLSGV 80

Query: 77  GGSIFAGYNVED-SCIMYGVEGDVRYTVPVLAD---NIHSLHGIGGSLRIRGGYEVSD-S 131
            G + AGYN +     + G+E D+ +T         N         + R R G+ + D  
Sbjct: 81  IGGMQAGYNYQVSPLFVVGIENDLDFTGLSRQGDLVNPAVSVPWLTTGRARAGFTMLDQR 140

Query: 132 LLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKV- 190
           L LY T G    +  +    G +  + +G TAG G E         A+LEY  +      
Sbjct: 141 LFLYGTAGLAAGELKD----GPVHKVKMGWTAGGGAE-WAFLPKWSAKLEYLYTDLKHDA 195

Query: 191 -----EGFYNTISLGVGMKF 205
                    +++ +G+   F
Sbjct: 196 LPDWRAAKIHSVRVGLNYHF 215


>gi|261822111|ref|YP_003260217.1| outer membrane protein A [Pectobacterium wasabiae WPP163]
 gi|261606124|gb|ACX88610.1| OmpA domain protein transmembrane region-containing protein
           [Pectobacterium wasabiae WPP163]
          Length = 361

 Score = 78.7 bits (192), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 35/224 (15%), Positives = 65/224 (29%), Gaps = 40/224 (17%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K   A+ V+    +    AQAA                     Y   +   +  +   
Sbjct: 1   MKKT--AIAVAVALASFATIAQAA---------------PKDNTWYTGGKLGVSQFHDTG 43

Query: 61  SAL--YNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGG 118
                Y G          G   F GY    +    G E    +   +      +      
Sbjct: 44  FYGNGYTGVVNNPIKSKLGAGAFVGYQ---ANPYLGFELGYDWLGRMKYAGSDTNAADSA 100

Query: 119 SLRI-------RGGYEVSDSLLLYATVGPDVAQKYE----TGKAGEITPIAIGGTAGVGV 167
           S +        +  Y V   L +Y  +G  V +       +G         +   A VG+
Sbjct: 101 SFKAQGIQLATKLSYPVMPDLDVYTRLGGLVWRTDSHADRSGTHLNNNDTGVSPLAAVGI 160

Query: 168 EVGGLSESLVARLEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
           E   + ++   R++Y+          V    +   +S+G+  +F
Sbjct: 161 EY-AIDKNWATRVDYQWVSNIGDAGTVGARPDNLLMSVGLSYRF 203


>gi|86749852|ref|YP_486348.1| hypothetical protein RPB_2735 [Rhodopseudomonas palustris HaA2]
 gi|86572880|gb|ABD07437.1| conserved hypothetical protein [Rhodopseudomonas palustris HaA2]
          Length = 570

 Score = 78.7 bits (192), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 38/210 (18%), Positives = 56/210 (26%), Gaps = 27/210 (12%)

Query: 10  VSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSFG 69
           +S+  L    ++QAAD  R A      V           +   F           +    
Sbjct: 8   LSAALLTPSGTSQAADLARPAAPLAGAVWTWTGFYVGAHLGAGFGTVKVDNPYGPSIYGD 67

Query: 70  EEAHHNAGGSIFAGYNVEDSC--IMYGVEGDVRYTVPVLAD------------NIHSLHG 115
                 A   + AGYN +      + G+E D         D            N      
Sbjct: 68  TIRVPKALAGLQAGYNWQVPGSPWVLGIELDASALDADGTDTCLAYSGQFVSANCRVREH 127

Query: 116 IGGSLRIRGGYEVSD--SLLLYATVGPDVAQKYETGKAGEI----------TPIAIGGTA 163
             G++  R G         L Y   G  V     T     +               G T 
Sbjct: 128 ALGTVTGRIGRVFGPQGRSLAYLKGGAAVLAGDLTMTTNAVDYLNQPAAKLDATRWGWTV 187

Query: 164 GVGVEVGGLSESLVARLEYRASKYSKVEGF 193
           G G+E G LS     + EY  + + +    
Sbjct: 188 GAGLEYG-LSSGWTVKAEYDYAAFGRRGID 216


>gi|270261236|ref|ZP_06189509.1| outer membrane protein A, precursor [Serratia odorifera 4Rx13]
 gi|270044720|gb|EFA17811.1| outer membrane protein A, precursor [Serratia odorifera 4Rx13]
          Length = 359

 Score = 78.7 bits (192), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 38/220 (17%), Positives = 64/220 (29%), Gaps = 33/220 (15%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K   A+ ++         AQAA                     Y   +  ++  +   
Sbjct: 1   MKKT--AIALAVALAGFATVAQAA---------------PKDNTWYTGAKLGWSQYHDTG 43

Query: 61  SALYNG----SFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGI 116
                       G       G   F GY              +       + N  +    
Sbjct: 44  FYGNGYQNGIGNGPNHKDQLGAGAFLGYQANQYLGFELGYDWLGRMPYKGSVNNGAFKAQ 103

Query: 117 GGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGE-----ITPIAIGGTAGVGVEVGG 171
           G  L  +  Y ++D L +Y  +G  V +       G           +   A VGVE   
Sbjct: 104 GVQLAAKLSYPIADDLDIYTRLGGMVWRADSKANYGNGTRLSDHDTGVSPLAAVGVEY-A 162

Query: 172 LSESLVARLEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
           L+++   RL+Y+          V    +   +SLGV  +F
Sbjct: 163 LTKNWATRLDYQFVSNIGDAGTVGARPDNTMLSLGVSYRF 202


>gi|83308662|emb|CAJ01570.1| outer membrane protein [uncultured bacterium]
          Length = 238

 Score = 78.7 bits (192), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 40/191 (20%), Positives = 64/191 (33%), Gaps = 38/191 (19%)

Query: 51  HDFNGPYAGLSALYNGS-----------FGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDV 99
             + G Y G    Y                    +   G    GYN++ +  + G+EGDV
Sbjct: 38  FTWAGLYLGGQIGYGWGTDTLTVFPRGFGTNFTPNGVVGGAHIGYNLQFNQFVAGLEGDV 97

Query: 100 RYTVPVLADN-----IHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGK---- 150
             T    + +       +   + GS+R R G    D  LLYAT G + A    +      
Sbjct: 98  EGTSIDSSFSPGGVLYSTRIPVQGSIRGRVGVAF-DRALLYATGGAEFAGFNTSENGFPG 156

Query: 151 AGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEG----------------FY 194
             + +    G T G G+E   ++ +   R EYR + +  +                    
Sbjct: 157 FDQNSTTRTGWTVGGGIEY-AVTGNWSIRAEYRYADFGHLTDPTPFTFGFGSFVIHHETE 215

Query: 195 NTISLGVGMKF 205
           N +  G   KF
Sbjct: 216 NAVRAGFSYKF 226


>gi|319404477|emb|CBI78084.1| Hemin binding protein D [Bartonella rochalimae ATCC BAA-1498]
          Length = 267

 Score = 78.7 bits (192), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 42/280 (15%), Positives = 71/280 (25%), Gaps = 88/280 (31%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+ L      S   L S    QA D V              A+   +     + G Y G 
Sbjct: 1   MKYL----TASVFTLFSISIVQATDFVI-------PYQSYTASPVVLSSTFSWTGFYFGG 49

Query: 61  SALYNGSFGEEAH--------------------HNAGGSIFAGYNVEDSC-IMYGVEGDV 99
                      +                         G ++ G N+  +   + G + D+
Sbjct: 50  KIGVFSGQSTSSFIDSNNVKHNIIFQNQSSPKLSGVVGGLYTGLNININNGFVLGFDTDI 109

Query: 100 RYTVPVLADNIHS----------------------LHGIGGSLRIRGGYEVSDSLLLYAT 137
            ++       I                              ++R R G+   D ++ Y  
Sbjct: 110 NWSGAKDTKVIDIIASLKADNNKKSQIDFDIKQSLQQKWLSAIRGRIGFSF-DRVMPYIA 168

Query: 138 VGPDVAQKYETGKAGE-----------------------ITPIAIGGTAGVGVEVGGLSE 174
            G  V +   T                             + I  G T G G++   +++
Sbjct: 169 GGISVTKLQSTYLKFFVPSKNNSLTRSSLEKTPPVLSTSNSKIMNGYTIGGGLDF-AITD 227

Query: 175 SLVARLEYRASKYS---------KVEGFYNTISLGVGMKF 205
           + + R EY  S +           V    N    GV  KF
Sbjct: 228 NFILRAEYNYSDFGKKEFVNNNMNVSYKSNAFYFGVACKF 267


>gi|299773277|gb|ADJ38713.1| outer membrane protein P5 [Haemophilus parasuis]
          Length = 367

 Score = 78.7 bits (192), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 42/230 (18%), Positives = 81/230 (35%), Gaps = 33/230 (14%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATN-RYVPIRHDFNGPYAG 59
           M+K  +A+ VS LA+AS   AQAA      + G +    T   +   +  ++  +  Y  
Sbjct: 1   MKKSLIALAVSGLAVASV--AQAAPQANTFYVGAKAGWATFHNDINQIDSKYANDARYDA 58

Query: 60  LSALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGS 119
            +  Y       + ++    +F GY + D+  +               +     H   G+
Sbjct: 59  TNLKYG-----ISRNSVTYGVFGGYQIIDNLAVELGYDYFGRVRGNKQEFRAFKHSAHGT 113

Query: 120 -LRIRGGYEVSDSLLLYATVGPDVAQKYETGKA-------GEITPIAIGGTAGVGVEVGG 171
            L ++  YEV + L +Y  V   + +                   +      G GVE   
Sbjct: 114 HLSLKPSYEVLNGLDVYGKVAAALVRNDYKRPPQTGGVPTQPAHNLKTSLVLGAGVEY-A 172

Query: 172 LSESLVARLEYRAS----KYSKVEG------------FYNTISLGVGMKF 205
           +   L  R+EY+       ++K E               ++++ G+  +F
Sbjct: 173 ILPELAFRVEYQWLSNVGNFTKGEAKENRRATYNYSPDSHSVTAGISYRF 222


>gi|299773261|gb|ADJ38705.1| outer membrane protein P5 [Haemophilus parasuis]
 gi|299773267|gb|ADJ38708.1| outer membrane protein P5 [Haemophilus parasuis]
          Length = 367

 Score = 78.7 bits (192), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 42/230 (18%), Positives = 82/230 (35%), Gaps = 33/230 (14%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATN-RYVPIRHDFNGPYAG 59
           M+K  +A+ VS LA+AS  S  AA      + G +    T   +   +  ++  +  Y  
Sbjct: 1   MKKSLIALAVSGLAVASVSS--AAPQANTFYVGAKAGWATFHNDINQIDSKYANDARYDA 58

Query: 60  LSALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGS 119
            +  Y       + ++    +F GY + D+  +               +     H   G+
Sbjct: 59  TNLKYG-----ISRNSVTYGVFGGYQIIDNLAVELGYDYFGRVRGNKQEFRAFKHSAHGT 113

Query: 120 -LRIRGGYEVSDSLLLYATVGPDVAQKYETGK-------AGEITPIAIGGTAGVGVEVGG 171
            L ++  YEV + L +Y  VG  + +               +   +      G GVE   
Sbjct: 114 HLSLKPSYEVLNGLDVYGKVGAALVRNDYKRYSQTAGVQTQKAHNLKTSLVLGAGVEY-A 172

Query: 172 LSESLVARLEYRAS----KYSKVEG------------FYNTISLGVGMKF 205
           +   L  R+EY+       ++K E               ++++ G+  +F
Sbjct: 173 ILPELAFRVEYQWLSNVGNFTKAEAKENRRATYNYSPDSHSVTAGISYRF 222


>gi|39933934|ref|NP_946210.1| outer membrane protein [Rhodopseudomonas palustris CGA009]
 gi|39647781|emb|CAE26301.1| possible outer membrane protein [Rhodopseudomonas palustris CGA009]
          Length = 244

 Score = 78.7 bits (192), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 33/199 (16%), Positives = 58/199 (29%), Gaps = 33/199 (16%)

Query: 38  VPTIATNRYVPIRHDFNGPYAGLSALYNGSFGEEAHHNAG--------GSIFAGYNVED- 88
             T A        +++ G Y G       S                  G + AGY+ +  
Sbjct: 38  PYTKAPAYAPAPVYNWTGFYIGGHIGGAFSGDNSIGTGVTASDNGKFLGGVQAGYDWQFA 97

Query: 89  SCIMYGVEGDVRYTVPVLAD----------NIHSLHGIGGSLRIRGGYEVSDSLLLYATV 138
              + GVEG   +     +                     S+  R GY    +LL Y   
Sbjct: 98  PNWVLGVEGQYSWLSGTNSSVSWGAPGAVFTYSDNQRGLASVTGRLGYTWGPALL-YVKG 156

Query: 139 GPDVAQKYETGKAGE----ITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKV---- 190
           G   A    +         +     G T G G+E    + +   ++EY+   +  V    
Sbjct: 157 GWAYADYSSSLTFNNVGVAVDSKTDGYTVGGGLEY-LFAPNWSGKIEYQYYDFGNVTLAP 215

Query: 191 ----EGFYNTISLGVGMKF 205
               +   + +  G+  +F
Sbjct: 216 GFTAKNDEHVVKAGLNYRF 234


>gi|13474724|ref|NP_106293.1| outer membrane protein [Mesorhizobium loti MAFF303099]
 gi|14025479|dbj|BAB52079.1| outer membrane protein [Mesorhizobium loti MAFF303099]
          Length = 205

 Score = 78.7 bits (192), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 40/219 (18%), Positives = 70/219 (31%), Gaps = 33/219 (15%)

Query: 3   KLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSA 62
           ++ + V  + LA      A AAD                      P    ++G Y G+  
Sbjct: 4   RVKIVVTAAGLAFCLLGPAMAADLS---------------PTYNDPPAFQWSGAYVGVHG 48

Query: 63  LYNGSFGEE---AHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLAD--NIHSLHGIG 117
               +         +   G + AGYN +    + G E +  Y      D           
Sbjct: 49  GTAFTGMPNPFAGRNGFSGGVQAGYNQQMGPTVLGAEIEGSYLGGAEHDVQGGKIKEKWR 108

Query: 118 GSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLV 177
           G+ + + G    D  LL+ T G  + +  +           +G   G G+E G  +  L 
Sbjct: 109 GAAKAKAGLSF-DQTLLFGTGGVALTKFDKGDNVSSADGWKVGYLLGAGIEQGF-AGGLS 166

Query: 178 ARLEYRASK-----------YSKVEGFYNTISLGVGMKF 205
           A++EY   +            SK     + +  G+  +F
Sbjct: 167 AKVEYDYVRTLGVETTSALGTSKTTIGSHELKAGINYRF 205


>gi|121602037|ref|YP_989465.1| omp25/ropB family outer membrane protein [Bartonella bacilliformis
           KC583]
 gi|120614214|gb|ABM44815.1| outer membrane protein, omp25/ropB family [Bartonella bacilliformis
           KC583]
          Length = 284

 Score = 78.7 bits (192), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 47/290 (16%), Positives = 79/290 (27%), Gaps = 93/290 (32%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+ L +  G++   L S     AAD V               ++ + P    + G Y G 
Sbjct: 3   MRYLSVLFGIT---LGSSSVVNAADVVVINKTEEEAPAS---SSVFTPADLSWTGVYLGG 56

Query: 61  SALYNGSFGEEAH-----------------HNAGGSIFAGYNVEDSC-IMYGVEGDVRYT 102
                 S  +                        G ++ G N++     + GVE D  ++
Sbjct: 57  QISGFSSKVDIDRYSDNTWSSVEKSLLPEISGFSGGLYVGSNIDLGEGFILGVETDALWS 116

Query: 103 VPVLADNIHSL------------------------------------------------H 114
                  + +                                                  
Sbjct: 117 NTGDKKTLPTKKVGAAHRLEAAERNREDEVVQERRVAAANNSAKAPEANVRMTGEYALRQ 176

Query: 115 GIGGSLRIRGGYEVSDSLLLYATVGPDVAQ----------KYETGKAGEITPIAIGGTAG 164
              G+ R R G+ V +  + Y T G    Q             T  + +   + +G   G
Sbjct: 177 QWIGATRARVGFAV-ERFMPYVTGGLAYGQLRGVNLLALATNNTENSEKEEKLMVGYAVG 235

Query: 165 VGVEVGGLSESLVARLEYRASKYSK---------VEGFYNTISLGVGMKF 205
            G++   +S ++  R EYR S   K         V    N   +GV  KF
Sbjct: 236 AGLDF-AVSSNIFLRTEYRFSDLGKKKFANEKIEVNYKINDFRVGVAYKF 284


>gi|146340935|ref|YP_001205983.1| putative outer-membrane protein [Bradyrhizobium sp. ORS278]
 gi|146193741|emb|CAL77758.1| putative outer-membrane protein; putative secreted protein
           [Bradyrhizobium sp. ORS278]
          Length = 242

 Score = 78.7 bits (192), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 42/246 (17%), Positives = 73/246 (29%), Gaps = 53/246 (21%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+KL + +  + + +A+  SA AAD   R +               +   +D++G Y G+
Sbjct: 1   MKKLLV-ITTALVGIATATSASAADLAARPYTKAPP---------AIVAINDWSGFYLGI 50

Query: 61  SALYNGSF-----------GEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADN 109
           +  Y  S            G             GY  +   +++G+E    +      + 
Sbjct: 51  NGGYGSSRNCWTLVNGPAEGCHNATGGTVGGQFGYRWQMGQVVFGLEAQGNWADLTGNNV 110

Query: 110 I--------HSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITP----- 156
                     +     G    + GY   D+LL YA  G  V        +G I       
Sbjct: 111 TPVFAPDRNRTKLTAFGLFTGQIGYSFGDTLL-YAKGGAAVTDTRYEIFSGVINTVLAAT 169

Query: 157 --IAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEG---------------FYNTISL 199
                G + G GVE    + S     EY                           +  + 
Sbjct: 170 TVHKWGASVGAGVEY-AFAPSWSVGFEYDHLFMGNTNVPFQGAVFAQTDRIKQDVDLFTA 228

Query: 200 GVGMKF 205
            +  +F
Sbjct: 229 RINYRF 234


>gi|316934026|ref|YP_004109008.1| putative outer-membrane protein precursor [Rhodopseudomonas
           palustris DX-1]
 gi|315601740|gb|ADU44275.1| putative outer-membrane protein precursor [Rhodopseudomonas
           palustris DX-1]
          Length = 246

 Score = 78.7 bits (192), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 39/227 (17%), Positives = 64/227 (28%), Gaps = 46/227 (20%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K  L   V  +AL           V  A        P       +P  +D++G Y G 
Sbjct: 1   MKKFLLG-TVGLIALG----------VAPAMAADLAARPYTKAPPIIPAMYDWSGFYIGA 49

Query: 61  SALYN------------------GSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYT 102
           +  +                      G             GYN +    ++GVE    + 
Sbjct: 50  NGGWGSSRNCWDYLGTTAAPFAAFGEGCHDASGGTVGGQIGYNWQVGTWVFGVEAQGNWA 109

Query: 103 VPVLAD--------NIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKA--- 151
               ++           S     G    R GY  +++LL Y   G  V     T      
Sbjct: 110 DFKGSNASLRFTDTTNESKVDAFGLFTARVGYAWNNALL-YVKGGAAVTSDKYTTYRTLA 168

Query: 152 ----GEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFY 194
                + +    G   G G+E G  + +    +EY        +  +
Sbjct: 169 GTIIDDASETRWGAAVGGGLEYGF-TPNWSFAVEYDHLFMGGRDLTF 214


>gi|299773263|gb|ADJ38706.1| outer membrane protein P5 [Haemophilus parasuis]
          Length = 367

 Score = 78.3 bits (191), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 43/230 (18%), Positives = 82/230 (35%), Gaps = 33/230 (14%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATN-RYVPIRHDFNGPYAG 59
           M+K  +A+ VS LA+AS  S  AA      + G +    T   +   +  ++  +  YA 
Sbjct: 1   MKKSLIALAVSGLAVASVSS--AAPQANTFYVGAKAGWATFHNDINQLNSKYKNDARYAT 58

Query: 60  LSALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGS 119
            +  Y         ++    +F GY + D+  +               +     H   G+
Sbjct: 59  SANGYV-----INRNSVTYGVFGGYQIIDNLAVELGYDYFGRVRGNKQEFRAFKHSAHGT 113

Query: 120 -LRIRGGYEVSDSLLLYATVGPDVAQKYETGK-------AGEITPIAIGGTAGVGVEVGG 171
            L ++  YEV + L +Y  VG  + +               +   +      G GVE   
Sbjct: 114 HLSLKPSYEVLNGLDVYGKVGAALVRNDYKRYSQTAGVQTQKAHNLKTSLVLGAGVEY-A 172

Query: 172 LSESLVARLEYRAS----KYSKVEG------------FYNTISLGVGMKF 205
           +   L  R+EY+       ++K E               ++++ G+  +F
Sbjct: 173 ILPELAFRVEYQWLSNVGNFTKAEAKENRRATYNYSPDSHSVTAGISYRF 222


>gi|6012949|emb|CAB57308.1| putative outer-membrane protein A [Pectobacterium carotovorum]
          Length = 367

 Score = 78.3 bits (191), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 33/224 (14%), Positives = 65/224 (29%), Gaps = 40/224 (17%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K   A+G++         AQAA                     Y   +   +  +   
Sbjct: 1   MKKT--AIGLAVALAGFATVAQAA---------------PKDNTWYTGGKLGVSQFHDTG 43

Query: 61  SALYNGSFGEEAH--HNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGG 118
                 +           G   F GY    +    G E    +   +      +      
Sbjct: 44  FYGNGYTDVNNNPIKSKLGAGAFVGYQ---ANPYLGFEMGYDWLGRMKYAGSTANPADSA 100

Query: 119 SLRI-------RGGYEVSDSLLLYATVGPDVAQKYE----TGKAGEITPIAIGGTAGVGV 167
           SL+        +  Y V   L +Y  +G  V +       +G         +   A +G+
Sbjct: 101 SLKAQGIQLAAKLSYPVLPDLDVYTRLGGMVWRVDTHADRSGNHLNNDDTGVSPLAAIGI 160

Query: 168 EVGGLSESLVARLEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
           E   + ++   R++Y+          V    +   +S+G+  +F
Sbjct: 161 EY-AIDKNWATRVDYQWVSNIGDAGTVGARPDNMLMSVGLSYRF 203


>gi|129141|sp|P04845|OMPA_SERMA RecName: Full=Outer membrane protein A; Flags: Precursor
 gi|758300|emb|CAA25254.1| ompA protein [Serratia marcescens]
          Length = 359

 Score = 78.3 bits (191), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 38/221 (17%), Positives = 64/221 (28%), Gaps = 34/221 (15%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K   A+ ++         AQAA                     Y   +  ++  +   
Sbjct: 1   MKKT--AIALAVALAGFATVAQAA---------------PKDNTWYTGAKLGWSQYHDTG 43

Query: 61  SALYNG----SFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGI 116
                       G       G   F GY              +       + N  +    
Sbjct: 44  FYGNGYQNGIGNGPTHKDQLGAGAFLGYQANQYLGFELGYDWLGRMPYKGSVNNGAFKAQ 103

Query: 117 GGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGE------ITPIAIGGTAGVGVEVG 170
           G  L  +  Y ++D L +Y  +G  V +       G            +   A VGVE  
Sbjct: 104 GVQLAAKLSYPIADDLDIYTRLGGMVWRADSKANYGRTGQRLSDHDTGVSPLAAVGVEY- 162

Query: 171 GLSESLVARLEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
            L+++   RL+Y+          V    +   +SLGV  +F
Sbjct: 163 ALTKNWATRLDYQFVSNIGDAGTVGARPDNTMLSLGVSYRF 203


>gi|299135509|ref|ZP_07028695.1| OmpA domain protein transmembrane region-containing protein [Afipia
           sp. 1NLS2]
 gi|298589733|gb|EFI49942.1| OmpA domain protein transmembrane region-containing protein [Afipia
           sp. 1NLS2]
          Length = 229

 Score = 78.3 bits (191), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 37/221 (16%), Positives = 68/221 (30%), Gaps = 25/221 (11%)

Query: 8   VGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIAT--NRYVPIRHDFNGPYAGLSALYN 65
           +  +++A  S  S  AAD   R +      V  I      Y+  +       +       
Sbjct: 1   LLAATVAALSSTSVFAADLAARHYTKAPAYVAPIYNWTGFYIGAQVGGAFQGSSGYNATA 60

Query: 66  GSFGEEAHHNAGGSIFAGYNVED-SCIMYGVEGDVRYTVPVL-------ADNIHSLHGIG 117
           G  G     +  G    G N +     + G+EG+               A+ +   +   
Sbjct: 61  GVVGTRDDSSFIGGGVVGANYQFAPNWVVGLEGEFNGLSNNRHTFTDATANTVSIKNDWL 120

Query: 118 GSLRIRGGYEVSDSLLLYATVGPDVAQ--KYETGKAGEITPIAIGGTAGVGVEVGGLSES 175
            S+  R GY      ++YA  G          +     +     G T G G+E    + +
Sbjct: 121 ASVTGRLGYTWGPG-MIYAKGGVAFRDNGGVTSNVVALVDRNDTGYTVGAGLEY-MFAPA 178

Query: 176 LVARLEYRASKYSKVEG-----------FYNTISLGVGMKF 205
             A++EY+   +                  +T+  G+   F
Sbjct: 179 WSAKVEYQYYNFDHTNVAFATNTASYRDDLHTVKAGINYHF 219


>gi|310639322|ref|YP_003944081.1| outer membrane protein [Ketogulonicigenium vulgare Y25]
 gi|308752898|gb|ADO44042.1| outer membrane protein [Ketogulonicigenium vulgare Y25]
          Length = 261

 Score = 78.3 bits (191), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 33/237 (13%), Positives = 65/237 (27%), Gaps = 33/237 (13%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDF------- 53
           M+ + +A  ++S +  +  +   + PV           P  A +                
Sbjct: 26  MRYICIAAFLASTSAIAANAGGLSTPVMEPPVIMVQPTPMPAPSWQGAYVGANVNYGDLS 85

Query: 54  ---NGPYAGLSALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVL---- 106
               G                       +I  GY+ + +  ++G+ G+  +         
Sbjct: 86  VDSTGVLETALQGAGFDTTVATADGVNYAIRGGYDWQFNNWLFGLGGEYSFGSYDGGLSG 145

Query: 107 ------ADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIG 160
                   +I        +  +R GY  S S   Y  VG   A    T      +     
Sbjct: 146 DLVTALGTDIDLSIDSVATAYLRAGYAFSQSTAAYLLVGYTWATAEATLGGTTYSEDYEA 205

Query: 161 GTAGVGVEVGGLSESLVARLEYRASKYSKVE------------GFYNTISLGVGMKF 205
            + G+GVE    + +     EY  + +  +                    +GV  +F
Sbjct: 206 ASYGLGVE-HRFNRAWSVYGEYVYTDFGDINPTNDPTYDNLAEADLGQFKIGVNFRF 261


>gi|19881377|gb|AAM00931.1|AF491823_1 hemagglutinin antigen [Avibacterium paragallinarum]
          Length = 344

 Score = 78.3 bits (191), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 36/224 (16%), Positives = 73/224 (32%), Gaps = 36/224 (16%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAG- 59
           M+K   A+ ++   L +   AQAA                 A   Y   +  +   + G 
Sbjct: 1   MKKT--AIALAIAGLTAASVAQAA---------------PQANTFYAGAKAGWASFHDGL 43

Query: 60  LSALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGS 119
                + +      ++    +F GY + D+  +     D               +   G+
Sbjct: 44  NQFENSQNADGTLRNSVTYGVFGGYQITDNFAVELGYDDFGRAKLRQGGETVIKYTNHGA 103

Query: 120 -LRIRGGYEVSDSLLLYATVGPDVAQKYET------GKAGEITPIAIGGTAGVGVEVGGL 172
            L ++  Y V + L +YA VG  + +                  + +      G+E    
Sbjct: 104 HLSLKASYPVLEGLDVYARVGAALIRSDYKPTKRAAPNQTHEHSLKVSPVFAGGLEYNLP 163

Query: 173 S-ESLVARLEYRAS--------KYSKVEGFYN--TISLGVGMKF 205
           S   L  R+EY+            S+V+   +  +++ G+  +F
Sbjct: 164 SLPELALRVEYQWVNKVGRVEKDGSRVDYTPSIGSVTAGLSYRF 207


>gi|157960752|ref|YP_001500786.1| OmpA/MotB domain-containing protein [Shewanella pealeana ATCC
           700345]
 gi|157845752|gb|ABV86251.1| OmpA/MotB domain protein [Shewanella pealeana ATCC 700345]
          Length = 356

 Score = 78.3 bits (191), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 40/217 (18%), Positives = 61/217 (28%), Gaps = 23/217 (10%)

Query: 1   MQKLFLAVGVSSLALA----SFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGP 56
           M KL L   VS +       S  S  AA+             P           H  N  
Sbjct: 1   MFKLSLKANVSIVFFTLLYQSLGSVYAAEADSSEPANEFA--PYFYLGAKAGQMHYQNAC 58

Query: 57  YAGLSALYNGSFGEEAHHNAGGSIFAGYN-VE---DSCIMYGVEGDVRYTVPVLADNIHS 112
            +               +  G   FAGY   +          +   V        +N + 
Sbjct: 59  ESW--------SVSCDGNYVGFGGFAGYQAWQYLGFETAYLDLGEAVSGYSESAVNNTYV 110

Query: 113 LHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGL 172
               G  L     + +S+   L+A  G         G     +        G G+    +
Sbjct: 111 GSMKGWELSAVTRFGLSEDFELFAKAGSFYWDGDNQGPYSRNSDSGWAPMLGAGLAY-QI 169

Query: 173 SESLVARLEYRASKYSKVE----GFYNTISLGVGMKF 205
           S S VARLEY+       +       +  +LG+  +F
Sbjct: 170 SPSWVARLEYQYIDKLGSDLIGGSNGHLTTLGISYRF 206


>gi|213027149|ref|ZP_03341596.1| outer membrane protein A [Salmonella enterica subsp. enterica
           serovar Typhi str. 404ty]
          Length = 236

 Score = 78.3 bits (191), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 35/216 (16%), Positives = 70/216 (32%), Gaps = 32/216 (14%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K  +A+ V+         AQAA                     Y   +  ++  +   
Sbjct: 1   MKKTAIAIAVALA--GFATVAQAA---------------PKDNTWYAGAKLGWSQYHDT- 42

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGSL 120
              +  + G    +  G   F GY V            +        +   +    G  L
Sbjct: 43  --GFIHNDGPTHENQLGAGAFGGYQVNPYVGFEMGYDWLGRMPYKGDNTNGAYKAQGVQL 100

Query: 121 RIRGGYEVSDSLLLYATVGPDVAQKYET-----GKAGEITPIAIGGTAGVGVEVGGLSES 175
             + GY ++D L +Y  +G  V +         G + +     +      G+E   ++  
Sbjct: 101 TAKLGYPITDDLDVYTRLGGMVWRADTKSNVPGGASTKDHDTGVSPVFAGGIEY-AITPE 159

Query: 176 LVARLEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
           +  RLEY+ +      + +    +   +S+GV  +F
Sbjct: 160 IATRLEYQWTNNIGDANTIGTRPDNGLLSVGVSYRF 195


>gi|39933882|ref|NP_946158.1| outer membrane protein [Rhodopseudomonas palustris CGA009]
 gi|192289301|ref|YP_001989906.1| porin [Rhodopseudomonas palustris TIE-1]
 gi|39647729|emb|CAE26249.1| possible outer membrane protein [Rhodopseudomonas palustris CGA009]
 gi|192283050|gb|ACE99430.1| porin [Rhodopseudomonas palustris TIE-1]
          Length = 449

 Score = 78.3 bits (191), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 39/216 (18%), Positives = 59/216 (27%), Gaps = 35/216 (16%)

Query: 24  ADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLS-----ALYNGSFGEEAHHNAGG 78
           A    R    G  + P  A    + I  +F G                     A     G
Sbjct: 227 AGLNYRIGGNGTYITPPPANWAGLYIGGNFGGATGRDRSSLTLGGGQTDTFNLAPDGFIG 286

Query: 79  SIFAGYNVEDSCIMYGVEGDVRYTVPVLA--------DNIHSLHGIGGSLRIRGGYEVSD 130
               GYN + S  ++GVE D + +                 +     G+ R R GY +  
Sbjct: 287 GGQIGYNWQASNWVFGVEADFQGSTQKDQRASVLGPRAYYDAKLPWFGTARGRIGYSLG- 345

Query: 131 SLLLYATVGPDVAQKYETGKAGEIT----PIAIGGTAGVGVE-----VGGLSESLVARLE 181
           S L Y T G           +            G  AG G+E      G L  +  ++ E
Sbjct: 346 STLFYGTAGYAYGNIKSDIVSSIGNYSFKTTKGGWAAGAGIETPFQLFGLLGPNWTSKTE 405

Query: 182 YRASKYSK------------VEGFYNTISLGVGMKF 205
           Y                    +   + +  G+   F
Sbjct: 406 YLYVDLGSTTDVFGGTGINTTKVTEHILRTGINYHF 441



 Score = 70.6 bits (171), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 43/237 (18%), Positives = 72/237 (30%), Gaps = 38/237 (16%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+++F  V    LA  +  SAQAAD   +A +    V        +    +   G    L
Sbjct: 1   MKRIFAGV---VLAGTAAVSAQAADLAVKAPYLKAPVAAVYDWTGFYIGANVGVGLGRNL 57

Query: 61  S-----ALYNGSFGEEAHHNAGGSIFAGYNVEDSCI----MYGVEGDVRYTVPVLA---- 107
                    + +          G    GYN +        + G+E D++ +         
Sbjct: 58  QTHAYPGGASLNTTYLQPQGVIGGGQIGYNWQLGSFLGPMLLGLEADIQGSGASDGYTSL 117

Query: 108 ----DNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAG-----EITPIA 158
                N +      G++R R G     ++  Y T G  V     T   G     + +   
Sbjct: 118 NGLATNYNQKLDWFGTVRGRVGLVRGPAV-AYFTGGYAVGSVKTTVTEGGLVAFDNSKTR 176

Query: 159 IGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFYNT-----------ISLGVGMK 204
            G   G GVE   L  +   ++EY          F+                G+  +
Sbjct: 177 SGWVIGSGVE-AALGGNWTGKIEYLYLDLGNQTDFFGNQSLRTEVRESIFRAGLNYR 232


>gi|299773291|gb|ADJ38720.1| outer membrane protein P5 [Haemophilus parasuis]
          Length = 365

 Score = 78.3 bits (191), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 43/228 (18%), Positives = 83/228 (36%), Gaps = 31/228 (13%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATN-RYVPIRHDFNGPYAG 59
           M+K+F  +  + LA+AS   AQAA      + G +    T   +   +  ++  +  Y  
Sbjct: 1   MKKIFNCISSTGLAVASV--AQAAPQANTFYVGAKAGWATFHNDINQIDSKYANDARYDA 58

Query: 60  LSALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGS 119
            +  Y       A ++    +F GY + D+  +               +     H   G+
Sbjct: 59  TNLKYG-----IARNSVTYGVFGGYQIIDNLAVELGYDYFGRVRGNKQEFREFKHSAHGT 113

Query: 120 -LRIRGGYEVSDSLLLYATVGPD-----VAQKYETGKAGEITPIAIGGTAGVGVEVGGLS 173
            L ++  YEV + L +Y  VG         +   T +  +   +      G GVE   + 
Sbjct: 114 HLSLKPSYEVLNGLDVYGKVGAALVRNDYKRYSTTIEPVKSHNLKTSLIVGAGVEY-AIL 172

Query: 174 ESLVARLEYRAS----KYSKVEG------------FYNTISLGVGMKF 205
             L  R+EY+       ++K E               ++++ G+  +F
Sbjct: 173 PELAFRVEYQWLSNVGNFTKAEAKENRRATYNYSPDSHSVTAGISYRF 220


>gi|293395760|ref|ZP_06640042.1| outer membrane protein A [Serratia odorifera DSM 4582]
 gi|291421697|gb|EFE94944.1| outer membrane protein A [Serratia odorifera DSM 4582]
          Length = 352

 Score = 78.3 bits (191), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 38/213 (17%), Positives = 70/213 (32%), Gaps = 20/213 (9%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K  +A+ V  L   +   A AA           G     A   +     D +      
Sbjct: 1   MKKTLVALIV--LNACAVTPAFAA--------ADTGTWYGGAKLGWSH-YFDASADKDFS 49

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSL--HGIGG 118
             L + +  +    N  G +FAGY +     + G    +        + +        G 
Sbjct: 50  DNLDHATDFDFNKDNTTGGVFAGYQINSWLAVEGGYDYLGNMQINGNNGVAGAKLASQGL 109

Query: 119 SLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVA 178
            L ++  Y ++D+  LY   G    +              +   A VG E    +++   
Sbjct: 110 QLSMKASYGLTDNWDLYGRAGAMAYRAETEHAGHSAFETGVRPLAAVGTEY-AFNDNWAG 168

Query: 179 RLEYRA-SKYSKVE-----GFYNTISLGVGMKF 205
           R+EY+  S    V         ++++ GV  +F
Sbjct: 169 RVEYQWVSNVGNVNQIGVSADVSSLTAGVVYRF 201


>gi|240849916|ref|YP_002971305.1| hemin binding protein A [Bartonella grahamii as4aup]
 gi|240267039|gb|ACS50627.1| hemin binding protein A [Bartonella grahamii as4aup]
          Length = 288

 Score = 78.3 bits (191), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 40/252 (15%), Positives = 66/252 (26%), Gaps = 84/252 (33%)

Query: 37  VVPTIATNRYVPIRHDFNGPYAGLSALYNGSFGEEAHH----------------NAGGSI 80
              T            + G Y G          +E                      G I
Sbjct: 38  PRETAPAVISAAPSFSWTGFYIGGQVGNFSGKVDEFDSETKKKITDKDWTPKPSGFMGGI 97

Query: 81  FAGYNVEDSC-IMYGVEGDVRYTVPVLAD------------------------------- 108
           + G NV+    ++ GVE D  +     +                                
Sbjct: 98  YVGSNVDLGNGLILGVETDAVWADREDSKTHSAVIGETGLAAFKNKLTAAEATFASGKNI 157

Query: 109 -----------NIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYE---------- 147
                               G+ R+R G+   D +L Y   G    Q             
Sbjct: 158 DNVTKDGKRVEGTSIKEKWSGATRVRIGFAAVDRILPYFAGGIAYTQLQVVNSLKAEGAD 217

Query: 148 -----TGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYS---------KVEGF 193
                + K  + +   +G T G GV+   ++++++ R EYR S +          K+   
Sbjct: 218 GAEIASAKMFDQSKTMVGFTVGGGVDF-AMTDNVLLRAEYRYSDFGKKAFVKDEDKIAYK 276

Query: 194 YNTISLGVGMKF 205
            N   +GV  KF
Sbjct: 277 TNDFRVGVAYKF 288


>gi|157369997|ref|YP_001477986.1| outer membrane protein A [Serratia proteamaculans 568]
 gi|157321761|gb|ABV40858.1| OmpA domain protein transmembrane region-containing protein
           [Serratia proteamaculans 568]
          Length = 358

 Score = 78.3 bits (191), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 38/220 (17%), Positives = 63/220 (28%), Gaps = 33/220 (15%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K   A+ ++         AQAA                     Y   +  ++  +   
Sbjct: 1   MKKT--AIALAVALAGFATVAQAA---------------PKDNTWYTGAKLGWSQYHDTG 43

Query: 61  SALYNG----SFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGI 116
                       G       G   F GY              +       + N  +    
Sbjct: 44  FYGNGYQNGIGNGPTHKDQLGAGAFLGYQANQYLGFELGYDWLGRMPYKGSVNNGAFKAQ 103

Query: 117 GGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGE-----ITPIAIGGTAGVGVEVGG 171
           G  L  +  Y + D L +Y  +G  V +       G           +   A VGVE   
Sbjct: 104 GVQLAAKLSYPIMDDLDIYTRLGGMVWRADSKANYGNGTRLSDHDTGVSPLAAVGVEY-A 162

Query: 172 LSESLVARLEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
           L+++   RL+Y+          V    +   +SLGV  +F
Sbjct: 163 LTKNWATRLDYQFVSNIGDAGTVGARPDNTMLSLGVSYRF 202


>gi|12620578|gb|AAG60854.1|AF322012_159 ID352 [Bradyrhizobium japonicum]
          Length = 620

 Score = 77.9 bits (190), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 37/253 (14%), Positives = 70/253 (27%), Gaps = 52/253 (20%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+   L +G +++A+A+  ++ A +  R A               +V   +         
Sbjct: 57  MRSRVLFLGAATMAIATTGTSMA-NLGREALPPSVWNWSGGYIGGHVGGGYGRTSF--TN 113

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLAD------------ 108
                         +       GYN +++  +YG+E D    V   ++            
Sbjct: 114 PFGPPIYGDVVDIPSFVAGGQIGYNWQNNSWVYGLELDASAAVASGSNTCLAASDLIVSA 173

Query: 109 NIHSLHGIGGSLRIRGGYEVS--DSLLLYATVGPDVAQKYETGKAGEITPI--------- 157
           N ++   +  +   R GY        L Y   G                           
Sbjct: 174 NCNAAPNLFATGTGRIGYAFGSLGQTLAYLKAGAAWQNNRGDIVNNFEGGDLPQEKTHFD 233

Query: 158 --AIGGTAGVGVEVGGLSESLVARLEYRASKYS-----------------------KVEG 192
              +GG  G+GVE   L+ S    +EY    +                         +  
Sbjct: 234 YGQVGGVIGLGVEQ-ALTPSWSVNVEYDYLHFGGPSVATASTAKLSPSTILPASTTSLSS 292

Query: 193 FYNTISLGVGMKF 205
            Y+   +G+   F
Sbjct: 293 NYHIGKIGLNYHF 305


>gi|304414298|ref|ZP_07395666.1| outer membrane protein A [Candidatus Regiella insecticola LSR1]
 gi|304283512|gb|EFL91908.1| outer membrane protein A [Candidatus Regiella insecticola LSR1]
          Length = 389

 Score = 77.9 bits (190), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 37/214 (17%), Positives = 62/214 (28%), Gaps = 30/214 (14%)

Query: 6   LAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYA--GLSAL 63
            A+ ++         AQAA                     Y   +  ++G +        
Sbjct: 44  TAIALAVALAGFATLAQAA---------------PRDNTWYAGAKVGWSGYHDTLMNHTY 88

Query: 64  YNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGSLRIR 123
                G       G   F GY +     +                   +    G  L  +
Sbjct: 89  KGVGDGSTRKDQLGAGAFLGYQINQYLGLEMGYDWFGRMHYSGDVKNGAFKAHGVQLAAK 148

Query: 124 GGYEVSDSLLLYATVGPDVAQKYETGKAG------EITPIAIGGTAGVGVEVGGLSESLV 177
             Y V + L +Y  +G  + +   TG  G          I +   A VG+E   L+++ V
Sbjct: 149 LSYPVLEDLDVYTRLGGMLWRADSTGNLGDPRKKIRDYDIGVSPVAAVGLEY-ALTQNWV 207

Query: 178 ARLEYRAS-KYSK-----VEGFYNTISLGVGMKF 205
            RL+Y+                   +SLGV  +F
Sbjct: 208 TRLDYQFVNNMGDEATLGTRPDNTNLSLGVAYRF 241


>gi|238785957|ref|ZP_04629921.1| Outer membrane protein A [Yersinia bercovieri ATCC 43970]
 gi|238713147|gb|EEQ05195.1| Outer membrane protein A [Yersinia bercovieri ATCC 43970]
          Length = 350

 Score = 77.9 bits (190), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 35/215 (16%), Positives = 62/215 (28%), Gaps = 30/215 (13%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K   A+ ++         AQAA                     Y   +  ++      
Sbjct: 1   MKKT--AIALAVALAGFATVAQAA---------------PKDNTWYTGGKLGWSQFQDTG 43

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGSL 120
           S     + G       G   F GY              +         N  +    G  L
Sbjct: 44  SI--IENDGPTHKDQVGAGAFLGYQANQYLGFEMGYDWLGRMPYKGDTNNGAFKAQGVQL 101

Query: 121 RIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEI----TPIAIGGTAGVGVEVGGLSESL 176
             +  Y V+  L +Y  +G  V +   TG             +     +G E    +++ 
Sbjct: 102 AAKLSYPVAQDLDVYTRLGGMVWRADATGSINGDRTSGHDTGVSPLVALGAEY-AWTKNW 160

Query: 177 VARLEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
             R+EY+        + V    +   +S+GV  +F
Sbjct: 161 ATRMEYQWVNNIGDRATVGARPDNGMLSVGVSYRF 195


>gi|260466904|ref|ZP_05813087.1| porin [Mesorhizobium opportunistum WSM2075]
 gi|259029300|gb|EEW30593.1| porin [Mesorhizobium opportunistum WSM2075]
          Length = 238

 Score = 77.9 bits (190), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 39/222 (17%), Positives = 71/222 (31%), Gaps = 27/222 (12%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+ + LA+ V    +     A AAD                                   
Sbjct: 1   MKTILLAMAV----ITPVGMASAADTNVVLPGDTTYNWSGAYIGAQAGYAWANARVGQTF 56

Query: 61  SAL-YNGSFGEEAHHNAGGSIFAGYNVEDSC-IMYGVEGDVRYTVPVLADNIHS------ 112
           +   ++            G ++AG N +    ++ G+E D  +       +  +      
Sbjct: 57  APGSFDDYGWGYNPSGGFGGLYAGVNHQFDSGLVLGIEADYSFAGVKDTTHYRALGVDDP 116

Query: 113 ------LHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYE-------TGKAGEITPIAI 159
                      GSLR+R GY V D  L + T G  VA           +    ++     
Sbjct: 117 AFGGELKLDTVGSLRLRAGYAV-DRWLPFVTGGLAVASYKHTTVNLPGSTPYADVKGTVA 175

Query: 160 GGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFYNTISLGV 201
           G T G G E   ++++ + R EYR + + +     +++  G 
Sbjct: 176 GYTLGAGAEY-AVTDNWLVRGEYRFADFGRHTSVRHSLVNGA 216


>gi|91977226|ref|YP_569885.1| putative outer membrane protein [Rhodopseudomonas palustris BisB5]
 gi|91683682|gb|ABE39984.1| putative outer membrane protein [Rhodopseudomonas palustris BisB5]
          Length = 241

 Score = 77.9 bits (190), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 33/190 (17%), Positives = 58/190 (30%), Gaps = 31/190 (16%)

Query: 39  PTIATNRYVPIRHDFNGPYAGLSALYNGSF--------------GEEAHHNAGGSIFAGY 84
           P       +   +D++G Y G +  +  S               G      A      GY
Sbjct: 28  PYAKAPPIIAAVYDWSGFYIGANGGWGTSRKSWDFYTVGGLAAEGSHDASGATAGGQIGY 87

Query: 85  NVEDSCIMYGVEGDVRYTVPVLAD--------NIHSLHGIGGSLRIRGGYEVSDSLLLYA 136
           N +    ++G+E    +     ++        +  S     G    R GY  +++LL YA
Sbjct: 88  NWQAGSWVFGLEAQGNWADFKGSNVTLLGGLFDNQSRIDAFGLFTGRVGYAWNNALL-YA 146

Query: 137 TVGPDVAQKYET-------GKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSK 189
             G  V                G  +    G   G G E G  + +    +EY      K
Sbjct: 147 KGGAAVVNDKYDFIRRADGFVTGTASETRWGAAVGAGFEYGF-TPNWSFAVEYDHLFLDK 205

Query: 190 VEGFYNTISL 199
            +  +   ++
Sbjct: 206 KDVTFTNTAV 215


>gi|50120684|ref|YP_049851.1| outer membrane protein A [Pectobacterium atrosepticum SCRI1043]
 gi|49611210|emb|CAG74656.1| outer-membrane protein A [Pectobacterium atrosepticum SCRI1043]
          Length = 366

 Score = 77.9 bits (190), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 35/229 (15%), Positives = 65/229 (28%), Gaps = 45/229 (19%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K   A+ V+    +    AQAA                     Y   +   +  +   
Sbjct: 1   MKKT--AIAVAVALASFATIAQAA---------------PKDNTWYTGGKLGVSQFHDTG 43

Query: 61  SAL--YNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGG 118
                Y G          G   F GY    +    G E    +   +      + +    
Sbjct: 44  FYGNGYTGVNNNPIKSKLGAGAFVGYQ---ANPYLGFELGYDWLGRMKYAGSTASNDDSA 100

Query: 119 SLR-------IRGGYEVSDSLLLYATVGPDVAQKYE---------TGKAGEITPIAIGGT 162
           S +        +  Y V   L +Y  +G  V +            T          +   
Sbjct: 101 SFKAQGIQLAAKLSYPVMPDLDVYTRLGGMVWRADSHAATSVNTGTRADINNDDTGVSPL 160

Query: 163 AGVGVEVGGLSESLVARLEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
           A +GVE   + ++   R++Y+          V    +   +S+G+  +F
Sbjct: 161 AAIGVEY-AIDKNWATRVDYQWVSNIGDAGTVGARPDNLLMSVGLSYRF 208


>gi|284007554|emb|CBA73076.1| outer membrane protein A [Arsenophonus nasoniae]
          Length = 353

 Score = 77.9 bits (190), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 33/218 (15%), Positives = 59/218 (27%), Gaps = 33/218 (15%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K+ +                    V  A               Y   +  ++      
Sbjct: 7   MKKIAI-------------------AVAVAAFATAAQAAPKDNTWYTGAKLGWSHFEDTG 47

Query: 61  --SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGG 118
                 N   G+      G   + GY                        N  SL  +G 
Sbjct: 48  FHPYGDNVGSGKTKRDQLGAGAYLGYQHNQYLGFELGYDWFGRMRYSGQPNNGSLKSMGV 107

Query: 119 SLRIRGGYEVSDSLLLYATVGPDVAQKY-----ETGKAGEITPIAIGGTAGVGVEVGGLS 173
            L  R  Y ++D L +Y  +G  V +       E   + +     +     +G E   ++
Sbjct: 108 QLTARLSYPLTDELDVYTRLGGMVWRTDAKANVENQPSFKEHDTGVSPVYALGFEY-AIT 166

Query: 174 ESLVARLEYRA-SKYSKVEG-----FYNTISLGVGMKF 205
                RL+Y+  S     +          +S+GV  +F
Sbjct: 167 PEWATRLDYQWVSHIGDKDSLSVRPDNGMLSVGVAYRF 204


>gi|19881369|gb|AAM00927.1|AF491819_1 hemagglutinin antigen [Avibacterium paragallinarum]
          Length = 344

 Score = 77.9 bits (190), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 36/224 (16%), Positives = 73/224 (32%), Gaps = 36/224 (16%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAG- 59
           M+K   A+ ++   L +   AQAA                 A   Y   +  +   + G 
Sbjct: 1   MKKT--AIALAIAGLTAASVAQAA---------------PQANTFYAGAKAGWASFHDGL 43

Query: 60  LSALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGS 119
                + +      ++    +F GY + D+  +     D               +   G+
Sbjct: 44  NQFENSQNADGTLRNSVTYGVFGGYQITDNFAVELGYDDFGRAKRRQGGETVIKYTNHGA 103

Query: 120 -LRIRGGYEVSDSLLLYATVGPDVAQKYET------GKAGEITPIAIGGTAGVGVEVGGL 172
            L ++  Y V + L +YA VG  + +                  + +      G+E    
Sbjct: 104 HLSLKASYPVLEGLDVYARVGAALIRSDYKPTKRAAPNQTHEHSLKVSPVFAGGLEYNLP 163

Query: 173 S-ESLVARLEYRAS--------KYSKVEGFYN--TISLGVGMKF 205
           S   L  R+EY+            S+V+   +  +++ G+  +F
Sbjct: 164 SLPELALRVEYQWVNKVGRVEKDGSRVDYTPSIGSVTAGLSYRF 207


>gi|300024536|ref|YP_003757147.1| porin [Hyphomicrobium denitrificans ATCC 51888]
 gi|299526357|gb|ADJ24826.1| porin [Hyphomicrobium denitrificans ATCC 51888]
          Length = 232

 Score = 77.9 bits (190), Expect = 9e-13,   Method: Composition-based stats.
 Identities = 49/242 (20%), Positives = 78/242 (32%), Gaps = 47/242 (19%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M +  LA+     ALA+     A +P     + G  V              D+      +
Sbjct: 1   MSRSLLAMT---FALAAATPVLAGEPSWTGPYIGAHVGGAWGNASTTDDPRDWGNDPKFI 57

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLH------ 114
                    ++        + AGYNV+ S I+ GVEGD+ Y     A +  S        
Sbjct: 58  ------GPFDQNPVGVIAGLTAGYNVQLSNIVLGVEGDIGYLGLDSALDTPSSQSGNHQS 111

Query: 115 -----GIGGSLRIRGGYEVSDSLLLYATVGPDVAQKY------ETGKAGEITPIAIGGTA 163
                GI G++  R G+  + S L+Y   G               G     T    G  A
Sbjct: 112 IVLDSGIYGAVTARAGFLATPSTLVYGKGGFAFYNGDATQSTTADGYVFHGTGTFTGWVA 171

Query: 164 GVGVEVGGLSESLVARLEYRASKYS--------------------KVEGFYNTISLGVGM 203
           G G+E   L+++L  ++EY    +                           +T+  G+  
Sbjct: 172 GGGIEQ-RLTDNLSIKVEYLHFDFGSQAGDQTSISDPPVGHVYGNSTRIDADTVKAGLNY 230

Query: 204 KF 205
            F
Sbjct: 231 HF 232


>gi|17987000|ref|NP_539634.1| 22 kDa outer membrane protein precursor [Brucella melitensis bv. 1
           str. 16M]
 gi|17982651|gb|AAL51898.1| 22 kDa outer membrane protein precursor [Brucella melitensis bv. 1
           str. 16M]
          Length = 185

 Score = 77.9 bits (190), Expect = 9e-13,   Method: Composition-based stats.
 Identities = 38/182 (20%), Positives = 65/182 (35%), Gaps = 18/182 (9%)

Query: 40  TIATNRYVPIRHDFNGPYAGLSALYNGSFGEE---AHHNAGGSIFAGYNVEDSCIMYGVE 96
               +      HD++G Y G     + S       +   A G I  G N+++  I++G E
Sbjct: 6   YTYNDPVAAGPHDWSGNYVGAQVGGSSSKFPSPFASRTGALGGIVVGKNMQNGNIVFGAE 65

Query: 97  GDVRYTVP--VLADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEI 154
            +  +      +           G+ + + GY   D  L+Y T G  V +          
Sbjct: 66  LEGNFAEAEHRIGHGGTLQQSWNGNAKGKVGYTF-DKTLVYGTAGYGVTRFKAKDNTTSA 124

Query: 155 TPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEG-----------FYNTISLGVGM 203
           +    G   G GVE   LS  L  + EY   +++ V+              ++I  G+  
Sbjct: 125 SGCEGGVLIGAGVEQ-ALSGPLSVKAEYDFQRFNDVKSQVNGIEQRNNLKNHSIKAGLNY 183

Query: 204 KF 205
           KF
Sbjct: 184 KF 185


>gi|148255740|ref|YP_001240325.1| putative outer-membrane protein [Bradyrhizobium sp. BTAi1]
 gi|146407913|gb|ABQ36419.1| putative outer-membrane protein, putative secreted protein
           [Bradyrhizobium sp. BTAi1]
          Length = 212

 Score = 77.5 bits (189), Expect = 9e-13,   Method: Composition-based stats.
 Identities = 42/188 (22%), Positives = 59/188 (31%), Gaps = 23/188 (12%)

Query: 39  PTIATNRYVPIRHDFNGPYAGLSALYNGSFGEEAH-HNAGGSIFAGYNVEDSCIMYGVEG 97
           PT      +     + G Y G    Y       A           GYN +   +++G+E 
Sbjct: 27  PTYTKAPVLAPVQTWTGFYIGAFGGYANEDASTAALKGGFAGGTVGYNWQQGPLVFGLEA 86

Query: 98  DVRYTVPVLADNI------HSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYET--- 148
           D  +        I             G++R R GY   D++LLY T G        +   
Sbjct: 87  DAAWADINATVGIPGVFGLTDRIESTGTVRGRIGYAF-DTVLLYGTGGYAWGNNKLSATV 145

Query: 149 -GKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGF----------YNTI 197
            G AG  T    G  AG GVE    +     + EY          F           +T 
Sbjct: 146 GGVAGSETKFLSGWAAGAGVE-WMFAPKWSLKGEYLYKSLESSTYFGGAVPLGTLNLHTF 204

Query: 198 SLGVGMKF 205
            +GV   F
Sbjct: 205 QVGVNYHF 212


>gi|90025228|gb|ABD85117.1| OmpA [Actinobacillus suis H91-0380]
          Length = 373

 Score = 77.5 bits (189), Expect = 9e-13,   Method: Composition-based stats.
 Identities = 43/236 (18%), Positives = 79/236 (33%), Gaps = 39/236 (16%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNR-YVPIRHDFNGPYAG 59
           M+K  +A+ VS LALAS   AQAA     A+ G +    +          ++  +  Y  
Sbjct: 1   MKKTVIALAVSGLALASV--AQAAPQQNTAYAGAKVGWASFHEGVRQFNDKYSNDARYNS 58

Query: 60  LSALYNGSFGEEAHHNAGGSIFAGYNV-EDSCIMYGVEGDVRYTVPVLADNIHSLH---- 114
            +  Y         ++    +F GY +   +      E    Y   V  +          
Sbjct: 59  DTTAYG-----INRNSVTYGVFGGYQILNQNNFGLAAELGYDYYGRVRGNVGDFREFKHS 113

Query: 115 GIGGSLRIRGGYEVSDSLLLYATVGPD--------VAQKYETGKAGEITPIAIGGTAGVG 166
             G +  ++  YEV  +L +Y  VG             +       +   +      G G
Sbjct: 114 AHGLNFALKPSYEVLPNLDVYGKVGVAVVRNDYKFYGAENTNEPTEKFHKLKASTILGAG 173

Query: 167 VEVGGLSESLVARLEYRA-----------SKYSKVEGFY------NTISLGVGMKF 205
           VE   +   L AR+EY+             +    +  +      ++++ G+  +F
Sbjct: 174 VEY-AILPELAARIEYQYLNKAGNFNKALVRSGTQDVDFQYAPDIHSVTAGLSYRF 228


>gi|238795889|ref|ZP_04639402.1| Outer membrane protein A [Yersinia mollaretii ATCC 43969]
 gi|238720352|gb|EEQ12155.1| Outer membrane protein A [Yersinia mollaretii ATCC 43969]
          Length = 350

 Score = 77.5 bits (189), Expect = 9e-13,   Method: Composition-based stats.
 Identities = 34/215 (15%), Positives = 61/215 (28%), Gaps = 30/215 (13%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K   A+ ++         AQAA                     Y   +  ++      
Sbjct: 1   MKKT--AIALAVALAGFATVAQAA---------------PKDNTWYTGGKLGWSQFQDTG 43

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGSL 120
           S     + G       G   F GY              +         N  +    G  L
Sbjct: 44  SI--INNDGPTHKDQIGAGAFLGYQANQYLGFEMGYDWLGRMPYKGDTNNGAFKAQGVQL 101

Query: 121 RIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEI----TPIAIGGTAGVGVEVGGLSESL 176
             +  Y V+  L +Y  +G  V +    G             +     +G E    +++ 
Sbjct: 102 AAKLSYPVAQDLDVYTRLGGMVWRADTDGSIDGQRYSAHDTGVSPLVALGAEY-AWTKNW 160

Query: 177 VARLEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
             R+EY+        + V    +   +S+GV  +F
Sbjct: 161 ATRMEYQWVSNIGDKATVGARPDNGMLSVGVSYRF 195


>gi|218508536|ref|ZP_03506414.1| outer membrane protein [Rhizobium etli Brasil 5]
          Length = 144

 Score = 77.5 bits (189), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 42/151 (27%), Positives = 66/151 (43%), Gaps = 10/151 (6%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+ L   +  S+ A+A    AQAAD V +           +          ++ G Y G 
Sbjct: 1   MRVLIAGLMASAFAIAGVSVAQAADAVDQVPEAPVAQDAPVKPAG------NWEGFYLGG 54

Query: 61  SALYNGSFGEEAHH--NAGGSIFAGYNVEDSCIMYGVEGDVRYTVPV-LADNIHSLHGIG 117
           +  YN        H    GG +F GYN +   I+YGVE D+ Y+     +  + + +G  
Sbjct: 55  AGTYNMGDFGSDRHTYGFGGQVFTGYNWQQGQIVYGVESDLGYSGDDVSSGGVKNKYGWN 114

Query: 118 GSLRIRGGYEVSDSLLLYATVGPDVAQKYET 148
           GS+R R GY+++   LLY T G  +     +
Sbjct: 115 GSVRGRVGYDMNP-FLLYGTAGLALGNIKVS 144


>gi|37498966|gb|AAQ86765.2| hemagglutinin antigen [Avibacterium paragallinarum]
 gi|48249488|gb|AAT40990.1| hemagglutinin antigen [Avibacterium paragallinarum]
          Length = 345

 Score = 77.5 bits (189), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 37/225 (16%), Positives = 73/225 (32%), Gaps = 37/225 (16%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAG- 59
           M+K   A+ ++   L +   AQAA                 A   Y   +  +   + G 
Sbjct: 1   MKKT--AIALAIAGLTAASVAQAA---------------PQANTFYAGAKAGWASFHDGL 43

Query: 60  LSALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGS 119
                + +      ++    +F GY + D+  +     D               H   G+
Sbjct: 44  NQFENSQNAYGTLRNSVTYGVFGGYQITDNFAVELGYDDFGRAKLRKGGETVIKHTNHGA 103

Query: 120 -LRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPI-------AIGGTAGVGVEVGG 171
            L ++  Y V + L +YA VG  + +          +          +      G+E   
Sbjct: 104 HLSLKASYPVLEGLDVYARVGAALIRSDYKSTKRAESDYVMHEHSLKVSPVFAGGLEYNL 163

Query: 172 LS-ESLVARLEYRAS--------KYSKVEGFYN--TISLGVGMKF 205
            S   L  R+EY+            S+V+   +  +++ G+  +F
Sbjct: 164 PSLPELALRVEYQWVNKVGRVEKDGSRVDYTPSIGSVTAGLSYRF 208


>gi|110633591|ref|YP_673799.1| outer membrane protein, 31 kDa [Mesorhizobium sp. BNC1]
 gi|110284575|gb|ABG62634.1| outer membrane protein, 31 kDa [Chelativorans sp. BNC1]
          Length = 234

 Score = 77.5 bits (189), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 35/202 (17%), Positives = 57/202 (28%), Gaps = 25/202 (12%)

Query: 18  FCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGS--------FG 69
             SA AAD V               +  +  +     G  +     Y             
Sbjct: 14  SGSAFAADAVYGDVPAAPVAEVAAESFDWTGLYLGAFGGVSTGDFKYEAGPTGGDPLGGI 73

Query: 70  EEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYT----------VPVLADNIHSLHGIGGS 119
           + +     G    GY+ +    + G   D+  T              +    S     G+
Sbjct: 74  DISGGGFIGGAQVGYDWQIGNWVIGGVADIAATNHDADISADIDGFGSAEAESKLKYLGT 133

Query: 120 LRIRGGYEVSDSLLLYATVGPDVAQKYETGKAG-----EITPIAIGGTAGVGVEVGGLSE 174
           +R R GY   D  L+Y   G    +  +    G       +    G TAG GVE   ++ 
Sbjct: 134 VRARAGYSF-DRTLVYGHGGFAYGETEQKIDLGGTELFNESQGRTGWTAGAGVEF-AVTN 191

Query: 175 SLVARLEYRASKYSKVEGFYNT 196
            +    EY      +   F + 
Sbjct: 192 RISVGTEYSYVDLGEERVFEDA 213


>gi|312115597|ref|YP_004013193.1| hypothetical protein Rvan_2888 [Rhodomicrobium vannielii ATCC
           17100]
 gi|311220726|gb|ADP72094.1| hypothetical protein Rvan_2888 [Rhodomicrobium vannielii ATCC
           17100]
          Length = 254

 Score = 77.5 bits (189), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 37/214 (17%), Positives = 63/214 (29%), Gaps = 22/214 (10%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M K  +A    +  LA   SA A D   +  +    VV    T     +     G     
Sbjct: 1   MNKTLIATASVAALLAMGGSALAGDLYAKGGYKDAPVVVAEPTWTGFHLGLGVGGAAVNH 60

Query: 61  SALYN------------GSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLAD 108
                                  +     G++  GY+ +    + G+  +  +   +  D
Sbjct: 61  EIDAGLYDVRSGESKSIAGIDGISGTGVFGTVEVGYDRQYGNFVGGIFFNYDFGDDISTD 120

Query: 109 N-------IHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEI--TPIAI 159
                            ++  R GY V+ S L Y   G   +    +             
Sbjct: 121 VSLLGHDLASVKQTDSWTVGGRLGYLVNASTLAYVLGGYTESTFELSVPVANFSTDDTFS 180

Query: 160 GGTAGVGVEVGGLSESLVARLEYRASKYSKVEGF 193
           G T G G+E   L+ SL  + EYR +++      
Sbjct: 181 GWTVGGGLET-KLTSSLSLKGEYRYTEFDTNTYK 213


>gi|289809683|ref|ZP_06540312.1| outer membrane protein A [Salmonella enterica subsp. enterica
           serovar Typhi str. AG3]
          Length = 264

 Score = 77.5 bits (189), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 27/174 (15%), Positives = 58/174 (33%), Gaps = 15/174 (8%)

Query: 43  TNRYVPIRHDFNGPYAGLSALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYT 102
              Y   +  ++  +      +  + G    +  G   F GY V            +   
Sbjct: 2   NTWYAGAKLGWSQYHDT---GFIHNDGPTHENQLGAGAFGGYQVNPYVGFEMGYDWLGRM 58

Query: 103 VPVLADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYET-----GKAGEITPI 157
                +   +    G  L  + GY ++D L +Y  +G  V +         G + +    
Sbjct: 59  PYKGDNTNGAYKAQGVQLTAKLGYPITDDLDVYTRLGGMVWRADTKSNVPGGASTKDHDT 118

Query: 158 AIGGTAGVGVEVGGLSESLVARLEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
            +      G+E   ++  +  RLEY+ +      + +    +   +S+GV  +F
Sbjct: 119 GVSPVFAGGIEY-AITPEIATRLEYQWTNNIGDANTIGTRPDNGLLSVGVSYRF 171


>gi|91977701|ref|YP_570360.1| putative outer membrane protein [Rhodopseudomonas palustris BisB5]
 gi|91684157|gb|ABE40459.1| putative outer membrane protein [Rhodopseudomonas palustris BisB5]
          Length = 237

 Score = 77.5 bits (189), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 42/238 (17%), Positives = 73/238 (30%), Gaps = 44/238 (18%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K  L+   ++   A    A AAD   R +     V           + +++ G Y G 
Sbjct: 1   MKKYLLS---AAAVFALTAPAFAADLGPRTYTKAPPVYTPP------EVVYNWTGFYIGG 51

Query: 61  SALYNGSFGEEAHHNAG---GSIFAGYNVED-SCIMYGVEGDVRYTVPVLA-------DN 109
           +     +       +AG   G +  G++ +     + G+E    +               
Sbjct: 52  NVGGAFAGSNNIQSDAGRFMGGVQGGFDYQFAPNWVVGLEAQYSWMASNNTGVLFPLGSV 111

Query: 110 IHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYE--------TGKAGEITPIAIGG 161
                   GS+  R GY    +LL YA  G                            G 
Sbjct: 112 ATENTRGLGSVTGRLGYSWGPALL-YAKGGYAFRDSSLGVNTAAGVQSAYTTSGNRNDGY 170

Query: 162 TAGVGVEVGGLSESLVARLEYRASKYSKV--------------EGFYNTISLGVGMKF 205
           T G G+E    + S  A++EY+  K+                     +T+  G+  +F
Sbjct: 171 TVGAGLEY-MFAPSWSAKVEYQYYKFDNTSFTGGPADVVGTTFRNDDHTVKAGINYRF 227


>gi|260460749|ref|ZP_05808999.1| outer membrane protein [Mesorhizobium opportunistum WSM2075]
 gi|259033326|gb|EEW34587.1| outer membrane protein [Mesorhizobium opportunistum WSM2075]
          Length = 221

 Score = 77.5 bits (189), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 45/222 (20%), Positives = 73/222 (32%), Gaps = 26/222 (11%)

Query: 6   LAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYN 65
           L V  + L  A    A AADP         G   T      +   + +       +    
Sbjct: 4   LIVASAGLLAALSVPALAADPTVDVPMTAPGFDWTGYYAG-MQAGYGWGQSDISGTGGGP 62

Query: 66  GSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLA------DNIHSLHGIGGS 119
            S   +      G   AG   +    + G E D+ Y+           + + +     GS
Sbjct: 63  FSVSPDIGGGFVGGHVAG-LWQFDQAVIGAEADLNYSSVDGTADLGAGNTLGTDVKWFGS 121

Query: 120 LRIRGGYEVSDSLLLYATVGPDVAQKYETGKAG---EITPIAIGGTAGVGVEVGGLSESL 176
           +  + GY V D +L+Y   G   A    +  AG     T   +G T G GV+   L++  
Sbjct: 122 VNAKAGYAV-DRVLVYGIGGVAFAGIETSQSAGAAFSETRTNVGWTVGAGVDY-ALTDKF 179

Query: 177 VARLEYRASKYS-------------KVEGFYNTISLGVGMKF 205
           V   +YR   +                +   NT+ + +  KF
Sbjct: 180 VVGAQYRYYDFGSEHFDGSNGFADRDQDTKLNTVGVNLSYKF 221


>gi|46397593|gb|AAS91729.1| OmpA [Bibersteinia trehalosi]
          Length = 364

 Score = 77.5 bits (189), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 45/229 (19%), Positives = 82/229 (35%), Gaps = 33/229 (14%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNR-YVPIRHDFNGPYAG 59
           M+K  +A+ V+  A+A   SA AA      + G +    T   +      ++  +  YAG
Sbjct: 1   MKKSLVALAVAGFAVA---SANAAPEANSFYVGAKAGWATFHNDVNQFNSKYALDERYAG 57

Query: 60  LSALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTV----PVLADNIHSLHG 115
               Y         ++    +F GY + D+  +                   D+    H 
Sbjct: 58  GPTAYG-----INRNSVTYGVFGGYQIIDNLAVELGYDYFGRVRGNVQVDEQDSKAVKHT 112

Query: 116 IGGS-LRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPI--AIGGTAGVGVEVGGL 172
             G+ L ++  YEV   L +Y  VG  + +        +            G G+E   +
Sbjct: 113 AHGTHLSLKPSYEVVSGLDVYGKVGAALVRNDYKNYVDQEKSHNLKTSLLLGAGLEY-AI 171

Query: 173 SESLVARLEYRAS----KYSKVEG------------FYNTISLGVGMKF 205
           + +L ARLEY+       ++K E               +++S G+  +F
Sbjct: 172 TPALAARLEYQWLSNVGNFNKAESKENRLRNVTYRPDIHSVSAGLVYRF 220


>gi|17861366|gb|AAK61593.1| OmpA [Pasteurella multocida]
          Length = 348

 Score = 77.1 bits (188), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 38/231 (16%), Positives = 73/231 (31%), Gaps = 44/231 (19%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAG- 59
           M+K   A+ ++ +ALA    AQAA                     YV  +  +   + G 
Sbjct: 1   MKKT--AIALTIVALAVASVAQAA---------------PQPNTFYVGAKAGWASFHDGL 43

Query: 60  LSALY-NGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGG 118
               Y + +      ++    +F GY + D+  +     D             +      
Sbjct: 44  NQIEYVSKTSFGSKRNSVTYGVFGGYQITDNFAVELGYDDFGRAKVRANSKTTAFDAAKH 103

Query: 119 S-----LRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITP--------IAIGGTAGV 165
           +     L ++  Y + D L +YA VG  + +      A  I            +      
Sbjct: 104 TNHGTHLSLKASYPLLDGLDVYARVGAALIRSDYKLYAPLINKRLSPHFKITQVSPVFAG 163

Query: 166 GVEVGGLSESLVARLEYRASK-----------YSKVEGFYNTISLGVGMKF 205
           G+E   +   L  R+EY+              Y+       +++ G+  +F
Sbjct: 164 GLEYAFI-PELTLRVEYQWVNNVCKFEYADGQYADFRPDIGSVTAGLSYRF 213


>gi|170750202|ref|YP_001756462.1| carbohydrate-selective porin OprB [Methylobacterium radiotolerans
           JCM 2831]
 gi|170656724|gb|ACB25779.1| Carbohydrate-selective porin OprB [Methylobacterium radiotolerans
           JCM 2831]
          Length = 708

 Score = 77.1 bits (188), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 43/230 (18%), Positives = 69/230 (30%), Gaps = 47/230 (20%)

Query: 6   LAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALY- 64
            A  V +  L +  +A+AAD                 +  YV +     G Y   S    
Sbjct: 11  TAALVLTAPLLAPVAARAADLFAPRPTAQAPAYTD-WSGGYVGLEGSAGGSYGAYSFGPT 69

Query: 65  ----------------NGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVL-- 106
                             S   +    A G +F G+N +    +YG+E  +         
Sbjct: 70  TIGGRPVPPFKSGDSTGRSDQGKNATTATGGLFGGWNWQAGPWVYGIEASLDAANLKRPV 129

Query: 107 ---------------ADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYE---- 147
                           + + +   + G+LR R GY   D  L+Y T G   A        
Sbjct: 130 PSTIAGFGYADTTPAFNIVRAKTDLYGALRARLGYSF-DRYLIYGTFGLAGANARILANY 188

Query: 148 ------TGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVE 191
                    A       +G T G GV+   +++SL   ++YR        
Sbjct: 189 PDLDAGGQTAARRDLDYVGFTLGAGVQY-AITDSLALGIDYRYIDLGGSR 237


>gi|90577944|ref|ZP_01233755.1| hypothetical outer membrane protein OmpA [Vibrio angustum S14]
 gi|90441030|gb|EAS66210.1| hypothetical outer membrane protein OmpA [Vibrio angustum S14]
          Length = 352

 Score = 77.1 bits (188), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 35/190 (18%), Positives = 60/190 (31%), Gaps = 19/190 (10%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M K   A+   +L ++   +A   +P       G        +  Y              
Sbjct: 1   MSKARFAILPLALLISGAVNAATVNPFYAGVRAGGVHYSDFDSKNYANGT---------- 50

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSL--HGIGG 118
              Y          +    +F GYNV     + G    +        ++  S        
Sbjct: 51  ---YGSGAEGVDRDDFAAGVFMGYNVTPWFAIEGGYTWLGEVTSKYDEHHDSGKIEQQAI 107

Query: 119 SLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGE---ITPIAIGGTAGVGVEVGGLSES 175
            L  +  Y+ +D + LY  VG         G  G+       ++  TAG+G E    +++
Sbjct: 108 DLVGKFTYQATDKVDLYTKVGGAWQFTRAKGLPGQTATDRDDSLIATAGLGAEYHF-TDN 166

Query: 176 LVARLEYRAS 185
           L AR EY+  
Sbjct: 167 LSARAEYQYY 176


>gi|238757655|ref|ZP_04618839.1| Outer membrane protein A [Yersinia aldovae ATCC 35236]
 gi|238704160|gb|EEP96693.1| Outer membrane protein A [Yersinia aldovae ATCC 35236]
          Length = 350

 Score = 77.1 bits (188), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 35/215 (16%), Positives = 62/215 (28%), Gaps = 30/215 (13%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K   A+ ++         AQAA                     Y   +  ++      
Sbjct: 1   MKKT--AIALAVALAGFATVAQAA---------------PKDNTWYTGGKLGWSQYQNSG 43

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGSL 120
           S     + G       G   F GY              +         N  +    G  L
Sbjct: 44  SI--INNDGPTHKDQLGAGAFLGYQANQYLGFEMGYDWLGRMPYKGDTNNGAFKAQGVQL 101

Query: 121 RIRGGYEVSDSLLLYATVGPDVAQKYETGKAG----EITPIAIGGTAGVGVEVGGLSESL 176
             +  Y V+  L +Y  +G  V +    G  G          +     +G E    +++ 
Sbjct: 102 AAKLSYPVAQDLDVYTRLGGMVWRADADGSIGGVRNSNHDTGVSPLVALGAEY-AWTKNW 160

Query: 177 VARLEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
             R+EY+        + V    +   +S+GV  +F
Sbjct: 161 ATRMEYQWINNIGDRATVGARPDNGMLSVGVSYRF 195


>gi|46397588|gb|AAS91725.1| OmpA [Bibersteinia trehalosi]
          Length = 364

 Score = 77.1 bits (188), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 45/228 (19%), Positives = 76/228 (33%), Gaps = 32/228 (14%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNR-YVPIRHDFNGPYAG 59
           M+K  +A+ V+  A+A   SA AA      + G +    T          ++  +  Y+ 
Sbjct: 1   MKKSLVALAVAGFAVA---SANAAPEANSFYVGAKAGWATFHHGVNQFNSKYANDERYSD 57

Query: 60  LSALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYT-VPVLADNIHSLHGIGG 118
               Y         ++    +F GY + D+  +             V           G 
Sbjct: 58  GPTAYG-----INRNSVTYGVFGGYQIIDNLAVELGYDYFGRVRGNVGDRRAFKDTKHGA 112

Query: 119 SLRIRGGYEVSDSLLLYATVGPD-----VAQKYETGKAGEITPIAIGGTAGVGVEVGGLS 173
            + ++  YEV   L LY  VG           Y  G   +   +      G GVE   ++
Sbjct: 113 HISLKPSYEVVSGLDLYGKVGAALVRNDYKDYYANGTKDKSHNLKTSLILGAGVEY-AIT 171

Query: 174 ESLVARLEYRAS----KYSKVEG------------FYNTISLGVGMKF 205
            +L  RLEY+       Y K E               +++S G+  +F
Sbjct: 172 PALAVRLEYQWLSRAGNYGKAEAKAGNVTDLRYSPDAHSVSAGLTYRF 219


>gi|316933367|ref|YP_004108349.1| OmpA-like transmembrane region [Rhodopseudomonas palustris DX-1]
 gi|315601081|gb|ADU43616.1| OmpA-like transmembrane region [Rhodopseudomonas palustris DX-1]
          Length = 240

 Score = 77.1 bits (188), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 36/238 (15%), Positives = 67/238 (28%), Gaps = 41/238 (17%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M  +   +  ++  +A    A AAD   R +                 + +++ G Y G 
Sbjct: 1   MTTMKNTLLGAAAVIALSAPAFAADLPPRPYTKAAPAYTAP------QVVYNWTGFYVGG 54

Query: 61  SALYNGSFGE---EAHHNAGGSIFAGYNVEDS-CIMYGVEGDVRYTVPV-------LADN 109
                 +             G +  G + + +   + G+E    +               
Sbjct: 55  HVGGAWAGDNSIPGNSGRFFGGVQGGADYQFATNWVIGIEAQYSWMSSNNTGVIFPGGST 114

Query: 110 IHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYET--------GKAGEITPIAIGG 161
                   GS+  R GY    + L+YA  G                            G 
Sbjct: 115 AVEDTRGLGSVTGRLGYAWGPT-LVYAKGGYAWRDSDLGVATAAGFPAAYTTSGSRNDGY 173

Query: 162 TAGVGVEVGGLSESLVARLEYRASKYSKV--------------EGFYNTISLGVGMKF 205
           T G G+E    + S  A++EY+  K+                     +T+  G+  +F
Sbjct: 174 TVGAGLEY-LFAPSWSAKVEYQYYKFGDTTFTGGPADVVGTSFRNDEHTVKAGINYRF 230


>gi|115526777|ref|YP_783688.1| OmpA domain-containing protein [Rhodopseudomonas palustris BisA53]
 gi|115520724|gb|ABJ08708.1| OmpA domain protein transmembrane region-containing protein
           [Rhodopseudomonas palustris BisA53]
          Length = 228

 Score = 77.1 bits (188), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 35/199 (17%), Positives = 60/199 (30%), Gaps = 20/199 (10%)

Query: 25  DPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSFGEEAHHNAGGSIFAGY 84
           D   R +       P    N          G                      G +  GY
Sbjct: 22  DLGARTYTKAPAYAPAPIYNWTGFYIGGHIGGAFVGDDSIATGVTRNNDGTFLGGVQGGY 81

Query: 85  NVED-SCIMYGVEGDVRYTVPVLAD------NIHSLHGIGGSLRIRGGYEVSDSLLLYAT 137
           + +     ++G+E    +             +        GS+  R GY    +LL YA 
Sbjct: 82  DYQFAPNWVFGIEAQYSWLDSGTDPVLVGAYSFSDKQKGLGSVTGRIGYTWGPALL-YAK 140

Query: 138 VGPDVAQKYETGKAG----EITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEG- 192
            G   A    T   G     ++  + G T G G+E    + S  A++EY+   +  V+  
Sbjct: 141 GGYAFADYDTTVTLGGVGAAVSSKSDGYTVGGGLEY-LFAPSWSAKVEYQYYDFGNVDFG 199

Query: 193 ------FYNTISLGVGMKF 205
                   + +  G+  +F
Sbjct: 200 TFSVKNDEHVVKAGLNYRF 218


>gi|330448104|ref|ZP_08311752.1| ompA family protein [Photobacterium leiognathi subsp. mandapamensis
           svers.1.1.]
 gi|328492295|dbj|GAA06249.1| ompA family protein [Photobacterium leiognathi subsp. mandapamensis
           svers.1.1.]
          Length = 352

 Score = 77.1 bits (188), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 35/190 (18%), Positives = 59/190 (31%), Gaps = 17/190 (8%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M K   A+   +L ++   +A   +P       G        +  Y    +         
Sbjct: 1   MSKARFAILPLALLISGAVNAATENPFYAGVRAGGVHYADFDSKNYAAGTY--------- 51

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSL--HGIGG 118
                GS       +    +F GYNV     + G    +                     
Sbjct: 52  --GNPGSEYRIDRDDFAAGLFMGYNVTPWFAIEGGYTWLGEVTLKGDKYHDQGKVEQQAI 109

Query: 119 SLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGE---ITPIAIGGTAGVGVEVGGLSES 175
            L  +  Y+ +D + LY  VG         G  G+       ++  TAG+G E    +++
Sbjct: 110 DLVGKFTYQATDKVDLYTKVGGAWQFTRSKGLPGQTTTDRDDSLIATAGLGAEYHF-TDN 168

Query: 176 LVARLEYRAS 185
           L AR EY+  
Sbjct: 169 LSARAEYQYY 178


>gi|238897463|ref|YP_002923140.1| outer membrane protein 3a (II*;G;d) [Candidatus Hamiltonella
           defensa 5AT (Acyrthosiphon pisum)]
 gi|188474314|gb|ACD49741.1| outer membrane protein A [Candidatus Hamiltonella defensa]
 gi|229465218|gb|ACQ66992.1| outer membrane protein 3a (II*;G;d) [Candidatus Hamiltonella
           defensa 5AT (Acyrthosiphon pisum)]
          Length = 365

 Score = 77.1 bits (188), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 36/219 (16%), Positives = 67/219 (30%), Gaps = 32/219 (14%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K  +AV V+   L +    QAA                     Y+  +  ++   +  
Sbjct: 1   MKKTTIAVAVAFSGLTTL--VQAA---------------PKDDTWYLGSKLGWSRYASTG 43

Query: 61  -SALY-NGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGG 118
               Y     G    +  G   F GY                           +    G 
Sbjct: 44  MKNDYIGIGDGPTHKNQIGAGAFLGYQANQYLGFELGSDWFGRMPYKGDTKNGAFKAYGV 103

Query: 119 SLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGE------ITPIAIGGTAGVGVEVGGL 172
            +  +  Y +++ L +Y  +G  V +    G               +   A VG+E   L
Sbjct: 104 QIGAKLNYPIAEDLDIYTRLGGVVWKAKTKGYTSPEAKRLSENDTGVSPFAAVGLEY-AL 162

Query: 173 SESLVARLEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
           +E+   R +Y+ +     +  +    N   +S+GV  +F
Sbjct: 163 TENWATRFDYQWTRKIGNFDSIGAAPNNGMLSIGVSYRF 201


>gi|12620644|gb|AAG60920.1|AF322013_39 ID525 [Bradyrhizobium japonicum]
          Length = 781

 Score = 77.1 bits (188), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 38/224 (16%), Positives = 60/224 (26%), Gaps = 41/224 (18%)

Query: 18  FCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSFGEEAHHNAG 77
              A+A    +            +     +      +          +G + +     A 
Sbjct: 555 TAQAKANGIDKEPPPVMPTNWAGVYLGGTIGAGKGRSHYADPFPTPVSGDYADL--GGAM 612

Query: 78  GSIFAGYNVEDSCIMYGVEGDVRYTVPVLAD--------------NIHSLHGIGGSLRIR 123
                G N +    + G+E    +      +              N  S     G+L  R
Sbjct: 613 FGGQIGINYQTGSWVLGLEASGYWANVQGTNTCFGAFPSPQIAGFNCGSQIDALGALTGR 672

Query: 124 GGYEVSDSLLLYATVGPDVAQKYETGKAGEITP-------IAIGGTAGVGVEVGGLSESL 176
            GY   D  LLY   G    ++      G I+           G T G G+E   L  + 
Sbjct: 673 VGYAF-DRTLLYVKGGSAWDRQTNQFNTGGISGTILTNGNTNWGWTVGGGLEY-ALLPNW 730

Query: 177 VARLEYRASKYSKV----------------EGFYNTISLGVGMK 204
              LEY+   + K                      T+SLGV  K
Sbjct: 731 SMALEYKYYDFGKSPVFTTAGLGSVPLSPNSTTVQTVSLGVNYK 774



 Score = 74.8 bits (182), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 37/248 (14%), Positives = 62/248 (25%), Gaps = 56/248 (22%)

Query: 3   KLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSA 62
           K  LA          +  A AAD   +          T+          ++ G Y G   
Sbjct: 15  KALLASNSICWMAGLYGPAHAADLPVKTAPPITAAPSTL---------WNWTGIYVGAHL 65

Query: 63  LYNGSFGE-------------------EAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTV 103
                  +                          G    G N +    + G+E       
Sbjct: 66  GGAFGSSDWQTATGLQADFSNRGFPGSGNAEGLLGGGQIGVNYQFGTWVTGLEIAASAAD 125

Query: 104 PVL---------------ADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYET 148
                             +    +     G++  R G    + LL+Y   G   A     
Sbjct: 126 VDGFAKCANRADNRYGVISFTCDNRVTSLGTIAGRLGQTWGN-LLIYGKAGAAWATDESD 184

Query: 149 G------KAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFY-----NTI 197
                       +    G   G+G+E    S +L A +EY    +   +  Y     N  
Sbjct: 185 ARTSHYINKFNQSGTRWGWMGGLGLEY-AFSPNLSAFVEYDHFDFGSKDSNYVDQFNNAS 243

Query: 198 SLGVGMKF 205
           ++G   +F
Sbjct: 244 TVGFRQRF 251


>gi|219872299|ref|YP_002476674.1| outer membrane protein P5 , heat-modifiable outer membrane protein
           [Haemophilus parasuis SH0165]
 gi|219692503|gb|ACL33726.1| outer membrane protein P5 precursor, heat-modifiable outer membrane
           protein [Haemophilus parasuis SH0165]
 gi|253807583|gb|ACT36164.1| outer membrane protein P5 [Haemophilus parasuis]
 gi|312270777|gb|ADQ55789.1| OmpA [Haemophilus parasuis]
 gi|312270779|gb|ADQ55790.1| OmpA [Haemophilus parasuis]
          Length = 371

 Score = 77.1 bits (188), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 42/234 (17%), Positives = 80/234 (34%), Gaps = 37/234 (15%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATN-RYVPIRHDFNGPYAG 59
           M+K  +A+ VS LA+AS   AQAA      + G +    T   +   +  ++  +  Y  
Sbjct: 1   MKKSLIALAVSGLAVASV--AQAAPQANTFYVGAKAGWATFHNDINQIDSKYANDARYDA 58

Query: 60  LSALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGS 119
            +  Y       + ++    +F GY + D+  +               +     H   G+
Sbjct: 59  TNLKYG-----ISRNSVTYGVFGGYQIIDNLAVELGYDYFGRVRGNKQEFRAFKHSAHGT 113

Query: 120 -LRIRGGYEVSDSLLLYATVGPDVAQKYETGK-------AGEITPIAIGGTAGVGVEVGG 171
            L ++  YEV + L +Y  VG  + +               +   +      G GVE   
Sbjct: 114 HLSLKPSYEVLNGLDVYGKVGAALVRNDYKRYSQTAGVQTQKAHNLKTSLVLGAGVEY-A 172

Query: 172 LSESLVARLEYRASK-----------------YSKVEG---FYNTISLGVGMKF 205
           +   L  R+EY+                    +          +++S G+  +F
Sbjct: 173 ILPELAFRVEYQWLSRVGNANKAAQKRGDTAMFGPGSTYSPDAHSVSAGISYRF 226


>gi|312115598|ref|YP_004013194.1| hypothetical protein Rvan_2889 [Rhodomicrobium vannielii ATCC
           17100]
 gi|311220727|gb|ADP72095.1| hypothetical protein Rvan_2889 [Rhodomicrobium vannielii ATCC
           17100]
          Length = 249

 Score = 77.1 bits (188), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 40/211 (18%), Positives = 71/211 (33%), Gaps = 18/211 (8%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNG----- 55
           M+K F+A   ++   A   SA A D   ++ +    +V    T     I     G     
Sbjct: 1   MKKTFVAAASAAAIFAMSGSALAGDLYAKSGYKDAPIVVAEPTWTGFYIGLGVGGQAVNH 60

Query: 56  -----PYAGLSALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLAD-- 108
                 +      + G     +     G++  GY+ +   I+ GV  +  +   V +   
Sbjct: 61  ELSASDFDAGDEEWIGDLNGVSGTGVIGTVEVGYDRQFGNIVAGVFFNYDFGDDVSSSLR 120

Query: 109 ----NIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGK-AGEITPIAIGGTA 163
               N+++      +   R GY V+   L Y   G   +         G       G T 
Sbjct: 121 IEDLNVNAKQTDSWTAGGRLGYLVNPGTLAYVLGGYTQSTFELGFPGFGSADDTFAGWTV 180

Query: 164 GVGVEVGGLSESLVARLEYRASKYSKVEGFY 194
           G G+E   LS +   + EYR +++       
Sbjct: 181 GGGLET-RLSGNWYLKGEYRFTEFDTNRYTL 210


>gi|238749729|ref|ZP_04611234.1| Outer membrane protein A [Yersinia rohdei ATCC 43380]
 gi|238712384|gb|EEQ04597.1| Outer membrane protein A [Yersinia rohdei ATCC 43380]
          Length = 358

 Score = 77.1 bits (188), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 36/223 (16%), Positives = 65/223 (29%), Gaps = 39/223 (17%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K   A+ ++         AQAA                     Y   +  ++      
Sbjct: 1   MKKT--AIALAVALAGFATVAQAA---------------PKDNTWYTGGKLGWSQYQDTG 43

Query: 61  SAL-YN--GSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIG 117
           +   Y   G+ G    +  G   F GY    +    G E    +   +            
Sbjct: 44  TGGIYGDLGNDGPTHKNQLGAGAFLGYQ---ANQYLGFEMGYDWLGRMPYKGDTRNGDFK 100

Query: 118 G---SLRIRGGYEVSDSLLLYATVGPDVAQKYE------TGKAGEITPIAIGGTAGVGVE 168
                L  +  Y V+  L LY  +G  V +         +G         +     +G E
Sbjct: 101 AQGVQLAAKLSYPVAQDLDLYTRLGGLVWRADSSAFDAESGARSSNHDTGVSPLVALGAE 160

Query: 169 VGGLSESLVARLEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
               +++   R+EY+          V    +   +S+GV  +F
Sbjct: 161 Y-AWTKNWATRMEYQWVSNIGDKGTVGARPDNGMLSVGVSYRF 202


>gi|19881371|gb|AAM00928.1|AF491820_1 hemagglutinin antigen [Avibacterium paragallinarum]
 gi|19881381|gb|AAM00933.1|AF491825_1 hemagglutinin antigen [Avibacterium paragallinarum]
 gi|19881383|gb|AAM00934.1|AF491826_1 hemagglutinin antigen [Avibacterium paragallinarum]
 gi|38385761|gb|AAR19399.1| hemagglutinin antigen [Avibacterium paragallinarum]
 gi|89147814|gb|ABD62756.1| hemagglutinin antigen [Avibacterium paragallinarum]
          Length = 344

 Score = 77.1 bits (188), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 37/224 (16%), Positives = 72/224 (32%), Gaps = 36/224 (16%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAG- 59
           M+K   A+ +    L +   AQAA                 A   Y   +  +   + G 
Sbjct: 1   MKKT--AIALVIAGLTAASVAQAA---------------PQANTFYAGAKAGWASFHDGL 43

Query: 60  LSALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGS 119
                + +      ++    +F GY + D+  +     D               H   G+
Sbjct: 44  NQFENSQNAYGTLRNSVTYGVFGGYQITDNFAVELGYDDFGRAKLRQDGETVGKHTNHGA 103

Query: 120 -LRIRGGYEVSDSLLLYATVGPDVAQKYET------GKAGEITPIAIGGTAGVGVEVGGL 172
            L ++  Y V + L +YA VG  + +                  + +      G+E    
Sbjct: 104 HLSLKASYPVLEGLDVYARVGAALIRSDYKPTKRAAPNETHEHSLKVSPVFAGGLEYNLP 163

Query: 173 S-ESLVARLEYRAS--------KYSKVEGFYN--TISLGVGMKF 205
           S   L  R+EY+            S+V+   +  +++ G+  +F
Sbjct: 164 SLPELALRVEYQWVNKVGRWEKDGSRVDYTPSIGSVTAGLSYRF 207


>gi|48249486|gb|AAT40989.1| hemagglutinin antigen [Avibacterium paragallinarum]
          Length = 345

 Score = 76.8 bits (187), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 37/225 (16%), Positives = 73/225 (32%), Gaps = 37/225 (16%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAG- 59
           M+K   A+ ++   L +   AQAA                 A   Y   +  +   + G 
Sbjct: 1   MKKT--AIALAIAGLTAASVAQAA---------------PQANTFYAGAKAGWASFHDGL 43

Query: 60  LSALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGS 119
                + +      ++    +F GY + D+  +     D               H   G+
Sbjct: 44  NQFENSQNAYGTLRNSVTYGVFGGYQITDNFAVELGYDDFGRAKLRKGGETVIKHTNHGA 103

Query: 120 -LRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPI-------AIGGTAGVGVEVGG 171
            L ++  Y V + L +YA VG  + +          +          +      G+E   
Sbjct: 104 HLSLKASYPVLEGLDVYARVGAALIRSDYKSTKRAESDYVMHEHSLKVSPVFAGGLEYNL 163

Query: 172 LS-ESLVARLEYRAS--------KYSKVEGFYN--TISLGVGMKF 205
            S   L  R+EY+            S+V+   +  +++ G+  +F
Sbjct: 164 PSLPELALRVEYQWVNKVGRGEKDGSRVDYTPSIGSVTAGLSYRF 208


>gi|227329084|ref|ZP_03833108.1| outer membrane protein A [Pectobacterium carotovorum subsp.
           carotovorum WPP14]
          Length = 361

 Score = 76.8 bits (187), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 36/224 (16%), Positives = 64/224 (28%), Gaps = 40/224 (17%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K   A+ V+    +    AQAA                     Y   +   +  +   
Sbjct: 1   MKKT--AIAVAVALASFATIAQAA---------------PKDNTWYTGGKLGVSQFHDTG 43

Query: 61  SAL--YNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGG 118
                Y G          G   F GY    +    G E    +   +      S      
Sbjct: 44  FYGNGYTGVNNNPIKSKLGAGAFVGYQ---ANPYLGFELGYDWLGRMKYAGSTSNVADSA 100

Query: 119 SLR-------IRGGYEVSDSLLLYATVGPDVAQKY----ETGKAGEITPIAIGGTAGVGV 167
           S +        +  Y V   L +Y  +G  V +        G         +   A +GV
Sbjct: 101 SFKAQGIQLAAKLSYPVLPDLDVYTRLGGMVWRADSHAAIGGGDINNDDTGVSPLAAIGV 160

Query: 168 EVGGLSESLVARLEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
           E   + ++   R++Y+          V    +   +S+G+  +F
Sbjct: 161 EY-AIDKNWATRVDYQWVSNIGDAGTVGARPDNMLMSVGLSYRF 203


>gi|209886119|ref|YP_002289976.1| outer membrane protein Omp31 [Oligotropha carboxidovorans OM5]
 gi|209874315|gb|ACI94111.1| outer membrane protein Omp31 [Oligotropha carboxidovorans OM5]
          Length = 237

 Score = 76.8 bits (187), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 48/240 (20%), Positives = 82/240 (34%), Gaps = 39/240 (16%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M +L LA   S   +A   S+ AAD   R +         +       I       + G 
Sbjct: 1   MTRLLLA---SVAVIALGTSSYAADLAARPYTKAPATAVALYNWTGFYIGGFGGYGWGGK 57

Query: 61  SALYNGSFGEEAHHNAGG---------SIFAGYNVED--SCIMYGVEGDVRYTVPVLA-- 107
           +   N  F ++   +                GYN +   S  ++G+E ++  +   L+  
Sbjct: 58  ARADNTDFDDDGIDDTAAFPKMKGGFGGGTIGYNWQGFGSPFVFGLEAEIAGSGIDLSFV 117

Query: 108 -----DNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEI----TPIA 158
                        + GS+  R GY V+D LL+YA  G   A+   +   G      +   
Sbjct: 118 DPADGSGASYKLNMFGSVTGRVGYAVNDMLLIYAKGGYAWARTKLSVVDGADSFSSSATH 177

Query: 159 IGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGF-------------YNTISLGVGMKF 205
            G T G G+E   ++ +   + EY  + Y K                  +T+  G+   F
Sbjct: 178 SGYTIGAGLEY-MMARNWSTKAEYLYADYGKATYGPAPDGDTGRIGLSNHTVKFGINYHF 236


>gi|49474419|ref|YP_032461.1| hemin binding protein E [Bartonella quintana str. Toulouse]
 gi|21689909|gb|AAM68132.1| hemin-binding protein E [Bartonella quintana]
 gi|49239923|emb|CAF26323.1| Hemin binding protein E [Bartonella quintana str. Toulouse]
          Length = 299

 Score = 76.8 bits (187), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 44/299 (14%), Positives = 70/299 (23%), Gaps = 112/299 (37%)

Query: 11  SSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSFGE 70
           S  A       QAAD +             +           + G Y G       S   
Sbjct: 9   SVFAFIPASVVQAADVIVPQQSEQ------VIPPVIASPPFSWTGFYFGGQIGGFSSKIS 62

Query: 71  EAHH----------------------------------NAGGSIFAGYNVEDSC-IMYGV 95
                                                    G  + G N+E     + GV
Sbjct: 63  AMTSDVASPYVDNLFFPDEESKNKKWVSVEKKYMPELSGFIGGGYTGANLELGNGFILGV 122

Query: 96  EGDVRYTVPVLADNI--------------------------------------------- 110
           E D+  +       +                                             
Sbjct: 123 ETDILVSKRKDTKTVVFSDKSDQKITLVEGTKGETDGHTEEDSLGQLIGVSRLKEAEENS 182

Query: 111 -----HSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYE-----------TGKAGEI 154
                       G+ R+R G+ V + ++ Y + G    Q  +                + 
Sbjct: 183 LTVSHTLKQKWTGATRVRVGFPV-ERMMPYISGGVAYGQFQDIFSMSITGEDADFTTVDD 241

Query: 155 TPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEG--------FYNTISLGVGMKF 205
           T   IG T G GV+   +++  + R EYR S + K +           N   +GV  KF
Sbjct: 242 TKAMIGYTLGGGVDF-AMTDHFIVRAEYRYSDFGKKKFQERIELNYKTNDFRVGVAYKF 299


>gi|27376983|ref|NP_768512.1| hypothetical protein bll1872 [Bradyrhizobium japonicum USDA 110]
 gi|27350125|dbj|BAC47137.1| bll1872 [Bradyrhizobium japonicum USDA 110]
          Length = 602

 Score = 76.8 bits (187), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 37/253 (14%), Positives = 70/253 (27%), Gaps = 52/253 (20%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+   L +G +++A+A+  ++ A +  R A               +V   +         
Sbjct: 39  MRSRVLFLGAATMAIATTGTSMA-NLGREALPPSVWNWSGGYIGGHVGGGYGRTSF--TN 95

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLAD------------ 108
                         +       GYN +++  +YG+E D    V   ++            
Sbjct: 96  PFGPPIYGDVVDIPSFVAGGQIGYNWQNNSWVYGLELDASAAVASGSNTCLAASDLIVSA 155

Query: 109 NIHSLHGIGGSLRIRGGYEVS--DSLLLYATVGPDVAQKYETGKAGEITPI--------- 157
           N ++   +  +   R GY        L Y   G                           
Sbjct: 156 NCNAAPNLFATGTGRIGYAFGSLGQTLAYLKAGAAWQNNRGDIVNNFEGGDLPQEKTHFD 215

Query: 158 --AIGGTAGVGVEVGGLSESLVARLEYRASKYS-----------------------KVEG 192
              +GG  G+GVE   L+ S    +EY    +                         +  
Sbjct: 216 YGQVGGVIGLGVEQ-ALTPSWSVNVEYDYLHFGGPSVATASTAKLSPSTILPASTTSLSS 274

Query: 193 FYNTISLGVGMKF 205
            Y+   +G+   F
Sbjct: 275 NYHIGKIGLNYHF 287


>gi|114706584|ref|ZP_01439485.1| outer membrane protein, 31 kDa [Fulvimarina pelagi HTCC2506]
 gi|114537976|gb|EAU41099.1| outer membrane protein, 31 kDa [Fulvimarina pelagi HTCC2506]
          Length = 243

 Score = 76.8 bits (187), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 38/244 (15%), Positives = 75/244 (30%), Gaps = 40/244 (16%)

Query: 1   MQKLFLAVGVSSLALASFCSA-QAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAG 59
           M++L L   ++  +L++  +A    DP       G                         
Sbjct: 1   MRELLLGFLLTMSSLSAASAADLYDDPSASYSDTGAYDQTPSDWTGGYVGVTGGLAAGES 60

Query: 60  LSALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLA------------ 107
             ++ +G+  E       G + AGY+V+    + G   D+  T                 
Sbjct: 61  EYSVSDGTGFETTAGGGLGGVQAGYDVQLGRAVLGGVADISLTGIDADVSTRERAGGVET 120

Query: 108 -DNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYE-------------TGKAGE 153
            ++ ++     G++R R GY  SD +L Y   G    +                T     
Sbjct: 121 TNSANTELDYLGTVRARAGYAASDRVLAYGHGGLAYGRTDTTISESERRGGVTNTQTESR 180

Query: 154 ITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYS------------KVEGFYNTISLGV 201
            +    G   G G+E    ++++  + EY                    +  ++ +  GV
Sbjct: 181 KSDTKYGYAVGAGLEYKA-TDNVSLQTEYGYHDLGKDRLYSDSNGRVDQDLQFHAVKAGV 239

Query: 202 GMKF 205
             +F
Sbjct: 240 NFRF 243


>gi|15420174|gb|AAK97309.1|AF308167_1 Pap31 [Bartonella henselae phage 60457]
          Length = 241

 Score = 76.8 bits (187), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 43/251 (17%), Positives = 73/251 (29%), Gaps = 86/251 (34%)

Query: 13  LALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSFGEEA 72
           +AL S  +AQAAD +         +               + G Y G       S  E  
Sbjct: 1   IALISXSAAQAADVIVPHEVAPTVISAPA---------FSWTGFYIGGQVGNFSSKVEIT 51

Query: 73  H----------------HNAGGSIFAGYNVEDSC-IMYGVEGDVRYTVPVLADNIHSL-- 113
                                G I+AG N++    ++ GVE D  +     A    +   
Sbjct: 52  DPNKKDKLFSKDDTPKPSGFMGGIYAGSNMDLGNNMILGVETDAVWADREDAKTSSAKVI 111

Query: 114 -----------------------------------------HGIGGSLRIRGGYEVSDSL 132
                                                        G+ R+R G+  +D +
Sbjct: 112 REDELVNFKDSLKNANAVFAKDKTMDDVKQDEKHTDSLALKEKWSGATRVRIGFTAADRI 171

Query: 133 LLYATVGPDVAQKY----------------ETGKAGEITPIAIGGTAGVGVEVGGLSESL 176
           + Y   G   AQ                   + +  + T   +G T G GV+   +++++
Sbjct: 172 MPYVAGGVSYAQVQAVSSTKVTKAADDAEIASAQLFDKTKTLVGFTLGGGVDF-AMTDNV 230

Query: 177 VARLEYRASKY 187
           + R EYR S +
Sbjct: 231 LLRAEYRYSDF 241


>gi|153835168|ref|ZP_01987835.1| outer membrane protein [Vibrio harveyi HY01]
 gi|148868362|gb|EDL67484.1| outer membrane protein [Vibrio harveyi HY01]
          Length = 330

 Score = 76.8 bits (187), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 36/220 (16%), Positives = 65/220 (29%), Gaps = 55/220 (25%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+KL     V          A AA                             +  Y G 
Sbjct: 1   MKKL----AVVVAFTLGTSMANAASV---------------------------SDFYIGS 29

Query: 61  SALYNGSFGEE------AHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIH--- 111
              Y+    +          +A    + GY   D+  +      + +       ++H   
Sbjct: 30  KLGYSQVDSDCASEFQCDKDSASVGAYLGYQYNDNVAVEYGVDYLGHHTTSKKRSLHLTD 89

Query: 112 --SLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEV 169
             +   +  SL  +  Y ++D+L L+  +G                   +  TA  G E 
Sbjct: 90  VLTTDVLAISLAPKFSYSLTDNLALFTKIGAAY--------MIAEEENDVVATASAGAEY 141

Query: 170 GGLSESLVARLEYRA----SKYSKVEGFYNTISLGVGMKF 205
             L+++L  R EY+     S     +  +N  S G+  +F
Sbjct: 142 -ALTQNLKLRAEYQRFEKMSDIHIEDMSFNNFSFGISYQF 180


>gi|183598397|ref|ZP_02959890.1| hypothetical protein PROSTU_01791 [Providencia stuartii ATCC 25827]
 gi|188020575|gb|EDU58615.1| hypothetical protein PROSTU_01791 [Providencia stuartii ATCC 25827]
          Length = 357

 Score = 76.8 bits (187), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 29/180 (16%), Positives = 50/180 (27%), Gaps = 15/180 (8%)

Query: 40  TIATNRYVPIRHDFNGPYAGLSALY---NGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVE 96
                 Y   +  ++             N           G   +AGY            
Sbjct: 23  PKDNTWYTGAKLGWSHYEDTSFTPVDRENTVGKSTDRDTFGAGAYAGYQYNQYMGFELGY 82

Query: 97  GDVRYTVPVLADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEIT- 155
                     A N   L  +G SL  +  Y V D L +Y  +G  V +            
Sbjct: 83  DWFGKMKYKGAGNNGDLKSMGVSLTTKLSYPVMDDLDVYTRLGGMVWRTDVKAHQTGEDR 142

Query: 156 ----PIAIGGTAGVGVEVGGLSESLVARLEYRA-SKYSKVEG-----FYNTISLGVGMKF 205
                  +     +GVE   ++ +   RL+Y+  S     +          +S+G+  +F
Sbjct: 143 YKENDTGVSPVYALGVEY-AITPNWATRLDYQWVSNIGDNDNLGVRPDNGMLSVGLAYRF 201


>gi|19881379|gb|AAM00932.1|AF491824_1 hemagglutinin antigen [Avibacterium paragallinarum]
          Length = 344

 Score = 76.8 bits (187), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 37/224 (16%), Positives = 72/224 (32%), Gaps = 36/224 (16%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAG- 59
           M+K   A+ +    L +   AQAA                 A   Y   +  +   + G 
Sbjct: 1   MKKT--AIALVIAGLTAASVAQAA---------------PQANTFYAGAKAGWASFHDGL 43

Query: 60  LSALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGS 119
                + +      ++    +F GY + D+  +     D               H   G+
Sbjct: 44  NQFENSQNAYGTLRNSVTYGVFGGYQITDNFAVELGYDDFGRAKLRQDGETVGKHTNHGA 103

Query: 120 -LRIRGGYEVSDSLLLYATVGPDVAQKYET------GKAGEITPIAIGGTAGVGVEVGGL 172
            L ++  Y V + L +YA VG  + +                  + +      G+E    
Sbjct: 104 HLSLKASYPVLEGLDVYARVGAALIRSDYKPTKRAAPNETHEHTLKVSPVFAGGLEYNLP 163

Query: 173 S-ESLVARLEYRAS--------KYSKVEGFYN--TISLGVGMKF 205
           S   L  R+EY+            S+V+   +  +++ G+  +F
Sbjct: 164 SLPELALRVEYQWVNKVGRWEKDGSRVDYTPSIGSVTAGLSYRF 207


>gi|192291529|ref|YP_001992134.1| OmpA domain protein transmembrane region-containing protein
           [Rhodopseudomonas palustris TIE-1]
 gi|192285278|gb|ACF01659.1| OmpA domain protein transmembrane region-containing protein
           [Rhodopseudomonas palustris TIE-1]
          Length = 246

 Score = 76.8 bits (187), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 38/223 (17%), Positives = 65/223 (29%), Gaps = 27/223 (12%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHD-------- 52
           M+K  L   V  +AL +  +  A    R        +      + +    +         
Sbjct: 1   MKKFLLG-TVGLIALGTAPAMAADLAARPYTKAPPIIAAAYDWSGFYVGANGGWGTSRNC 59

Query: 53  FNGPYAGLSALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLAD---- 108
           ++      +       G            AGYN + S  ++GVE    +     ++    
Sbjct: 60  WDYLGTTATPAVALGEGCHDASGGTAGGQAGYNWQISNWVFGVEAQGNWADFKGSNVSLL 119

Query: 109 -----NIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGK-------AGEITP 156
                   S     G    R GY  +++LL Y   G  V     T             + 
Sbjct: 120 VVPGTTNDSKIDAFGLFTARVGYAWNNALL-YVKGGAAVTSDKYTVYGNRTGAITDTASE 178

Query: 157 IAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFYNTISL 199
              G   G G+E G  S +    +EY        +  + T S+
Sbjct: 179 TRWGAAVGGGLEYGF-SPAWTFGVEYDHLFMGSRDITFATTSI 220


>gi|46397578|gb|AAS91717.1| OmpA [Bibersteinia trehalosi]
 gi|46397583|gb|AAS91721.1| OmpA [Bibersteinia trehalosi]
          Length = 364

 Score = 76.8 bits (187), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 46/228 (20%), Positives = 77/228 (33%), Gaps = 32/228 (14%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNR-YVPIRHDFNGPYAG 59
           M+K  +A+ V+  A+A   SA AA      + G +    T          ++  +  Y+ 
Sbjct: 1   MKKSLVALAVAGFAVA---SANAAPEANSFYVGAKAGWATFHHGVNQFNSKYANDERYSD 57

Query: 60  LSALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYT-VPVLADNIHSLHGIGG 118
               Y         ++    +F GY + D+  +             V           G 
Sbjct: 58  GPTAYG-----INRNSVTYGVFGGYQIIDNLAVELGYDYFGRVRGNVGDRRAFKDTKHGA 112

Query: 119 SLRIRGGYEVSDSLLLYATVGPD-----VAQKYETGKAGEITPIAIGGTAGVGVEVGGLS 173
            + ++  YEV   L LY  VG           Y  G   +   +      G GVE   ++
Sbjct: 113 HISLKPSYEVVSGLDLYGKVGAALVRNDYKDYYANGTKDKSHNLKTSLILGAGVEY-AIT 171

Query: 174 ESLVARLEYRAS----KYSKVEG------------FYNTISLGVGMKF 205
            +L ARLEY+       Y K E               +++S G+  +F
Sbjct: 172 PALAARLEYQWLSRAGNYGKAEAKAGNVTDLRYSPDAHSVSAGLTYRF 219


>gi|227356882|ref|ZP_03841261.1| OOP family OmpA-OmpF porin [Proteus mirabilis ATCC 29906]
 gi|227162952|gb|EEI47897.1| OOP family OmpA-OmpF porin [Proteus mirabilis ATCC 29906]
          Length = 368

 Score = 76.8 bits (187), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 31/184 (16%), Positives = 54/184 (29%), Gaps = 19/184 (10%)

Query: 40  TIATNRYVPIRHDFNGPYAGLSA--LYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEG 97
                 Y   +  ++   +  +     N   G       G   FAGY             
Sbjct: 29  PKDNTWYTGGKLGWSQYQSTGNNWDGVNIGNGSTHKDQIGAGAFAGYQYNQYLGFELGYD 88

Query: 98  DVRYTVPVLADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGK------- 150
            +       + N  +    G  L  +  Y V D L +Y  +G  V +   T         
Sbjct: 89  WLGRMAYKGSYNNGAFKAQGIQLTTKLSYPVMDDLDVYTRLGGMVWRADSTATINATSAG 148

Query: 151 ---AGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFYNT------ISLGV 201
                      +     +G E   ++ ++  RLEY+       +G  N       +S+GV
Sbjct: 149 TQKRFSENDTGVSPVFALGTEY-AITPNIATRLEYQWINNIGDKGTLNARPDNGMLSVGV 207

Query: 202 GMKF 205
             +F
Sbjct: 208 AYRF 211


>gi|224714311|gb|ACN62150.1| outer membrane protein A [Haemophilus parasuis]
          Length = 367

 Score = 76.8 bits (187), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 43/230 (18%), Positives = 82/230 (35%), Gaps = 33/230 (14%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATN-RYVPIRHDFNGPYAG 59
           M+K  +A+ VS LA+AS   AQ A      + G +    T   +   +  ++  +  YA 
Sbjct: 1   MKKSLIALAVSGLAVASV--AQDAPQANTFYVGAKAGWATFHNDINQLNSKYKNDARYAT 58

Query: 60  LSALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGS 119
            +  Y         ++    +F GY + D+  +               +     H   G+
Sbjct: 59  SANGYV-----INRNSVTYGVFGGYQIIDNLAVELGYDYFGRVRGNKQEFRAFKHSAHGT 113

Query: 120 -LRIRGGYEVSDSLLLYATVGPDVAQKYETGK-------AGEITPIAIGGTAGVGVEVGG 171
            L ++  YEV + L +Y  VG  + +               +   +      G GVE   
Sbjct: 114 HLSLKPSYEVLNGLDVYGKVGAALVRNDYKRYSQTAGVQTQKAHNLKTSLVLGAGVEY-A 172

Query: 172 LSESLVARLEYRAS----KYSKVEG------------FYNTISLGVGMKF 205
           +   L  R+EY+       ++K E               ++++ G+  +F
Sbjct: 173 ILPELAFRVEYQWLSNVGNFTKAEAKENRRATYNYSPDSHSVTAGISYRF 222


>gi|312270773|gb|ADQ55787.1| OmpA [Haemophilus parasuis]
 gi|312270775|gb|ADQ55788.1| OmpA [Haemophilus parasuis]
          Length = 371

 Score = 76.4 bits (186), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 42/234 (17%), Positives = 80/234 (34%), Gaps = 37/234 (15%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATN-RYVPIRHDFNGPYAG 59
           M+K  +A+ VS LA+AS   AQAA      + G +    T   +   +  ++  +  Y  
Sbjct: 1   MKKSLIALAVSGLAVASV--AQAAPQANTFYVGAKAGWATFHNDINQIDSKYANDARYDA 58

Query: 60  LSALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGS 119
            +  Y         ++    +F GY + D+  +               +     H   G+
Sbjct: 59  TNLKYG-----INRNSVTYGVFGGYQIIDNLAVELGYDYFGRVRGNKQEFRAFKHSAHGT 113

Query: 120 -LRIRGGYEVSDSLLLYATVGPDVAQKYET-------GKAGEITPIAIGGTAGVGVEVGG 171
            L ++  YEV + L +Y  VG  + +            +  +   +      G GVE   
Sbjct: 114 HLSLKPSYEVLNGLDVYGKVGAALVRNDYKLYSQTAGVQTQKAHNLKTSLVLGAGVEY-A 172

Query: 172 LSESLVARLEYRASK-----------------YSKVEG---FYNTISLGVGMKF 205
           +   L  R+EY+                    +          +++S G+  +F
Sbjct: 173 ILPELAFRVEYQWLSRVGNANKAAQKRGDTAMFGPGSTYSPDAHSVSAGISYRF 226


>gi|218461155|ref|ZP_03501246.1| outer membrane protein [Rhizobium etli Kim 5]
          Length = 168

 Score = 76.4 bits (186), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 43/167 (25%), Positives = 72/167 (43%), Gaps = 10/167 (5%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+ L   +  S+ A+A   +       + A    +     +A +  V    ++ G Y G 
Sbjct: 1   MRVLIAGLMASAFAIAGVSA------AQAADAVDQVPEAPVAQDAPVKPAGNWEGFYLGG 54

Query: 61  SALYNGSFGEEAHH--NAGGSIFAGYNVEDSCIMYGVEGDVRYTVPV-LADNIHSLHGIG 117
           +  YN        H    GG +F GYN +   I+YGVE D+ Y+     +  + + +G  
Sbjct: 55  AGTYNMGDFGSDRHTYGFGGQVFTGYNWQAGQIVYGVESDLGYSGDDVSSGGVENKYGWN 114

Query: 118 GSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAG 164
           GS+R R GY+++   LLY T G  +     +    + +  A G T G
Sbjct: 115 GSVRGRVGYDMNP-FLLYGTAGLALGNIKVSDDTSDESKTAYGYTVG 160


>gi|148258659|ref|YP_001243244.1| OmpA domain-containing protein [Bradyrhizobium sp. BTAi1]
 gi|146410832|gb|ABQ39338.1| putative outer membrane protein with ompA domain [Bradyrhizobium
           sp. BTAi1]
          Length = 662

 Score = 76.4 bits (186), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 40/182 (21%), Positives = 61/182 (33%), Gaps = 31/182 (17%)

Query: 44  NRYVPIRHDFNGPYAGLSALY-------------NGSFGEEAHHNAGGSIFAGYNV-EDS 89
            R      D++G Y G  A Y              G+          G + AGYN    S
Sbjct: 35  ARMAQTVFDWSGIYVGAHAGYTRDHAQASLIDPIGGAGAGSRFSGLTGGVQAGYNWVTRS 94

Query: 90  CIMYGVEGDVRYTVPVLADNIHSLH-----------GIGGSLRIRGGYEVSDSLLLYATV 138
            ++ G EGD  +   + +++  ++                S R R GY   D  L+YAT 
Sbjct: 95  GLLLGFEGDFSFPNSLTSNHTVAMLNRPGSSVSELWDYVASARGRIGYAQGD-WLVYATG 153

Query: 139 GPDVAQKYETGKAGEITP----IAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFY 194
           G                       +G TAG G+E    +     RLEY  S++      +
Sbjct: 154 GLAWTGGRFINTTAAGDEKLLTTRVGWTAGAGIE-RAFAPHWSWRLEYLYSQFENGGVRF 212

Query: 195 NT 196
           + 
Sbjct: 213 SN 214


>gi|39933549|ref|NP_945825.1| OmpA-like transmembrane domain-containing protein [Rhodopseudomonas
           palustris CGA009]
 gi|39647395|emb|CAE25916.1| OmpA-like transmembrane domain [Rhodopseudomonas palustris CGA009]
          Length = 736

 Score = 76.4 bits (186), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 39/208 (18%), Positives = 60/208 (28%), Gaps = 30/208 (14%)

Query: 23  AADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSFGEEAHHNAGGSIFA 82
           AA  + +                +        G     +     +              A
Sbjct: 102 AAGGIGKQRPDPAYDWSGFYVGAHAGYVRGHAGATLQDATSVAQN--SNGAGGITAGAQA 159

Query: 83  GYNVEDS-CIMYGVEGDVRYTV-----------PVLADNIHSLHGIGGSLRIRGGYEVSD 130
           GYN      ++ GVE D+ +                  N        G++R R G  ++ 
Sbjct: 160 GYNFVTGSNLLLGVEADISFPSYLPQNAVLSEFDNGTANTLQHLDYYGTVRARLG-VIAG 218

Query: 131 SLLLYATVGPDVAQKY--ETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYS 188
             L Y T G     +        G +    IG  AG GVE G  + +  AR+EY  S+Y 
Sbjct: 219 RWLGYVTGGLAFEHERYLTDPDVGRVMNARIGWAAGAGVEYGF-TPNWSARVEYLYSQYQ 277

Query: 189 KVEGF------------YNTISLGVGMK 204
                              T+ +GV  K
Sbjct: 278 NATVDLPTGASYATSLNLQTVRVGVNRK 305


>gi|217977073|ref|YP_002361220.1| porin [Methylocella silvestris BL2]
 gi|217502449|gb|ACK49858.1| porin [Methylocella silvestris BL2]
          Length = 239

 Score = 76.4 bits (186), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 48/227 (21%), Positives = 70/227 (30%), Gaps = 30/227 (13%)

Query: 7   AVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYN- 65
           A+  ++       +A AAD       GG    P    +          G      + +  
Sbjct: 5   ALLTTTTLAVFAGAALAADLPYGQESGGYAPAPIFTWSGLYLGGQIGYGWANNALSGWGP 64

Query: 66  ---GSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLA-----DNIHSLHGIG 117
               S          G    GYN++ + I+ G+EGDV  T              +   + 
Sbjct: 65  FFVFSGASYNPSGVLGGAHVGYNLQFNQIVLGLEGDVEATGVDKTYAFGPTVYTTQIPVQ 124

Query: 118 GSLRIRGGYEVSDSLLLYATVGPDVAQKYETG----KAGEITPIAIGGTAGVGVEVGGLS 173
           GS+R R G+ V D  L Y T G   A              +     G T G G+E   L+
Sbjct: 125 GSIRARFGFAV-DRALFYVTGGAAFASVTNQYQSYLGYNSLNRSFAGWTIGGGLEY-ALT 182

Query: 174 ESLVARLEYRASKYSKVEG---------------FYNTISLGVGMKF 205
            +   R EYR S +                      N   +G   KF
Sbjct: 183 NNWSVRAEYRYSDFGTATDYTFTAGPGGNVARHLTENAARVGFSYKF 229


>gi|320192555|gb|EFW67196.1| Outer membrane protein A precursor [Escherichia coli O157:H7 str.
           EC1212]
 gi|320202354|gb|EFW76925.1| Outer membrane protein A precursor [Escherichia coli EC4100B]
 gi|323165436|gb|EFZ51223.1| outer membrane protein A [Shigella sonnei 53G]
          Length = 337

 Score = 76.4 bits (186), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 30/183 (16%), Positives = 58/183 (31%), Gaps = 11/183 (6%)

Query: 30  AHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSFGEEAHHNAGGSIFAGYNVEDS 89
           A               Y   +  ++  +      +  + G    +  G   F GY V   
Sbjct: 4   AGFATVAQAAPKDNTWYTGAKLGWSQYHDT---GFINNNGPTHENQLGAGAFGGYQVNPY 60

Query: 90  CIMYGVEGDVRYTVPVLADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYE-T 148
                    +       +    +    G  L  + GY ++D L +Y  +G  V +    +
Sbjct: 61  VGFEMGYDWLGRMPYKGSVENGAYKAQGVQLTAKLGYPITDDLDIYTRLGGMVWRADTKS 120

Query: 149 GKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRAS----KYSKVEGFYNT--ISLGVG 202
              G+     +      GVE   ++  +  RLEY+ +        +    +   +SLGV 
Sbjct: 121 NVYGKNHDTGVSPVFAGGVEY-AITPEIATRLEYQWTNNIGDAHTIGTRPDNGMLSLGVS 179

Query: 203 MKF 205
            +F
Sbjct: 180 YRF 182


>gi|22126613|ref|NP_670036.1| outer membrane protein A [Yersinia pestis KIM 10]
 gi|45441153|ref|NP_992692.1| outer membrane protein A [Yersinia pestis biovar Microtus str.
           91001]
 gi|21959622|gb|AAM86287.1|AE013876_5 outer membrane porin A [Yersinia pestis KIM 10]
 gi|45436013|gb|AAS61569.1| putative outer membrane porin A protein [Yersinia pestis biovar
           Microtus str. 91001]
          Length = 363

 Score = 76.4 bits (186), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 34/217 (15%), Positives = 61/217 (28%), Gaps = 32/217 (14%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K   A+ ++   +     AQAA                     Y   +  ++      
Sbjct: 11  MKKT--AIALAVALVGFATVAQAA---------------PKDNTWYTGGKLGWSQYQDTG 53

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGSL 120
           S     + G       G   F GY              +         N  +    G  L
Sbjct: 54  SI--INNDGPTHKDQLGAGAFFGYQANQYLGFEMGYDWLGRMPYKGDINNGAFKAQGVQL 111

Query: 121 RIRGGYEVSDSLLLYATVGPDVAQKYETGKAG------EITPIAIGGTAGVGVEVGGLSE 174
             +  Y V+  L +Y  +G  V +    G               +     +G E    ++
Sbjct: 112 AAKLSYPVAQDLDVYTRLGGLVWRADAKGSFDGGLDRASGHDTGVSPLVALGAEY-AWTK 170

Query: 175 SLVARLEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
           +   R+EY+          V    +   +S+GV  +F
Sbjct: 171 NWATRMEYQWVNNIGDRETVGARPDNGLLSVGVSYRF 207


>gi|237731623|ref|ZP_04562104.1| outer membrane protein A [Citrobacter sp. 30_2]
 gi|226907162|gb|EEH93080.1| outer membrane protein A [Citrobacter sp. 30_2]
          Length = 348

 Score = 76.4 bits (186), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 26/175 (14%), Positives = 54/175 (30%), Gaps = 15/175 (8%)

Query: 45  RYVPIRHDFNGPYAG------LSALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGD 98
            Y   +  ++  +         +             N GG +F GY +     + G    
Sbjct: 28  WYAGGKFGWSHYFDTSASQQTGANGNKYGDVGFDSDNVGGGVFTGYQITPWLAVEGGYDY 87

Query: 99  VRYTVPVLADNIHSLH--GIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITP 156
           +        +          G  L ++  Y ++D+  LY   G    +     K      
Sbjct: 88  LGNMQFNGKNGASGSQMKSQGLQLSLKASYGLTDNWDLYGRAGAMGYRAESDIKGNNRFD 147

Query: 157 IAIGGTAGVGVEVGGLSESLVARLEYRA-SKYSK-----VEGFYNTISLGVGMKF 205
             +     VG E    +++   R+EY+  S         V    ++++ G+  +F
Sbjct: 148 TGVRPVVAVGTEY-AFNKNWAGRVEYQWVSNVGNENQIGVSSDVSSVTAGLSYRF 201


>gi|312270731|gb|ADQ55766.1| OmpA [Haemophilus parasuis]
 gi|312270733|gb|ADQ55767.1| OmpA [Haemophilus parasuis]
          Length = 367

 Score = 76.4 bits (186), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 42/231 (18%), Positives = 78/231 (33%), Gaps = 35/231 (15%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K  +A+ VS LA+AS   A AA      + G +    T   +       +        
Sbjct: 1   MKKSLIALAVSGLAVASV--ANAAPQANSFYVGAKAGWATFHNDI------NQLNFKYKN 52

Query: 61  SALYNGSFGE--EAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGG 118
            A Y     +     ++    +F GY + D+  +               +     H   G
Sbjct: 53  DARYATGRTDLGINRNSVTYGVFGGYQIIDNLAVELGYDYFGRVRGNKQEFRAFKHSAHG 112

Query: 119 S-LRIRGGYEVSDSLLLYATVGPDVAQKYETGK-------AGEITPIAIGGTAGVGVEVG 170
           + L ++  YEV + L +Y  VG  + +               +   +      G GVE  
Sbjct: 113 THLSLKPSYEVLNGLDVYGKVGAALVRNDYKRYSQTAGVQTQKAHNLKTSLVLGAGVEY- 171

Query: 171 GLSESLVARLEYRAS----KYSKVEG------------FYNTISLGVGMKF 205
            +   L  R+EY+       ++K E               ++++ G+  +F
Sbjct: 172 AILPELAFRVEYQWLSNVGNFTKAEMKENRRATYNYSPDSHSVTAGISYRF 222


>gi|316932401|ref|YP_004107383.1| putative outer-membrane immunogenic protein [Rhodopseudomonas
           palustris DX-1]
 gi|315600115|gb|ADU42650.1| putative outer-membrane immunogenic protein precursor; putative
           secreted protein [Rhodopseudomonas palustris DX-1]
          Length = 235

 Score = 76.0 bits (185), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 41/229 (17%), Positives = 67/229 (29%), Gaps = 28/229 (12%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K+ L  G  +L +     A AAD   R +       P    N          G     
Sbjct: 1   MKKILL--GTVALIVLGAAPAVAADLAARPYTKAPAYAPAPIYNWTGFYIGGHIGGAFSG 58

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVED-SCIMYGVEGDVRYTVPVLADNIHSL------ 113
                       +    G + AGY+ +     + GVEG   +                  
Sbjct: 59  DNSIGTGVTASDNGKFLGGVQAGYDWQFAPNWVLGVEGQYSWLSGTNQSVAFVDGLGNSY 118

Query: 114 -----HGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYE----TGKAGEITPIAIGGTAG 164
                     S+  R GY    +LL Y   G   A         G    +     G T G
Sbjct: 119 LFSDNQRGLASVTGRLGYTWGPALL-YVKGGWAYADYSTSLTVNGFGVAVDSKTDGYTVG 177

Query: 165 VGVEVGGLSESLVARLEYRASKYSKV--------EGFYNTISLGVGMKF 205
            G+E    + +   ++EY+   +  V        +   + +  G+  +F
Sbjct: 178 GGLEY-LFAPNWSGKIEYQYYDFGNVNLGNGFSAKNDEHVVKAGLNYRF 225


>gi|227111637|ref|ZP_03825293.1| outer membrane protein A [Pectobacterium carotovorum subsp.
           brasiliensis PBR1692]
          Length = 361

 Score = 76.0 bits (185), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 37/224 (16%), Positives = 66/224 (29%), Gaps = 40/224 (17%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K   A+ V+    +    AQAA                     Y   +   +  +   
Sbjct: 1   MKKT--AIAVAVALASFATVAQAA---------------PKDNTWYTGGKLGVSQFHDTG 43

Query: 61  SAL--YNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGG 118
                Y G          G   F GY    +    G E    +   +      +      
Sbjct: 44  FYGNGYTGINNNPIKSKLGAGAFVGYQ---ANPYLGFELGYDWLGRMKYAGSTANAADSA 100

Query: 119 SLR-------IRGGYEVSDSLLLYATVGPDVAQKY----ETGKAGEITPIAIGGTAGVGV 167
           S +        +  Y V   L +Y+ +G  V +        G         +   A VGV
Sbjct: 101 SFKAQGIQLAAKLSYPVLPDLDVYSRLGGMVWRADSHAAIGGGDINNDDTGVSPLAAVGV 160

Query: 168 EVGGLSESLVARLEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
           E   + ++  AR++Y+          V    +   +S+G+  +F
Sbjct: 161 EY-AIDKNWAARVDYQWVSNIGDAGTVGARPDNLLMSVGLSYRF 203


>gi|316932343|ref|YP_004107325.1| porin [Rhodopseudomonas palustris DX-1]
 gi|315600057|gb|ADU42592.1| porin [Rhodopseudomonas palustris DX-1]
          Length = 448

 Score = 76.0 bits (185), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 34/202 (16%), Positives = 56/202 (27%), Gaps = 43/202 (21%)

Query: 46  YVPIRHDFNGPYAGLSALYNGSFGEEA-------------HHNAGGSIFAGYNVEDSCIM 92
             P   ++ G Y G +     +    +                  G    GYN +    +
Sbjct: 240 VAPPPANWAGLYIGGNFGGATARDRSSVTIAGVTDAFNLAPDGFFGGGQIGYNWQAVNWV 299

Query: 93  YGVEGDVRYTVPVLADN--------IHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQ 144
           +GVE D + +                 +     G+ R R GY +  S L Y T G     
Sbjct: 300 FGVEADFQGSTLKDQRAAVLGPAVFYDAKLPWFGTARGRIGYSLG-STLFYGTAGYAYGN 358

Query: 145 KYETGKAGEIT----PIAIGGTAGVGVE-----VGGLSESLVARLEYRASKYSK------ 189
                 +            G  AG G+E      G L  +  ++ EY             
Sbjct: 359 IKTDIVSAIGNYSFKTTKGGWAAGAGIETPFQLFGLLGPNWTSKTEYLYVDLGSTTDAFG 418

Query: 190 ------VEGFYNTISLGVGMKF 205
                  +   +T+  G+   F
Sbjct: 419 ATGINTTKVTQHTLRTGINYHF 440



 Score = 68.3 bits (165), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 46/247 (18%), Positives = 74/247 (29%), Gaps = 58/247 (23%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+++   V    LA  +  SAQAAD   +A                V   +D+ G Y G 
Sbjct: 1   MKRILAGV---VLAGTAAVSAQAADLAVKAP----------YMKAPVAAVYDWTGFYIGA 47

Query: 61  SALYNGSFGEEAHHNAGGS---------------IFAGYNVEDSC----IMYGVEGDVRY 101
           +         + H   G                    GYN +       ++ GVE D++ 
Sbjct: 48  NVGVGLGRDLQTHSYPGAGTLNSTYLQPQGAIGGGQIGYNWQFGSMFGPMLIGVEADIQG 107

Query: 102 TVPVLA--------DNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAG- 152
           +              N +      G++R R G     +   Y T G  V     T   G 
Sbjct: 108 SGMSDGYTSLNGLATNYNQKLDWFGTVRGRVGLVRGPAF-GYFTGGYAVGNVKTTVTEGG 166

Query: 153 ----EITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFYNT-----------I 197
               + +    G   G GVE   L  +   ++EY          F+              
Sbjct: 167 LVAFDNSKTRSGWVIGSGVE-AALGGNWSGKIEYLYLDLGNQTDFFGNQSLRTEARESIF 225

Query: 198 SLGVGMK 204
            +G+  +
Sbjct: 226 RVGLNYR 232


>gi|296444784|ref|ZP_06886747.1| hypothetical protein MettrDRAFT_0463 [Methylosinus trichosporium
           OB3b]
 gi|296257732|gb|EFH04796.1| hypothetical protein MettrDRAFT_0463 [Methylosinus trichosporium
           OB3b]
          Length = 1115

 Score = 76.0 bits (185), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 39/240 (16%), Positives = 64/240 (26%), Gaps = 50/240 (20%)

Query: 2   QKLFLAVGV-SSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNG----- 55
           +++  +V   S        SA AA+P      G          +  +   + ++      
Sbjct: 22  KRIVASVAAYSLFCPLGAGSAIAAEPSAAKSAGAASPPMWTGFHAGLNGGYGWSSDTKAQ 81

Query: 56  -------------------PYAGLSALYNGSFGEEAHHNAGGSIFAGYNVEDS-CIMYGV 95
                              P    +     S    A     G +  GY+       + GV
Sbjct: 82  LTVTPLEPPLLYVPPDRVPPSDNFARDATRSIARSASGAFIGGLQLGYDWAFGERYVVGV 141

Query: 96  EGDVRYTVPVLADNIHSL----------HGIGGSLRIRGGYEVSDSLLLYATVGPDVA-- 143
           E D + +V    +                   G+LR R G   + SLL+Y T G      
Sbjct: 142 EADFQGSVGGHGEATTYSPSTVFVTANQLDYLGTLRGRLGVLATPSLLVYGTAGAAYGGP 201

Query: 144 -----------QKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEG 192
                        +      +     +G  AG GVE          + EY       + G
Sbjct: 202 ATRTQITQPGAGVFGGYGESQTDRTRLGWAAGAGVE-WMFDPKWSLKAEYLHYDLGSIGG 260



 Score = 66.4 bits (160), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 31/161 (19%), Positives = 51/161 (31%), Gaps = 34/161 (21%)

Query: 68   FGEEAHHNAGGSIFAGYNVEDS-CIMYGVEGDVRYTVPVLADN----------------- 109
             G+       G    G N + +   + G+E D+R +                        
Sbjct: 919  SGDVGLAGFVGGFQIGGNQKLNARFVAGLEADLRGSFGNSGSRSQFGTSTSIGNTFLSFG 978

Query: 110  -IHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEI-------------- 154
                     G++R R GY V+  + LYAT G   A    + +                  
Sbjct: 979  QTTVRLNYLGTIRPRLGYLVTPDVQLYATGGLAFAGLTSSAEMVTDRVGGITTTVGDPLY 1038

Query: 155  TPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFYN 195
                +G TAG GVE   L+ +  A+ EY      ++    +
Sbjct: 1039 QDTRLGWTAGGGVE-WALAPNWTAKAEYLHYDLGQIRVRTD 1078


>gi|13470446|ref|NP_102014.1| outer membrane protein [Mesorhizobium loti MAFF303099]
 gi|14021187|dbj|BAB47800.1| outer membrane protein [Mesorhizobium loti MAFF303099]
          Length = 221

 Score = 76.0 bits (185), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 49/235 (20%), Positives = 76/235 (32%), Gaps = 52/235 (22%)

Query: 6   LAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYN 65
           L V  + L       A AADP                         D+ G YAGL A Y 
Sbjct: 4   LVVASAGLLAVLSVPALAADPTVDVPMTAP--------------GFDWTGYYAGLQAGYG 49

Query: 66  GSFGEEA-------------HHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLA----- 107
               + +             +    G   AG   +    + G E D+ Y+          
Sbjct: 50  WGQSDISGTEGEPFSVSPDINGGFVGGHIAG-LWQFDQAVIGAEADLNYSSVNGTAEAEP 108

Query: 108 -DNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAG---EITPIAIGGTA 163
            +N  +     GS+  + GY + D +L+Y   G   A    +  AG     T   +G T 
Sbjct: 109 GNNFGTDIKWFGSVNAKAGYAM-DRVLVYGIGGVAFAGIETSQSAGSAFSETRANVGWTL 167

Query: 164 GVGVEVGGLSESLVARLEYRASKYS-------------KVEGFYNTISLGVGMKF 205
           G GV+   L++  V   +YR   +                +   NT+ + +  KF
Sbjct: 168 GAGVDY-ALTDKFVVGAQYRYYDFGSEHYDGSSDFVGRDQDTKLNTVGINLSYKF 221


>gi|110086793|gb|ABG49460.1| hemagglutinin antigen [Avibacterium paragallinarum]
          Length = 345

 Score = 76.0 bits (185), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 37/225 (16%), Positives = 72/225 (32%), Gaps = 37/225 (16%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAG- 59
           M+K   A+ ++   L +   AQAA                 A   Y   +  +   + G 
Sbjct: 1   MKKT--AIALAIAGLTAASVAQAA---------------PQANTFYAGAKAGWASFHDGL 43

Query: 60  LSALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGS 119
                  +      ++    +F GY + D+  +     D               H   G+
Sbjct: 44  NQFEDQENAQGTLRNSVTYGVFGGYQITDNFAVELGYDDFGRAKLRKGGETVIKHTNHGA 103

Query: 120 -LRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPI-------AIGGTAGVGVEVGG 171
            L ++  Y V + L +YA VG  + +          +          +      G+E   
Sbjct: 104 HLSLKASYPVLEGLDIYARVGAALIRSDYKSTKRAESDYVMHEHSLKVSPVFAGGLEYNL 163

Query: 172 LS-ESLVARLEYRAS--------KYSKVEGFYN--TISLGVGMKF 205
            S   L  R+EY+            S+V+   +  +++ G+  +F
Sbjct: 164 PSLPELALRVEYQWVNKVGRVEKDGSRVDYTPSIGSVTAGLSYRF 208


>gi|330860773|emb|CBX71062.1| outer membrane protein A [Yersinia enterocolitica W22703]
          Length = 363

 Score = 75.6 bits (184), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 35/220 (15%), Positives = 62/220 (28%), Gaps = 33/220 (15%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K   A+ ++         AQAA                     Y   +  ++      
Sbjct: 7   MKKT--AIALAVALAGFATVAQAA---------------PKDNTWYTGGKLGWSQYQNTG 49

Query: 61  SAL-YN--GSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIG 117
           +   Y   G+ G       G   F GY              +                 G
Sbjct: 50  TGGIYGDQGNDGPTHKDQLGAGAFLGYQANQYLGFEMGYDWLGRMPYKGDVRNGDFKAQG 109

Query: 118 GSLRIRGGYEVSDSLLLYATVGPDVAQKY------ETGKAGEITPIAIGGTAGVGVEVGG 171
             L  +  Y ++  L LY  +G  V +         TG         +     +G E   
Sbjct: 110 VQLAAKLSYPIAQDLDLYTRLGGMVWRADSSAFDATTGARANNHDTGVSPLVALGAEY-A 168

Query: 172 LSESLVARLEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
            +++   R+EY+        + V    +   +S+GV  +F
Sbjct: 169 WTKNWATRMEYQWVSNIGDKATVGARPDNGMLSVGVSYRF 208


>gi|146337818|ref|YP_001202866.1| putative outer membrane protein A-like (OmpA-like) [Bradyrhizobium
           sp. ORS278]
 gi|146190624|emb|CAL74626.1| Conserved hypothetical protein; putative outer membrane Protein
           A-like (OmpA-like) [Bradyrhizobium sp. ORS278]
          Length = 673

 Score = 75.6 bits (184), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 38/233 (16%), Positives = 70/233 (30%), Gaps = 34/233 (14%)

Query: 2   QKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRG-VVPTIATNRYVPIRHDFNGPYAGL 60
           +++ +A  + +       S  AAD   +A           +    +     D        
Sbjct: 17  REMLVAGTMLAGLGPLATSVAAADLPVKARMAQTVFDWTGLYVGAHAGYTRDHASATLSD 76

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNV-EDSCIMYGVEGDVRYTVPVLADNIHSLH----- 114
                 +      +   G + AGYN    S ++ G+EGD  +   + +++  ++      
Sbjct: 77  PTGVASAGSR--FNGLTGGVQAGYNWVTRSGLLLGLEGDFSFPNYLTSNHTVAMLGTPGA 134

Query: 115 ------GIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEIT-----PIAIGGTA 163
                     + R R GY  +   L YAT G                        +G  A
Sbjct: 135 SVSELWDYVATARGRVGYA-NGDWLAYATGGVAWTGGRFINTDPAGNTEKRLTTRLGWVA 193

Query: 164 GVGVEVGGLSESLVARLEYRASKYSKVEG------------FYNTISLGVGMK 204
           G G+E    +     RLEY    +                  + T+ +G+  K
Sbjct: 194 GAGIE-RAFAPDWSWRLEYLYYGFENGGVRFGNGASYNSALDFQTLRVGLNRK 245


>gi|197284675|ref|YP_002150547.1| outer membrane protein A [Proteus mirabilis HI4320]
 gi|194682162|emb|CAR41796.1| outer membrane protein A [Proteus mirabilis HI4320]
          Length = 362

 Score = 75.6 bits (184), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 31/184 (16%), Positives = 54/184 (29%), Gaps = 19/184 (10%)

Query: 40  TIATNRYVPIRHDFNGPYAGLSA--LYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEG 97
                 Y   +  ++   +  +     N   G       G   FAGY             
Sbjct: 23  PKDNTWYTGGKLGWSQYQSTGNNWDGVNIGNGSTHKDQIGAGAFAGYQYNQYLGFELGYD 82

Query: 98  DVRYTVPVLADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGK------- 150
            +       + N  +    G  L  +  Y V D L +Y  +G  V +   T         
Sbjct: 83  WLGRMAYKGSYNNGAFKAQGIQLTTKLSYPVMDDLDVYTRLGGMVWRADSTATINATSAG 142

Query: 151 ---AGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFYNT------ISLGV 201
                      +     +G E   ++ ++  RLEY+       +G  N       +S+GV
Sbjct: 143 TQKRFSENDTGVSPVFALGTEY-AITPNIATRLEYQWINNIGDKGTLNARPDNGMLSVGV 201

Query: 202 GMKF 205
             +F
Sbjct: 202 AYRF 205


>gi|46202723|ref|ZP_00052712.2| COG3659: Carbohydrate-selective porin [Magnetospirillum
           magnetotacticum MS-1]
          Length = 693

 Score = 75.6 bits (184), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 39/227 (17%), Positives = 62/227 (27%), Gaps = 53/227 (23%)

Query: 13  LALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSFG--- 69
           +       A  AD      H         +   +      + G        +    G   
Sbjct: 1   MLAGLSTGAHGADLATPTPHDA---THLPSFGTWAGGYTGWQGSAGDAFGDFGFGSGMIG 57

Query: 70  ------------------EEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIH 111
                                   A G +F GY  +    +YGVE DV  T      +  
Sbjct: 58  RRSVPEFRTGDATGRNDAGRNATTALGGLFGGYAWQIGPFVYGVEADVDATNLKRPVSST 117

Query: 112 S-----------------LHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEI 154
           +                    + G+ R R GY   +  L+YA+ G   AQ        + 
Sbjct: 118 TPGFGFEGLDPAFPVIRAKADVFGTARARVGYAF-ERYLVYASFGLAGAQVRFLTNFPDP 176

Query: 155 TPIA----------IGGTAGVGVEVGGLSESLVARLEYRASKYSKVE 191
              +          +G + G G+E   ++E L   LEYR     +  
Sbjct: 177 ATTSAPALRRGRAFLGFSLGAGIEY-AITEHLALGLEYRYLDLGRSG 222


>gi|322832273|ref|YP_004212300.1| OmpA/MotB domain protein [Rahnella sp. Y9602]
 gi|321167474|gb|ADW73173.1| OmpA/MotB domain protein [Rahnella sp. Y9602]
          Length = 358

 Score = 75.6 bits (184), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 38/220 (17%), Positives = 66/220 (30%), Gaps = 33/220 (15%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K   A+ ++         AQAA                     Y   +  ++  +   
Sbjct: 1   MKKT--AIALAVALAGFATVAQAA---------------PKDNTWYTGGKLGWSQYHDTG 43

Query: 61  SALY--NGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGG 118
            A        G       G   F GY              +       + N  +    G 
Sbjct: 44  FANAYNGIGNGPTHESQLGAGAFLGYQANQYLGFEMGYDWLGRMPYKGSVNNGAFKAQGV 103

Query: 119 SLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGE-------ITPIAIGGTAGVGVEVGG 171
            L  +  Y ++D L LY  +G  V +    G                +   A VGVE   
Sbjct: 104 QLAAKLSYPLTDDLDLYTRLGGMVWRADAKGNFNNGANGRVSDHDTGVSPLAAVGVEY-A 162

Query: 172 LSESLVARLEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
           ++++   RL+Y+        + V    +   +S+GV  +F
Sbjct: 163 VTKNWATRLDYQWVNNIGDAATVGARPDNAMLSVGVSYRF 202


>gi|85713475|ref|ZP_01044465.1| carbohydrate-selective porin OprB [Nitrobacter sp. Nb-311A]
 gi|85699379|gb|EAQ37246.1| carbohydrate-selective porin OprB [Nitrobacter sp. Nb-311A]
          Length = 668

 Score = 75.6 bits (184), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 41/204 (20%), Positives = 65/204 (31%), Gaps = 43/204 (21%)

Query: 42  ATNRYVPIRHDFNGPYAGLSALYNGSFG------------EEAHHNAGGSIFAGYNVEDS 89
            T         + G Y G  A + G                         + AGYN++  
Sbjct: 39  PTKAVPHPIIQWTGLYLGAHAGFGGGRSTATLADPAPITTGNDFGGLISGVQAGYNLQLP 98

Query: 90  C-IMYGVEGDVRYTVPVLADNIHSLH-----------GIGGSLRIRGGYEVSDSLLLYAT 137
             ++ GVE D+ +   + +++  S                GS R R GY      L YAT
Sbjct: 99  SGLLLGVETDISFPSYIESNSFVSKLATARSDVTHQWDFIGSARGRIGYATGP-WLTYAT 157

Query: 138 VGPDVAQKYETGKAGEIT-----PIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEG 192
            G  +A +                  +G  AG G+E    +    ARLEY   ++ K   
Sbjct: 158 GGLAIAGERYLNDPPSGDREKTLGSRLGWVAGAGLEY-AFAPHWSARLEYLYYQFDKTNV 216

Query: 193 ------------FYNTISLGVGMK 204
                        + +I +G+  K
Sbjct: 217 QFPSAAQYTATMDFQSIRVGLNRK 240


>gi|288225947|gb|ADC44458.1| OmpA [Candidatus Erwinia dacicola]
          Length = 324

 Score = 75.6 bits (184), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 32/176 (18%), Positives = 55/176 (31%), Gaps = 20/176 (11%)

Query: 46  YVPIRHDFNGPYAGLSAL--YNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTV 103
           Y   +  ++  +        Y  + G       G   F GY    +    G E    +  
Sbjct: 1   YTGAKLGWSQYHDKGYYGNSYQDNDGPSHESQLGAGAFLGYQ---ANPYLGFELGYDWLG 57

Query: 104 PVLADNIHSLHGIGG---SLRIRGGYEVSDSLLLYATVGPDVAQKYET-----GKAGEIT 155
            +                 L  +  Y V D L +Y  +G  V +   T     G      
Sbjct: 58  RMPNKGYQVNGAFKAQGVQLAAKLSYPVMDDLDVYTRLGGIVWRVDSTQQVVGGDRISDH 117

Query: 156 PIAIGGTAGVGVEVGGLSESLVARLEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
              +   A VGVE   ++++   RL+Y+          V    +   +S+GV  +F
Sbjct: 118 DTGVSPLAAVGVEY-AVTKNWATRLDYQWVNNIGDAGTVGARSDNSMLSVGVSYRF 172


>gi|238792361|ref|ZP_04635995.1| Outer membrane protein A [Yersinia intermedia ATCC 29909]
 gi|238728287|gb|EEQ19807.1| Outer membrane protein A [Yersinia intermedia ATCC 29909]
          Length = 358

 Score = 75.6 bits (184), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 36/220 (16%), Positives = 64/220 (29%), Gaps = 33/220 (15%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K   A+ ++         AQAA                     Y   +  ++      
Sbjct: 1   MKKT--AIALAVALAGFATVAQAA---------------PKDNTWYTGGKLGWSQYQDTG 43

Query: 61  SAL-YN--GSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIG 117
           +   Y   G+ G    +  G   F GY              +         N  +    G
Sbjct: 44  TGGIYGDVGNDGPTHKNQLGAGAFLGYQANQYLGFEMGYDWLGRMPYKGDVNNGAFKAQG 103

Query: 118 GSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEIT------PIAIGGTAGVGVEVGG 171
             L  +  Y V+  L LY  +G  V +   +                +     +G E   
Sbjct: 104 VQLAAKLSYPVAQDLDLYTRLGGMVWRADSSAYDAPTDTRSSNHDTGVSPLVALGAEY-A 162

Query: 172 LSESLVARLEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
            +++   R+EY+        + V    +   +SLGV  +F
Sbjct: 163 WTKNWATRMEYQWVSNIGDRATVGARPDNGMLSLGVSYRF 202


>gi|153947861|ref|YP_001401507.1| outer membrane protein A [Yersinia pseudotuberculosis IP 31758]
 gi|152959356|gb|ABS46817.1| outer membrane protein A [Yersinia pseudotuberculosis IP 31758]
          Length = 357

 Score = 75.6 bits (184), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 34/217 (15%), Positives = 61/217 (28%), Gaps = 32/217 (14%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K   A+ ++   +     AQAA                     Y   +  ++      
Sbjct: 5   MKKT--AIALAVALVGFATVAQAA---------------PKDNTWYTGGKLGWSQYQDTG 47

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGSL 120
           S     + G       G   F GY              +         N  +    G  L
Sbjct: 48  SI--INNDGPTHKDQLGAGAFFGYQANQYLGFEMGYDWLGRMPYKGDINNGAFKAQGVQL 105

Query: 121 RIRGGYEVSDSLLLYATVGPDVAQKYETGKAG------EITPIAIGGTAGVGVEVGGLSE 174
             +  Y V+  L +Y  +G  V +    G               +     +G E    ++
Sbjct: 106 AAKLSYPVAQDLDVYTRLGGLVWRADAKGSFDGGLDRASGHDTGVSPLVALGAEY-AWTK 164

Query: 175 SLVARLEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
           +   R+EY+          V    +   +S+GV  +F
Sbjct: 165 NWATRMEYQWVNNIGDRETVGARPDNGLLSVGVSYRF 201


>gi|315498453|ref|YP_004087257.1| porin [Asticcacaulis excentricus CB 48]
 gi|315416465|gb|ADU13106.1| porin [Asticcacaulis excentricus CB 48]
          Length = 199

 Score = 75.2 bits (183), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 38/175 (21%), Positives = 67/175 (38%), Gaps = 14/175 (8%)

Query: 43  TNRYVPIRHDFNGPYAGLSALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYT 102
                   +         SA        +   N    +  G+N + +  ++GVE D+ + 
Sbjct: 27  PYIAGQGGYAKTKLEVTYSAGTTTESASDDTGNGAAGVILGFNAQSNGAVFGVETDLNWN 86

Query: 103 VPVL-----ADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPI 157
                     + + +     G++R R G+ VS + L Y   G    + Y      + T  
Sbjct: 87  NAKDRYRVLGEEVETGIDYSGAVRARLGF-VSGNTLFYGAAGVAGTRAYVEYDGEKETET 145

Query: 158 AIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGF-------YNTISLGVGMKF 205
             G TAG+G +    S+ +  R+EYR + +  VE           ++ LG+GMKF
Sbjct: 146 VAGWTAGIGAD-HAFSDRVFGRIEYRYTDFGDVEDDGVKAELMQQSVWLGLGMKF 199


>gi|49182352|gb|AAT57678.1| OmpA [Pasteurella multocida]
          Length = 348

 Score = 75.2 bits (183), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 38/231 (16%), Positives = 73/231 (31%), Gaps = 44/231 (19%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAG- 59
           M+K   A+ ++ +ALA    AQAA                     YV  +  +   + G 
Sbjct: 1   MKKT--AIALTIVALAVASVAQAA---------------PQPNTFYVGAKAGWASFHDGL 43

Query: 60  LSALY-NGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGG 118
               Y + +      ++    +F GY + D+  +     D             +      
Sbjct: 44  NQIEYVSKTSFGSKRNSVTYGVFGGYQITDNFAVELGYDDFGRAKVRANSKTTAFDAAKH 103

Query: 119 S-----LRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITP--------IAIGGTAGV 165
           +     L ++  Y + D L +YA VG  + +      A  I            +      
Sbjct: 104 TNHGTHLSLKASYPLLDGLDVYARVGAALIRSDYKLYAPLINKRLSPHFKITQVSPVFAG 163

Query: 166 GVEVGGLSESLVARLEYRASK-----------YSKVEGFYNTISLGVGMKF 205
           G+E   +   L  R+EY+              Y+       +++ G+  +F
Sbjct: 164 GLEYAFI-PELTLRVEYQWVNNVGKFEYADGQYADFRPDIGSVTAGLSYRF 213


>gi|315179386|gb|ADT86300.1| outer membrane protein OmpA [Vibrio furnissii NCTC 11218]
          Length = 332

 Score = 75.2 bits (183), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 35/208 (16%), Positives = 59/208 (28%), Gaps = 42/208 (20%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K  LA  VS+  L +  +A A                 +     V      +      
Sbjct: 1   MKK--LAAMVSASLLVASSAAMA----------------DVYVGAKVGKTWLDDACN--- 39

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGSL 120
                 +               GYN         +EG   Y        +        +L
Sbjct: 40  ------NTESCDLDGTTAGALLGYNF---NDWLALEGGYDYLGKFNGAGLDRDTIQAYTL 90

Query: 121 RIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARL 180
             +  Y +++   LY  VG    +                     GVE    + +L  R+
Sbjct: 91  APKLSYALTEQWDLYGKVGAARVR--------YGDASDYSYLGAAGVEYAA-TRNLGVRV 141

Query: 181 EYRA-SKYSK--VEGFYNTISLGVGMKF 205
           EY+  S  +   V    +T +LG+  +F
Sbjct: 142 EYQYLSDMNNDVVRAKAHTTTLGLVYRF 169


>gi|288225941|gb|ADC44455.1| OmpA [Candidatus Erwinia dacicola]
 gi|288225945|gb|ADC44457.1| OmpA [Candidatus Erwinia dacicola]
          Length = 324

 Score = 75.2 bits (183), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 32/176 (18%), Positives = 55/176 (31%), Gaps = 20/176 (11%)

Query: 46  YVPIRHDFNGPYAGLSAL--YNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTV 103
           Y   +  ++  +        Y  + G       G   F GY    +    G E    +  
Sbjct: 1   YTGAKLGWSQYHDKGYYGNSYQDNDGPSHESQLGAGAFLGYQ---ANPYLGFELGYDWLG 57

Query: 104 PVLADNIHSLHGIGG---SLRIRGGYEVSDSLLLYATVGPDVAQKYET-----GKAGEIT 155
            +                 L  +  Y V D L +Y  +G  V +   T     G      
Sbjct: 58  RMPNKGYQVNGAFKAQGVQLAAKLSYPVMDDLDVYTRLGGIVWRVDSTQQVVGGDRISDH 117

Query: 156 PIAIGGTAGVGVEVGGLSESLVARLEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
              +   A VGVE   ++++   RL+Y+          V    +   +S+GV  +F
Sbjct: 118 DTGVSPLAAVGVEY-AVTKNWATRLDYQWVNNIGDAGTVGARSDNSMLSVGVSYRF 172


>gi|159044248|ref|YP_001533042.1| hypothetical protein Dshi_1699 [Dinoroseobacter shibae DFL 12]
 gi|157912008|gb|ABV93441.1| hypothetical protein Dshi_1699 [Dinoroseobacter shibae DFL 12]
          Length = 198

 Score = 75.2 bits (183), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 42/202 (20%), Positives = 66/202 (32%), Gaps = 20/202 (9%)

Query: 12  SLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSFGEE 71
            +ALA   +   A  +  +          +A    V    D+ G Y G    Y       
Sbjct: 9   VVALALPLALFGAPSLAGSLEDPVVEPVPMAPAPVVVSGRDWTGGYVGAQIGYGDVGTNA 68

Query: 72  AH---HNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGSLRIRGGYEV 128
           +        G + AGY+ +    + G   D       L     +       L++R G+E 
Sbjct: 69  SGVDGDGLIGGLIAGYDYDFGSYVLGAGIDYDIADIDLGP---ASLEDVLRLKLRAGFEA 125

Query: 129 SDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYS 188
             S L+YAT G   A                G  AG GVE   LS++L    E    ++ 
Sbjct: 126 GPS-LIYATGGYARAGTD-------NLGSDDGWFAGAGVEY-PLSQNLSLAGEVLYHEFD 176

Query: 189 K-----VEGFYNTISLGVGMKF 205
                 V+    T+   +  +F
Sbjct: 177 DFDGSGVDVDATTVQARLAYRF 198


>gi|83942577|ref|ZP_00955038.1| outer membrane protein, putative [Sulfitobacter sp. EE-36]
 gi|83846670|gb|EAP84546.1| outer membrane protein, putative [Sulfitobacter sp. EE-36]
          Length = 202

 Score = 75.2 bits (183), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 45/216 (20%), Positives = 72/216 (33%), Gaps = 25/216 (11%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M++       + LA  +F  A  A  +           P  A +       D+ G Y GL
Sbjct: 1   MKRTMKLASAAVLASTAFAGATYAGSLAEPVVEPVMTAPVPAPDLGG----DWTGFYTGL 56

Query: 61  SALYNGSFGEEA--HHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADN---IHSLHG 115
              Y+ +  +      N      AGYN +    + G E D   T   L D          
Sbjct: 57  QLGYSDAEVDNGLEGDNGSYGFHAGYNYDFGRFVLGGELDYDKTDIDLDDAAGVTQGSID 116

Query: 116 IGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSES 175
                +I+GGY++  S L+YAT G   A                G   G+G++   ++E 
Sbjct: 117 SVARAKIKGGYDLG-STLIYATGGYARADTSL--------GDEDGAFYGIGMDY-KITEQ 166

Query: 176 LVARLEYRASKYSKV------EGFYNTISLGVGMKF 205
                E    K+  V      +    T ++    +F
Sbjct: 167 YSVGAELLEHKFDDVNGVSGDDADVTTFNIRGSYRF 202


>gi|329755858|gb|AEC04326.1| outer membrane protein A [Pasteurella multocida]
          Length = 348

 Score = 74.8 bits (182), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 36/231 (15%), Positives = 72/231 (31%), Gaps = 44/231 (19%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAG- 59
           M+K  +A+ + +LA+AS   A                        YV  +  +   + G 
Sbjct: 1   MKKTAIALTIVALAVASVAQA-----------------VPQPNTFYVGAKAGWASFHDGL 43

Query: 60  LSALY-NGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGG 118
               Y + +      ++    +F GY + D+  +     D             +      
Sbjct: 44  NQIEYKSKTSFGSKRNSVTYGVFGGYQITDNFAVELGYDDFGRAKVRANSKTTAFDAAKH 103

Query: 119 S-----LRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITP--------IAIGGTAGV 165
           +     L ++  Y + D L +YA VG  + +      A  I            +      
Sbjct: 104 TNHGTHLSLKASYPLLDGLDVYARVGAALIRSDYKLYAPLINKRLSPHFKITQVSPVFAG 163

Query: 166 GVEVGGLSESLVARLEYRASK-----------YSKVEGFYNTISLGVGMKF 205
           G+E   +   L  R+EY+              Y+       +++ G+  +F
Sbjct: 164 GLEYAFI-PELTLRVEYQWVNNVGKFEYADGQYADFRPDIGSVTAGLSYRF 213


>gi|89073281|ref|ZP_01159811.1| hypothetical outer membrane protein OmpA [Photobacterium sp. SKA34]
 gi|89050991|gb|EAR56455.1| hypothetical outer membrane protein OmpA [Photobacterium sp. SKA34]
          Length = 326

 Score = 74.8 bits (182), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 42/204 (20%), Positives = 67/204 (32%), Gaps = 25/204 (12%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K+FL +    LA +   S  A                +     Y+  R   +      
Sbjct: 1   MKKIFLMIP---LAFSVSNSVHA----------------STDNPWYIGARAGASFLTNMD 41

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGSL 120
            A    S  E    N  G +FAGY V     +      +      L +   S    G  L
Sbjct: 42  DA--VTSVSEIQDTNFTGGVFAGYQVTPWFALETGYTHLG--NAKLDNKQGSYEAQGADL 97

Query: 121 RIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARL 180
             +  Y +SD++ ++A  G         G     +      TAG G+E   +++S   RL
Sbjct: 98  VTKFSYAISDNVDIFAKAGAFYYDWNAIGSGVIKSDNGWSSTAGAGLEY-FINKSFSTRL 156

Query: 181 EYRASKYSKVEGFYNTISLGVGMK 204
           EY+           +   LG+   
Sbjct: 157 EYQYYN-DVAGPDIHFAGLGLAFH 179


>gi|148254831|ref|YP_001239416.1| hypothetical protein BBta_3415 [Bradyrhizobium sp. BTAi1]
 gi|146407004|gb|ABQ35510.1| putative outer membrane protein of unknown function [Bradyrhizobium
           sp. BTAi1]
          Length = 680

 Score = 74.8 bits (182), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 45/224 (20%), Positives = 68/224 (30%), Gaps = 35/224 (15%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIAT-NRYVPIRHDFNGPYAG 59
           M+++ L   V SLALA      AA              P +     YV     ++   A 
Sbjct: 4   MKRIGLTSAVLSLALAIPGPTDAAPIRSAEADIQAWTGPFLGGHFGYVGGASSWSASNAV 63

Query: 60  LSALYNGSFGEE-----AHHNAGGSIFAGYNVEDS-CIMYGVEGDVRYTVP--------- 104
            +   +              +    + AGYN      ++ GVE DV              
Sbjct: 64  TTVSGSTGVFNSYDVFKGTGSYLFGLQAGYNWTLPSRLVLGVEADVSTPNTVAGERTVTS 123

Query: 105 --VLADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVA---------------QKYE 147
                 +        G+ R R GY   D  LLYAT G   +                   
Sbjct: 124 ASAGTASYRETVLAMGTARARLGYAF-DHWLLYATGGFAWSYDRLERTQLAGLPLVGSAV 182

Query: 148 TGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVE 191
            G         +G  AG+G E   ++    A+ E+ AS++    
Sbjct: 183 AGTVDTALTWRLGWVAGLGAE-LPIAPHWTAKAEFLASEFGSHR 225


>gi|3915781|sp|P24017|OMPA_KLEPN RecName: Full=Outer membrane protein A; AltName: Full=Outer
           membrane protein II; Flags: Precursor
 gi|3201545|emb|CAA04450.1| outer membrane protein A [Klebsiella pneumoniae]
          Length = 344

 Score = 74.8 bits (182), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 30/182 (16%), Positives = 54/182 (29%), Gaps = 15/182 (8%)

Query: 38  VPTIATNRYVPIRHDFNGPYAGLSALYNG--SFGEEAHHNAGGSIFAGYNVEDSCIMYGV 95
                   Y   +  ++  +           + G   +   G   F GY V         
Sbjct: 9   AAPKDNTWYAGGKLGWSQYHDTGFYGNGFQNNNGPTRNDQLGAGAFGGYQVNPYLGFEMG 68

Query: 96  EGDVRYTVPVLADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAG--- 152
              +       + +  +    G  L  + GY ++D L +Y  +G  V +    G      
Sbjct: 69  YDWLGRMAYKGSVDNGAFKAQGVQLTAKLGYPITDDLDIYTRLGGMVWRADSKGNYASTG 128

Query: 153 ---EITPIAIGGTAGVGVEVGGLSESLVARLEYRAS----KYSKVEGFYNT--ISLGVGM 203
                    +      GVE   ++  +  RLEY+          V    +   +SLGV  
Sbjct: 129 VSRSEHDTGVSPVFAGGVE-WAVTRDIATRLEYQWVNNIGDAGTVGTRPDNGMLSLGVSY 187

Query: 204 KF 205
           +F
Sbjct: 188 RF 189


>gi|158425587|ref|YP_001526879.1| putative outer-membrane immunogenic protein [Azorhizobium
           caulinodans ORS 571]
 gi|158332476|dbj|BAF89961.1| putative outer-membrane immunogenic protein [Azorhizobium
           caulinodans ORS 571]
          Length = 202

 Score = 74.8 bits (182), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 36/168 (21%), Positives = 60/168 (35%), Gaps = 19/168 (11%)

Query: 52  DFNGPYAGLSALYNGSF-GEEAHHNAGGSIFAGYNVED--SCIMYGVEGDVRYTVPVLAD 108
            + G Y G +  Y     G ++     G + AGYN++   S I+ G+E D  +      +
Sbjct: 40  SWTGFYVGGNIGYGWGSAGADSPKGFLGGLQAGYNLQMAGSPIVLGLETDFDWAGMNDGN 99

Query: 109 NIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVE 168
                    G++R R G+   D +L+Y T G    +          +  + G   G G E
Sbjct: 100 Y---SQDYIGTVRARAGFAF-DRVLIYGTAGFAYGKGSYQVFGLSNSQTSYGWALGAGAE 155

Query: 169 VGGLSESLVARLEYRASKYS-----------KVEGFYNTISLGVGMKF 205
              +  +  AR EY                  V    + +  GV  +F
Sbjct: 156 Y-AIDRNWSARAEYMYVDLGNSTYGTWVGPTNVSYDTSVLRAGVNYRF 202


>gi|319408966|emb|CBI82625.1| Hemin binding protein E [Bartonella schoenbuchensis R1]
          Length = 303

 Score = 74.8 bits (182), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 27/118 (22%), Positives = 42/118 (35%), Gaps = 24/118 (20%)

Query: 110 IHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQK-------------YETGKAGEITP 156
                   G+ RIR G+  +D ++ Y   G    Q               E     + T 
Sbjct: 188 YTLNQKWTGATRIRIGFA-ADRIMPYIAGGVAYGQFQNILSLSSTATHDKELNNMSDETK 246

Query: 157 IAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEG---------FYNTISLGVGMKF 205
             IG T G G++   +++ ++ R EYR S + K +            N    GV  KF
Sbjct: 247 TMIGYTFGAGIDF-AMTDDIILRAEYRYSDFGKKKFAKDSFELHYKTNDFRAGVSYKF 303



 Score = 36.7 bits (83), Expect = 2.1,   Method: Composition-based stats.
 Identities = 27/140 (19%), Positives = 42/140 (30%), Gaps = 36/140 (25%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M    L +  S   LA+    QAAD +    +   GV P +      P    +NG Y G 
Sbjct: 1   MNTKCL-IATSIFTLAAISLVQAADSIVFKENYKMGVSPIVR-----PPTFSWNGFYIGG 54

Query: 61  SALYNGSFGEEAHH-----------------------------NAGGSIFAGYNVEDSC- 90
                 S      H                                G  +AG NV+ S  
Sbjct: 55  QVGGFSSKISAMSHDNDIPLLPDKSGRPKKWVPVNEKFLPKLSGFIGGFYAGSNVDLSNG 114

Query: 91  IMYGVEGDVRYTVPVLADNI 110
           ++  ++ D+  +     + I
Sbjct: 115 LILSIDTDIILSARKNTNTI 134


>gi|123441891|ref|YP_001005874.1| outer membrane protein A [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|122088852|emb|CAL11658.1| putative outer membrane porin A protein [Yersinia enterocolitica
           subsp. enterocolitica 8081]
          Length = 357

 Score = 74.8 bits (182), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 34/220 (15%), Positives = 62/220 (28%), Gaps = 33/220 (15%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K   A+ ++         AQAA                     Y   +  ++      
Sbjct: 1   MKKT--AIALAVALAGFATVAQAA---------------PKDNTWYTGGKLGWSQYQNTG 43

Query: 61  SAL-YN--GSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIG 117
           +   Y   G+ G       G   F GY              +                 G
Sbjct: 44  TGGIYGDQGNDGPTHKDQLGAGAFLGYQANQYLGFEMGYDWLGRMPYKGDVRNGDFKAQG 103

Query: 118 GSLRIRGGYEVSDSLLLYATVGPDVAQKYET------GKAGEITPIAIGGTAGVGVEVGG 171
             L  +  Y ++  L LY  +G  V +   +      G         +     +G E   
Sbjct: 104 VQLAAKLSYPIAQDLDLYTRLGGMVWRADSSAFDAATGDRQNNHDTGVSPLVALGAEY-A 162

Query: 172 LSESLVARLEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
            +++   R+EY+        + V    +   +S+GV  +F
Sbjct: 163 WTKNWATRMEYQWVSNIGDKATVGARPDNGMLSVGVSYRF 202


>gi|329755862|gb|AEC04328.1| outer membrane protein A [Pasteurella multocida]
          Length = 348

 Score = 74.8 bits (182), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 36/231 (15%), Positives = 72/231 (31%), Gaps = 44/231 (19%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAG- 59
           M+K  +A+ + +LA+AS   A                        YV  +  +   + G 
Sbjct: 1   MKKTAIALTIVALAVASVAQA-----------------VPQPNTFYVGAKAGWASFHDGL 43

Query: 60  LSALY-NGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGG 118
               Y + +      ++    +F GY + D+  +     D             +      
Sbjct: 44  NQIEYKSKTSFGSKRNSVTYGVFGGYQITDNFAVELGYDDFGRAKVRANSKTTAFDAAKH 103

Query: 119 S-----LRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITP--------IAIGGTAGV 165
           +     L ++  Y + D L +YA VG  + +      A  I            +      
Sbjct: 104 TNHGTHLSLKASYPLLDGLDVYARVGAALIRSDYKLYAPLINKRLSPHFKITQVSPVFAG 163

Query: 166 GVEVGGLSESLVARLEYRASK-----------YSKVEGFYNTISLGVGMKF 205
           G+E   +   L  R+EY+              Y+       +++ G+  +F
Sbjct: 164 GLEYAFI-PELTLRVEYQWVNNVGKFEYADGQYADFRPDIGSVTAGLSYRF 213


>gi|238763376|ref|ZP_04624340.1| Outer membrane protein A [Yersinia kristensenii ATCC 33638]
 gi|238698475|gb|EEP91228.1| Outer membrane protein A [Yersinia kristensenii ATCC 33638]
          Length = 358

 Score = 74.8 bits (182), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 33/220 (15%), Positives = 61/220 (27%), Gaps = 33/220 (15%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K   A+ ++         AQAA                     Y   +  ++      
Sbjct: 1   MKKT--AIALAVALAGFATVAQAA---------------PKDNTWYTGGKLGWSQYQNTG 43

Query: 61  SAL-YN--GSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIG 117
           +   Y   G+ G       G   F GY              +                 G
Sbjct: 44  TGGIYGDQGNDGPTHKDQLGAGAFLGYQANQYLGFEMGYDWLGRMPYKGDVRNGDFKAQG 103

Query: 118 GSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAG------EITPIAIGGTAGVGVEVGG 171
             L  +  Y ++  L LY  +G  V +   +                +     +G E   
Sbjct: 104 VQLAAKLSYPIAQDLDLYTRLGGMVWRADSSAFNAASGERLNNHDTGVSPLVALGAEY-A 162

Query: 172 LSESLVARLEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
            +++   R+EY+        + V    +   +S+GV  +F
Sbjct: 163 WTKNWATRMEYQWVSNIGDKATVGARPDNGMLSVGVSYRF 202


>gi|238789280|ref|ZP_04633067.1| Outer membrane protein A [Yersinia frederiksenii ATCC 33641]
 gi|238722612|gb|EEQ14265.1| Outer membrane protein A [Yersinia frederiksenii ATCC 33641]
          Length = 357

 Score = 74.8 bits (182), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 34/220 (15%), Positives = 63/220 (28%), Gaps = 33/220 (15%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K   A+ ++         AQAA                     Y   +  ++      
Sbjct: 1   MKKT--AIALAVALAGFATVAQAA---------------PKDNTWYTGGKLGWSQYQDTG 43

Query: 61  SAL-YN--GSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIG 117
           +   Y   G+ G    +  G   F GY              +                 G
Sbjct: 44  TGGIYGDVGNDGPTHKNQLGAGAFLGYQANQYLGFEMGYDWLGRMPYKGDVRNGDFKAQG 103

Query: 118 GSLRIRGGYEVSDSLLLYATVGPDVAQKY------ETGKAGEITPIAIGGTAGVGVEVGG 171
             L  +  Y ++  L LY  +G  V +         +G         +     +G E   
Sbjct: 104 VQLAAKLSYPIAQDLDLYTRLGGMVWRADSSAFDATSGLRSNNHDTGVSPLVALGAEY-A 162

Query: 172 LSESLVARLEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
            +++   R+EY+        + V    +   +S+GV  +F
Sbjct: 163 WTKNWATRMEYQWVSNIGDKATVGARPDNGMLSVGVSYRF 202


>gi|296447421|ref|ZP_06889346.1| OmpA domain protein transmembrane region-containing protein
           [Methylosinus trichosporium OB3b]
 gi|296255041|gb|EFH02143.1| OmpA domain protein transmembrane region-containing protein
           [Methylosinus trichosporium OB3b]
          Length = 271

 Score = 74.8 bits (182), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 51/260 (19%), Positives = 79/260 (30%), Gaps = 58/260 (22%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+ L     ++     +  SA AAD                 T   V    +    ++  
Sbjct: 1   MKTLSALSMITLGF--AVSSASAADLPSAKAPVAFVEPAPAFTWTGVYAGLNIGYGWSEK 58

Query: 61  SALYN-----------GSFGEEAHHNAGGSIFAGYNVEDS--CIMYGVEGDVRYTVPVLA 107
            ++              SF   A     G    GYN + +    + G+E D R       
Sbjct: 59  QSIAGTVSAAGTPIAFWSFPSSAVDGVLGGGQIGYNRQFAGTSFVVGLEADFRGAGVNGY 118

Query: 108 DNIHS---------------LHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAG 152
            N                       G++R R GY V+ +LL+Y T G        T   G
Sbjct: 119 SNGFGPTNQFGYTPFVNARQQLDWFGTVRGRLGYAVAPTLLVYGTGGFAYGGYRATYSGG 178

Query: 153 ----------EITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSK------------- 189
                       + +  G TAG GVE         A++EY  ++  +             
Sbjct: 179 AVGVPVTVSVSNSDVRTGWTAGGGVE-WAFLPRWSAKVEYLYTELERGHDASYALLGLVA 237

Query: 190 ----VEGFYNTISLGVGMKF 205
               V+  ++TIS GV   F
Sbjct: 238 NQVGVQNRFHTISAGVNYHF 257


>gi|332162167|ref|YP_004298744.1| outer membrane protein A [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|318606220|emb|CBY27718.1| outer membrane protein A precursor [Yersinia enterocolitica subsp.
           palearctica Y11]
 gi|325666397|gb|ADZ43041.1| outer membrane protein A [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
          Length = 357

 Score = 74.4 bits (181), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 35/220 (15%), Positives = 62/220 (28%), Gaps = 33/220 (15%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K   A+ ++         AQAA                     Y   +  ++      
Sbjct: 1   MKKT--AIALAVALAGFATVAQAA---------------PKDNTWYTGGKLGWSQYQNTG 43

Query: 61  SAL-YN--GSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIG 117
           +   Y   G+ G       G   F GY              +                 G
Sbjct: 44  TGGIYGDQGNDGPTHKDQLGAGAFLGYQANQYLGFEMGYDWLGRMPYKGDVRNGDFKAQG 103

Query: 118 GSLRIRGGYEVSDSLLLYATVGPDVAQKY------ETGKAGEITPIAIGGTAGVGVEVGG 171
             L  +  Y ++  L LY  +G  V +         TG         +     +G E   
Sbjct: 104 VQLAAKLSYPIAQDLDLYTRLGGMVWRADSSAFDATTGARANNHDTGVSPLVALGAEY-A 162

Query: 172 LSESLVARLEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
            +++   R+EY+        + V    +   +S+GV  +F
Sbjct: 163 WTKNWATRMEYQWVSNIGDKATVGARPDNGMLSVGVSYRF 202


>gi|42528870|gb|AAS18468.1| outer membrane protein A [Salmonella enterica subsp. enterica
           serovar Gallinarum]
          Length = 319

 Score = 74.4 bits (181), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 27/157 (17%), Positives = 54/157 (34%), Gaps = 18/157 (11%)

Query: 63  LYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGG---S 119
            +  + G    +  G   F GY V       G E    +   +     +           
Sbjct: 18  GFIHNDGPTDENQLGAGAFGGYQV---NPYVGFEMGYDWLGRMPYKGDNINGAYKAQGVQ 74

Query: 120 LRIRGGYEVSDSLLLYATVGPDVAQKYET-----GKAGEITPIAIGGTAGVGVEVGGLSE 174
           L  + GY ++D L +Y  +G  V +         G + +     +      G+E   ++ 
Sbjct: 75  LTAKLGYPITDDLDVYTRLGGMVWRADTKSNVPGGPSTKDHDTGVSPVFAGGIEY-AITP 133

Query: 175 SLVARLEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
            +  RLEY+ +      + +    +   +S+GV  +F
Sbjct: 134 EIATRLEYQWTNNIGDANTIGTRPDNGLLSVGVSYRF 170


>gi|51595793|ref|YP_069984.1| outer membrane protein A [Yersinia pseudotuberculosis IP 32953]
 gi|108806724|ref|YP_650640.1| outer membrane protein A [Yersinia pestis Antiqua]
 gi|108812705|ref|YP_648472.1| outer membrane protein A [Yersinia pestis Nepal516]
 gi|145598823|ref|YP_001162899.1| outer membrane protein A [Yersinia pestis Pestoides F]
 gi|149366590|ref|ZP_01888624.1| putative outer membrane porin A protein [Yersinia pestis CA88-4125]
 gi|162418551|ref|YP_001607555.1| outer membrane protein A [Yersinia pestis Angola]
 gi|165924613|ref|ZP_02220445.1| outer membrane protein A [Yersinia pestis biovar Orientalis str.
           F1991016]
 gi|165940134|ref|ZP_02228667.1| outer membrane protein A [Yersinia pestis biovar Orientalis str.
           IP275]
 gi|166011945|ref|ZP_02232843.1| outer membrane protein A [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|166211728|ref|ZP_02237763.1| outer membrane protein A [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|167402334|ref|ZP_02307802.1| outer membrane protein A [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|167419876|ref|ZP_02311629.1| outer membrane protein A [Yersinia pestis biovar Orientalis str.
           MG05-1020]
 gi|167424140|ref|ZP_02315893.1| outer membrane protein A [Yersinia pestis biovar Mediaevalis str.
           K1973002]
 gi|170024855|ref|YP_001721360.1| outer membrane protein A [Yersinia pseudotuberculosis YPIII]
 gi|186894876|ref|YP_001871988.1| outer membrane protein A [Yersinia pseudotuberculosis PB1/+]
 gi|218928581|ref|YP_002346456.1| outer membrane protein A [Yersinia pestis CO92]
 gi|229841410|ref|ZP_04461569.1| outer membrane protein A (3a;II*;G;d) [Yersinia pestis biovar
           Orientalis str. PEXU2]
 gi|229843520|ref|ZP_04463663.1| outer membrane protein A (3a;II*;G;d) [Yersinia pestis biovar
           Orientalis str. India 195]
 gi|229894379|ref|ZP_04509562.1| outer membrane protein A (3a;II*;G;d) [Yersinia pestis Pestoides A]
 gi|270486903|ref|ZP_06203977.1| outer membrane protein A [Yersinia pestis KIM D27]
 gi|294503419|ref|YP_003567481.1| putative outer membrane porin A protein [Yersinia pestis Z176003]
 gi|55976558|sp|Q8ZG77|OMPA_YERPE RecName: Full=Outer membrane protein A; Flags: Precursor
 gi|55977792|sp|P38399|OMPA_YERPS RecName: Full=Outer membrane protein A; AltName: Full=Outer
           membrane protein II; Flags: Precursor
 gi|51589075|emb|CAH20693.1| putative outer membrane porin A protein [Yersinia
           pseudotuberculosis IP 32953]
 gi|108776353|gb|ABG18872.1| outer membrane porin A protein [Yersinia pestis Nepal516]
 gi|108778637|gb|ABG12695.1| putative outer membrane porin A protein [Yersinia pestis Antiqua]
 gi|115347192|emb|CAL20086.1| putative outer membrane porin A protein [Yersinia pestis CO92]
 gi|145210519|gb|ABP39926.1| outer membrane porin A protein [Yersinia pestis Pestoides F]
 gi|149290964|gb|EDM41039.1| putative outer membrane porin A protein [Yersinia pestis CA88-4125]
 gi|162351366|gb|ABX85314.1| outer membrane protein A [Yersinia pestis Angola]
 gi|165911957|gb|EDR30601.1| outer membrane protein A [Yersinia pestis biovar Orientalis str.
           IP275]
 gi|165923673|gb|EDR40805.1| outer membrane protein A [Yersinia pestis biovar Orientalis str.
           F1991016]
 gi|165989112|gb|EDR41413.1| outer membrane protein A [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|166207499|gb|EDR51979.1| outer membrane protein A [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|166962617|gb|EDR58638.1| outer membrane protein A [Yersinia pestis biovar Orientalis str.
           MG05-1020]
 gi|167048300|gb|EDR59708.1| outer membrane protein A [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|167056989|gb|EDR66752.1| outer membrane protein A [Yersinia pestis biovar Mediaevalis str.
           K1973002]
 gi|169751389|gb|ACA68907.1| OmpA domain protein transmembrane region-containing protein
           [Yersinia pseudotuberculosis YPIII]
 gi|186697902|gb|ACC88531.1| OmpA domain protein transmembrane region-containing protein
           [Yersinia pseudotuberculosis PB1/+]
 gi|229689128|gb|EEO81191.1| outer membrane protein A (3a;II*;G;d) [Yersinia pestis biovar
           Orientalis str. India 195]
 gi|229697776|gb|EEO87823.1| outer membrane protein A (3a;II*;G;d) [Yersinia pestis biovar
           Orientalis str. PEXU2]
 gi|229703777|gb|EEO90793.1| outer membrane protein A (3a;II*;G;d) [Yersinia pestis Pestoides A]
 gi|262361462|gb|ACY58183.1| putative outer membrane porin A protein [Yersinia pestis D106004]
 gi|262365389|gb|ACY61946.1| putative outer membrane porin A protein [Yersinia pestis D182038]
 gi|270335407|gb|EFA46184.1| outer membrane protein A [Yersinia pestis KIM D27]
 gi|294353878|gb|ADE64219.1| putative outer membrane porin A protein [Yersinia pestis Z176003]
 gi|320015699|gb|ADV99270.1| outer membrane protein A [Yersinia pestis biovar Medievalis str.
           Harbin 35]
          Length = 353

 Score = 74.4 bits (181), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 34/217 (15%), Positives = 61/217 (28%), Gaps = 32/217 (14%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K   A+ ++   +     AQAA                     Y   +  ++      
Sbjct: 1   MKKT--AIALAVALVGFATVAQAA---------------PKDNTWYTGGKLGWSQYQDTG 43

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGSL 120
           S     + G       G   F GY              +         N  +    G  L
Sbjct: 44  SI--INNDGPTHKDQLGAGAFFGYQANQYLGFEMGYDWLGRMPYKGDINNGAFKAQGVQL 101

Query: 121 RIRGGYEVSDSLLLYATVGPDVAQKYETGKAG------EITPIAIGGTAGVGVEVGGLSE 174
             +  Y V+  L +Y  +G  V +    G               +     +G E    ++
Sbjct: 102 AAKLSYPVAQDLDVYTRLGGLVWRADAKGSFDGGLDRASGHDTGVSPLVALGAEY-AWTK 160

Query: 175 SLVARLEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
           +   R+EY+          V    +   +S+GV  +F
Sbjct: 161 NWATRMEYQWVNNIGDRETVGARPDNGLLSVGVSYRF 197


>gi|148257935|ref|YP_001242520.1| hypothetical protein BBta_6718 [Bradyrhizobium sp. BTAi1]
 gi|146410108|gb|ABQ38614.1| putative exported protein of unknown function [Bradyrhizobium sp.
           BTAi1]
          Length = 550

 Score = 74.4 bits (181), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 28/166 (16%), Positives = 52/166 (31%), Gaps = 32/166 (19%)

Query: 71  EAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLAD------NIHSLHGIGGSLRIRG 124
               +  G +  G + +    + G++      +   +        +++      +  +R 
Sbjct: 378 SNGGDVIGGVQLGCDYQIDRFVLGIQAMADLGIINASTAVAPQLTLNARTSNLYTATVRA 437

Query: 125 GYEVSDSLLLYATVGPDVAQKYETGKAGEITPI------AIGGTAGVGVEVGGLSESLVA 178
           GY V+  +LLYA  G    +   T                 G T G GVE    + +  A
Sbjct: 438 GYLVTPEVLLYARGGAAWTRTSVTAVNAANGQSASAAFNRSGWTVGAGVE-WMFARNWSA 496

Query: 179 RLEYRASKYSKVEG-------------------FYNTISLGVGMKF 205
             EY  + +  V G                     +T  +GV  +F
Sbjct: 497 FAEYDYADFGTVTGRLPGAAAVTGGPDVVSLNTKIHTALVGVNYRF 542


>gi|299773233|gb|ADJ38691.1| outer membrane protein P5 [Haemophilus parasuis]
          Length = 368

 Score = 74.4 bits (181), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 40/228 (17%), Positives = 80/228 (35%), Gaps = 31/228 (13%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATN-RYVPIRHDFNGPYAG 59
           M+K  +A+      L+S  S+ AA      + G +    T   +   +  ++  +  YA 
Sbjct: 1   MKKSLIALAKHH--LSSCISSNAAPQADSFYVGAKAGWATFHNDINQLNFKYKNDARYAT 58

Query: 60  LSALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGS 119
            +  Y         ++    +F GY + D+  +               +     H   G+
Sbjct: 59  SANGYG-----INRNSVTYGVFGGYQIIDNLAVELGYDYFGRVRGNKQEFREFKHSAHGT 113

Query: 120 -LRIRGGYEVSDSLLLYATVGPDVAQKYE-----TGKAGEITPIAIGGTAGVGVEVGGLS 173
            L ++  YEV   L +Y  VG  + +        T +  +   +      G GVE   + 
Sbjct: 114 HLSLKPSYEVLSGLDVYGKVGAALVRNDYKRYFQTREPVKSHNLKTSLIVGAGVEY-AIL 172

Query: 174 ESLVARLEYRAS----KYSKVEG------------FYNTISLGVGMKF 205
             L  R+EY+       ++K E               ++++ G+  +F
Sbjct: 173 PELAFRVEYQWLSNVGNFTKAEMKENRRATYNYSPDSHSVTAGISYRF 220


>gi|148255737|ref|YP_001240322.1| putative outer-membrane protein [Bradyrhizobium sp. BTAi1]
 gi|146407910|gb|ABQ36416.1| putative outer-membrane protein [Bradyrhizobium sp. BTAi1]
          Length = 251

 Score = 74.4 bits (181), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 39/228 (17%), Positives = 64/228 (28%), Gaps = 28/228 (12%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIA---------TNRYVPIRH 51
           M+ L L    S         A AAD   R       ++ TI                 R 
Sbjct: 1   MRSLLLGATTSLAL--GIAPAIAADLPARTFTKAPAMIATIYDWSGFYLGFNAGGGSART 58

Query: 52  DFNGPYAGLSALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLAD--- 108
            +             + G      A      GY  +    ++GVEG   +      +   
Sbjct: 59  CWTNQVTIAGVAATNAEGCHDATGALAGGQVGYRWQTGGWVFGVEGQGNWANLKGRNASQ 118

Query: 109 -----NIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETG-------KAGEITP 156
                   +     G L  + GY  ++ +L Y   G  V  +  +G          + + 
Sbjct: 119 LAPGVTNQTKINGVGLLTGQIGYAWNN-VLWYVKGGAAVTGEKYSGLATATGTPFDQASA 177

Query: 157 IAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFYNTISLGVGMK 204
              G   G GVEVG  + +     EY           ++ +  G   +
Sbjct: 178 TRWGAAVGTGVEVGF-ANNWSIAAEYEHLFMGNRTLTFSGVPGGAATR 224


>gi|320179525|gb|EFW54477.1| Outer membrane protein A precursor [Shigella boydii ATCC 9905]
          Length = 342

 Score = 74.4 bits (181), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 31/188 (16%), Positives = 60/188 (31%), Gaps = 16/188 (8%)

Query: 30  AHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSFGEEAHHNAGGSIFAGYNVEDS 89
           A               Y   +  ++  +      +  + G    +  G   F GY V   
Sbjct: 4   AGFATVAQAAPKDNTWYTGAKLGWSQYHDT---GFIDNNGPTHENQLGAGAFGGYQVNPY 60

Query: 90  CIMYGVEGDVRYTVPVLADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYE-- 147
                    +       +    +    G  L  + GY ++D L +Y  +G  V +     
Sbjct: 61  VGFEMGYDWLGRMPYKGSVENGAYKAQGVQLTAKLGYPITDDLDVYTRLGGMVWRADTKA 120

Query: 148 ----TGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRAS----KYSKVEGFYNT--I 197
               TG++ +     +      GVE   ++  +  RLEY+ +        +    +   +
Sbjct: 121 HNNVTGESEKNHDTGVSPVFAGGVE-WAITPEIATRLEYQWTNNIGDAHTIGTRPDNGLL 179

Query: 198 SLGVGMKF 205
           SLGV  +F
Sbjct: 180 SLGVSYRF 187


>gi|91975321|ref|YP_567980.1| putative outer membrane protein [Rhodopseudomonas palustris BisB5]
 gi|91681777|gb|ABE38079.1| putative outer membrane protein [Rhodopseudomonas palustris BisB5]
          Length = 242

 Score = 74.4 bits (181), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 42/243 (17%), Positives = 73/243 (30%), Gaps = 49/243 (20%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K+ LA    +L       A AAD   R ++      P +         +++ G Y G 
Sbjct: 1   MKKILLA--TVALVAFGAAPALAADLAARPYNKAPVYAPPVP-------IYNWTGFYIGG 51

Query: 61  SALYNGSFGEEAHHNAG--------GSIFAGYNVED-SCIMYGVEGDVRYTVPV------ 105
                 +                  G + AGY+ +     + GVEG   +          
Sbjct: 52  HIGGAFAGDNSIGTGVTANSDGKFLGGVQAGYDWQFAPSWVLGVEGQYSWLSGSNDAVAF 111

Query: 106 ------LADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAG------- 152
                              S+  R GY    +LL Y   G   A    +           
Sbjct: 112 TVVGQPGTYTFSDNQRGLASVTGRLGYTWGPALL-YVKGGWAYADYKSSLTFTAPGGAAV 170

Query: 153 --EITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVE--------GFYNTISLGVG 202
               T    G T G G+E    +++   ++EY+   +  V+           + +  G+ 
Sbjct: 171 GVSSTSSQDGYTVGAGLEY-LFAQNWSGKIEYQYYDFGNVDLGAGFTAKNDQHVVKAGLN 229

Query: 203 MKF 205
            +F
Sbjct: 230 YRF 232


>gi|307946127|ref|ZP_07661462.1| putative outer membrane protein [Roseibium sp. TrichSKD4]
 gi|307769791|gb|EFO29017.1| putative outer membrane protein [Roseibium sp. TrichSKD4]
          Length = 256

 Score = 74.4 bits (181), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 37/215 (17%), Positives = 69/215 (32%), Gaps = 19/215 (8%)

Query: 8   VGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGS 67
           + + ++       A+AAD           +    +      +  +         +   G+
Sbjct: 44  LVMCAVLGGLVAGAKAADMPVYDDFVTPNLPSAGSVWEGGYVGAEAGLSQTLTESKVPGA 103

Query: 68  FGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTV------PVLADNIHSLHGIGGSLR 121
               +  +A   +F GYN + S ++ GVE    Y              + +      SLR
Sbjct: 104 KSTASKMDAAFGLFGGYNWQVSRVVLGVEAGATYLGGQAKKNLSGVGQVKAGSQWSASLR 163

Query: 122 IRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLE 181
            R G    +S + Y T G               + + +G   G G+EV  +SE+   R +
Sbjct: 164 GRVGLPF-ESFMPYLTAGLAATDHSTKANGKTHSALGVGLMFGGGLEV-AVSENWRVRAD 221

Query: 182 YRASK-------YSKVE----GFYNTISLGVGMKF 205
           Y  +        +           + + LGV   F
Sbjct: 222 YSMTGILNEKDMFGGTRIERTAANHRLMLGVSYAF 256


>gi|21106560|gb|AAM35363.1| membrane protein [Xanthomonas axonopodis pv. citri str. 306]
          Length = 474

 Score = 74.4 bits (181), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 37/245 (15%), Positives = 63/245 (25%), Gaps = 47/245 (19%)

Query: 1   MQKLFLAVGVSSLALASFCS-AQAADPVRRAHHGGRGVVPTIATNR-------------- 45
           M+   LA     L + +  + AQ+          G  V                      
Sbjct: 196 MKPTPLASAALVLLVLAPSAWAQSGPADWSGLSIGANVGGADPAGVSGGRFGFDTNLDGR 255

Query: 46  ---YVPIRHDFNGPYAGLSALYNGSFGEEAH-----HNAGGSIFAGYNVEDSCIMYGVEG 97
               V      +    G            +        A      GY+ +    +YGV  
Sbjct: 256 DGDQVGTATGADAFSPGFCGGAAAGRTPASGCSKDKGGAEYGARLGYDWQAGNWVYGVVA 315

Query: 98  DVRYTVPVLADNIHSLHGIGGS----------LRIRGGYEVS--DSLLLYATVGPDVAQK 145
           +        + +  S      +          LR R GY        L Y T G    + 
Sbjct: 316 EYTRNDVRDSVSAFSTTPAFYTFTRQLNRTAALRGRIGYAFGTQGDYLAYITAGVARGEF 375

Query: 146 Y--------ETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFYNTI 197
                               A G  AG+G++   LS+ +   +EY  ++    +     +
Sbjct: 376 DHSFASSNTANSFTSSGGDSADGYQAGIGLQ-RRLSDKVSVGVEYLFTRLQDDDT---RV 431

Query: 198 SLGVG 202
            +G G
Sbjct: 432 RVGPG 436


>gi|49182354|gb|AAT57679.1| OmpA [Pasteurella multocida]
          Length = 353

 Score = 74.4 bits (181), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 38/232 (16%), Positives = 71/232 (30%), Gaps = 41/232 (17%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K   A+ ++ +ALA    AQAA      + G +    +             +G     
Sbjct: 1   MKKT--AIALTIVALAVASVAQAAPQPNTFYVGAKAGWASFH-----------DGLNQAK 47

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYT------VPVLADNIHSLH 114
                 +      ++    +F GY + D   +     D              A ++    
Sbjct: 48  YLEAPEATFGFKRNSVTYGVFGGYQITDDFAVELGYDDFGRAKLRIAETDQKARDVAKHT 107

Query: 115 GIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEIT----------PIAIGGTAG 164
             G  L ++  Y V D L +YA VG  + +                        +     
Sbjct: 108 NHGAHLSLKASYPVLDGLDVYARVGAALIRSDYKVYDHSDPAKLPQLKRTHSTQVSPVFA 167

Query: 165 VGVEVGGLSESLVARLEYRASK----YSKVEG-------FYNTISLGVGMKF 205
            G+E   +   L  R+EY+          V+G          +++ G+  +F
Sbjct: 168 GGLEYAFM-PELALRVEYQWVNNVGKLKDVDGNRVDYRPDIGSVTAGLSYRF 218


>gi|329755860|gb|AEC04327.1| outer membrane protein A [Pasteurella multocida]
 gi|329755868|gb|AEC04331.1| outer membrane protein A [Pasteurella multocida]
 gi|329755870|gb|AEC04332.1| outer membrane protein A [Pasteurella multocida]
 gi|329755872|gb|AEC04333.1| outer membrane protein A [Pasteurella multocida]
          Length = 348

 Score = 74.4 bits (181), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 36/231 (15%), Positives = 72/231 (31%), Gaps = 44/231 (19%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAG- 59
           M+K  +A+ + +LA+AS   A                        YV  +  +   + G 
Sbjct: 1   MKKTAIALTIVALAVASVAQA-----------------VPQPNTFYVGAKAGWASFHDGL 43

Query: 60  LSALY-NGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGG 118
               Y + +      ++    +F GY + D+  +     D             +      
Sbjct: 44  NQIEYKSKTSFGSKRNSVTYGVFGGYQITDNFAVELGYDDFGRAKVRANSKTTAFDAAKH 103

Query: 119 S-----LRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITP--------IAIGGTAGV 165
           +     L ++  Y + D L +YA VG  + +      A  I            +      
Sbjct: 104 TNHGTHLSLKASYPLLDGLDVYARVGAALIRSDYKLYAPLINKRLSPHFKITQVSPVFAG 163

Query: 166 GVEVGGLSESLVARLEYRASK-----------YSKVEGFYNTISLGVGMKF 205
           G+E   +   L  R+EY+              Y+       +++ G+  +F
Sbjct: 164 GLEYAFI-PELTLRVEYQWVNNVGKFEYADGQYADFRPDIGSVTAGLSYRF 213


>gi|38000008|gb|AAP74760.2| outer membrane protein A precursor [Shigella flexneri 2a]
          Length = 327

 Score = 74.4 bits (181), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 30/180 (16%), Positives = 59/180 (32%), Gaps = 21/180 (11%)

Query: 40  TIATNRYVPIRHDFNGPYAGLSALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDV 99
                 Y   +  ++  +      +  + G    +  G   F GY V       G E   
Sbjct: 2   PKDNTWYTGAKLGWSQYHDT---GFIPNNGPTHENQLGAGAFGGYQV---NPYVGFEMGY 55

Query: 100 RYTVPVLADNIHSLHGIGG---SLRIRGGYEVSDSLLLYATVGPDVAQKYET-----GKA 151
            +   +     +           L  + GY ++D L +Y  +G  V +         G +
Sbjct: 56  DWLGRMPYKGDNINGAYKAQGVQLTAKLGYPITDDLDIYTRLGGMVWRADTKANVPGGAS 115

Query: 152 GEITPIAIGGTAGVGVEVGGLSESLVARLEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
            +     +      GVE   ++  +  RLEY+ +      + +    +   +SLGV  +F
Sbjct: 116 FKDHDTGVSPVFAGGVEY-AITPEIATRLEYQWTNNIGDANTIGTRPDNGLLSLGVSYRF 174


>gi|319408577|emb|CBI82232.1| putative Hemin-binding protein B [Bartonella schoenbuchensis R1]
 gi|319408616|emb|CBI82271.1| putative Hemin-binding protein B [Bartonella schoenbuchensis R1]
          Length = 439

 Score = 74.4 bits (181), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 26/119 (21%), Positives = 46/119 (38%), Gaps = 24/119 (20%)

Query: 109 NIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVA-------------QKYETGKAGEIT 155
           +        G+ R+R G+ V D ++ Y   G   A                 +  +    
Sbjct: 323 SNTLKQKWSGATRVRIGFAV-DRIVPYIAGGVAYAQLQNIFSRSIETEGHEISSSSLSDK 381

Query: 156 PIAIGGTAGVGVEVGGLSESLVARLEYRASKYSK---------VEGFYNTISLGVGMKF 205
            I +G T G GV+   ++++++ R EYR S + K         ++   N   +GV  KF
Sbjct: 382 KIMVGYTLGGGVDF-AMADNVILRAEYRYSDFGKQKFAKDKLELDYQTNDFRVGVAYKF 439



 Score = 47.9 bits (112), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 24/146 (16%), Positives = 40/146 (27%), Gaps = 39/146 (26%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAAD--------PVRRAHHGGRGVVPTI-------ATNR 45
           M    L +  S + L +   AQAAD        PV       + + P +           
Sbjct: 1   MNTKCL-ISTSIITLFTASVAQAADIMVPRESRPVVSPPQASKQISPPVEMSPNSDIPPV 59

Query: 46  YVPIRHDFNGPYAGLSALYNGSFGEEA----------------------HHNAGGSIFAG 83
                  +NG Y G            +                           G ++AG
Sbjct: 60  ISAPTFSWNGFYLGGQIGGFSGKTGISLYAKKGPSTREWTPVEKDTVPQLSGFMGGLYAG 119

Query: 84  YNVEDSC-IMYGVEGDVRYTVPVLAD 108
            NV+     + GV+ D+ ++      
Sbjct: 120 ANVDLGNSFILGVDTDIVWSNKQDTK 145


>gi|253990221|ref|YP_003041577.1| outer membrane protein A [Photorhabdus asymbiotica subsp.
           asymbiotica ATCC 43949]
 gi|253781671|emb|CAQ84834.1| outer membrane protein a (outer membrane protein ii*) [Photorhabdus
           asymbiotica]
          Length = 366

 Score = 74.4 bits (181), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 28/182 (15%), Positives = 55/182 (30%), Gaps = 17/182 (9%)

Query: 40  TIATNRYVPIRHDFNGPYAGLSALYNG----SFGEEAHHNAGGSIFAGYNVEDSCIMYGV 95
                 Y   +  ++  +               G    +  G   + GY           
Sbjct: 23  PKDNTWYTGGKLGWSQYHDVNFYGNGYTNEIGNGPTHKNQLGAGAYLGYQTNPYLGFEIG 82

Query: 96  EGDVRYTVPVLADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAG--- 152
              +       + N  +    G  L  +  Y ++D L +Y  +G  V +       G   
Sbjct: 83  YDWLGRMPYKGSVNNGAFKTHGFQLATKLSYPITDDLDIYTRLGGMVWRADSKATYGATN 142

Query: 153 ---EITPIAIGGTAGVGVEVGGLSESLVARLEYRAS----KYSKVEGFYNT--ISLGVGM 203
              +     +   A +GVE   L+++   RL+Y+          V    +   +S+GV  
Sbjct: 143 THRKDHDTGVSPLAAIGVEY-ALTKNWATRLDYQWVNNIGDAGTVGARPDNGLLSVGVSY 201

Query: 204 KF 205
           +F
Sbjct: 202 RF 203


>gi|115524371|ref|YP_781282.1| OmpA domain-containing protein [Rhodopseudomonas palustris BisA53]
 gi|115518318|gb|ABJ06302.1| OmpA domain protein transmembrane region-containing protein
           [Rhodopseudomonas palustris BisA53]
          Length = 235

 Score = 74.4 bits (181), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 28/204 (13%), Positives = 57/204 (27%), Gaps = 34/204 (16%)

Query: 34  GRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSFGEE---AHHNAGGSIFAGYNVEDS- 89
                          I +++ G Y G       +  +    +       +  G + + + 
Sbjct: 24  SARPATKAPAYTAPEIVYNWTGFYIGGHVGGAFAGDDNITGSDGRFLAGVQGGADYQFAR 83

Query: 90  CIMYGVEGDVRYTVPVLADN--------IHSLHGIGGSLRIRGGYEVSDSLLLYATVGPD 141
             + G+E    +                +   +   GS+  R GY    +LL YA  G  
Sbjct: 84  NWVVGIEAQYSWLPTDGNGGLLYPGNTLVTQDNRGLGSVTGRLGYSWGPALL-YAKGGYA 142

Query: 142 VAQKYET------GKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSK------ 189
                                   G + G G+E    + +  A++EY+   +        
Sbjct: 143 FRDSSIDVSNLGAQPFATSGNKKDGYSVGGGLEY-LFAPNWSAKVEYQYYNFGNTSFTGG 201

Query: 190 --------VEGFYNTISLGVGMKF 205
                   V    +T+  G+  +F
Sbjct: 202 PPDIVGSSVRNDEHTVKAGINYRF 225


>gi|86751789|ref|YP_488285.1| hypothetical protein RPB_4691 [Rhodopseudomonas palustris HaA2]
 gi|86574817|gb|ABD09374.1| conserved hypothetical protein [Rhodopseudomonas palustris HaA2]
          Length = 562

 Score = 74.4 bits (181), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 37/207 (17%), Positives = 62/207 (29%), Gaps = 36/207 (17%)

Query: 20  SAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSFGEEAHHNAGG- 78
           ++  A  +  A       +P +  +   P++  + G Y G     +      +     G 
Sbjct: 5   ASTTAMLILAATTAAAADLPRLPLSPAAPVQWSWTGLYWGAHLGGSFGQTSFSDPAGPGL 64

Query: 79  ------------SIFAGYNVEDS-CIMYGVEGDVRYTVPVL------------ADNIHSL 113
                        I  GYN + +   + GVE DV                   + N    
Sbjct: 65  YGGQVRSPAALAGIQLGYNYQPNRNWLIGVEADVSAMNGNGTQSCLVSSGLFISANCRVR 124

Query: 114 HGIGGSLRIRGGYEVSD--SLLLYATVGPDVAQKYETGKAGEI-------TPIAIGGTAG 164
                +L  R G+        LLYA  G     +      G         T    G TAG
Sbjct: 125 QDALATLTGRAGFVTGPGGRTLLYAKAGAAFLSERLDITIGNPIGSSTESTDGRWGWTAG 184

Query: 165 VGVEVGGLSESLVARLEYRASKYSKVE 191
            G+E   L+ +   + EY  + +   +
Sbjct: 185 AGIE-RALAPAWSVKFEYDYANFGSRD 210


>gi|77917690|ref|YP_355505.1| outer membrane immunogenic protein [Pelobacter carbinolicus DSM
           2380]
 gi|77543773|gb|ABA87335.1| outer membrane immunogenic protein [Pelobacter carbinolicus DSM
           2380]
          Length = 225

 Score = 74.1 bits (180), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 42/233 (18%), Positives = 66/233 (28%), Gaps = 36/233 (15%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M +L    G   +A+       A + +                  +V             
Sbjct: 1   MLRLRTIFGALVVAVLMSGPVYAGNMMGAE---ALSDYSGPYIGGFVGHSWADLEYSDSW 57

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIH--------S 112
           +  Y             G ++ G+N     IM G E D          + +         
Sbjct: 58  NPGY---DLNADIEGFVGGLYFGHNYMIDNIMLGFEADAGIGDLGEGADKNNSYNDWSAF 114

Query: 113 LHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQK---YETGKAGEITPIAIGGTAGVGVEV 169
                  LR R G+ V ++ L Y   G  VA+          G       G T G G+E 
Sbjct: 115 DIDWDAHLRARAGF-VYNTTLFYVAGGLAVAKVAVDDTDSGYGGDNATHFGWTIGAGIEQ 173

Query: 170 GGLSESLVARLEYRASKYS-----------------KVEGFYNTISLGVGMKF 205
             ++E L AR+EY    Y                   ++   +T  LG+   F
Sbjct: 174 -KITEHLTARIEYLYDDYGSESYSIEDSWWGDTYSADIDLEIHTARLGLAYSF 225


>gi|268590120|ref|ZP_06124341.1| outer membrane protein P5 [Providencia rettgeri DSM 1131]
 gi|291314389|gb|EFE54842.1| outer membrane protein P5 [Providencia rettgeri DSM 1131]
          Length = 363

 Score = 74.1 bits (180), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 30/185 (16%), Positives = 54/185 (29%), Gaps = 20/185 (10%)

Query: 40  TIATNRYVPIRHDFNGPYAGL---------SALYNGSFGEEAHHNAGGSIFAGYNVEDSC 90
                 Y   +  ++                A +            G   +AGY      
Sbjct: 23  PKDNTWYTGAKLGWSHYEDTSLNPAKTGTDYAGWGTVGNSTDRDTIGAGAYAGYQYNQYL 82

Query: 91  IMYGVEGDVRYTVPVLADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYE--- 147
                           A N   L  +G SL  +  Y + D L +Y  +G  V +      
Sbjct: 83  GFELGYDWFGKMKYKGAGNSGDLKSMGVSLTTKLSYPIMDDLDVYTRLGGMVYRTEAKAH 142

Query: 148 -TGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRA-SKYSKVEG-----FYNTISLG 200
             G+  + T   +     +G+E   ++     RL+Y+  S     +          +S+G
Sbjct: 143 QNGQRFKETDTGVAPVYALGLEY-AITPEWATRLDYQWVSNLGDKDNIGTRPDNGMLSVG 201

Query: 201 VGMKF 205
           V  +F
Sbjct: 202 VAYRF 206


>gi|27377196|ref|NP_768725.1| hypothetical protein bll2085 [Bradyrhizobium japonicum USDA 110]
 gi|12620785|gb|AAG61061.1|AF322013_180 ID877 [Bradyrhizobium japonicum]
 gi|27350339|dbj|BAC47350.1| bll2085 [Bradyrhizobium japonicum USDA 110]
          Length = 417

 Score = 74.1 bits (180), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 37/213 (17%), Positives = 59/213 (27%), Gaps = 27/213 (12%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+   L +G +++AL +  +A AAD              +                ++  
Sbjct: 1   MRPGVLLLGATTIALVANGAANAADLEPEVKLPAAVWNWSGGYIGGHVGGGYGRTSFS-N 59

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLAD------------ 108
               +   G             GYN + +  ++GVE DV   V    +            
Sbjct: 60  PYGPSIYGGIVDTPTFLAGGQIGYNWQKNGWVFGVELDVSGAVSDGTNTCLASSGFVVSA 119

Query: 109 NIHSLHGIGGSLRIRGGYEVS--DSLLLYATVGPDVAQKYETGKAGEI-----------T 155
           N  +   I  +   R GY        L Y   G                           
Sbjct: 120 NCKAGPNIFATATGRVGYTFGASGGTLAYLKGGAAWQNNQGDVINNHEGGLVPQEKTHFD 179

Query: 156 PIAIGGTAGVGVEVGGLSESLVARLEYRASKYS 188
              IGG  G+GVE   L+ +     EY    + 
Sbjct: 180 YGRIGGIIGLGVEQ-ALTPAWSVAAEYDYLNFG 211


>gi|83951536|ref|ZP_00960268.1| possible outer membrane protein [Roseovarius nubinhibens ISM]
 gi|83836542|gb|EAP75839.1| possible outer membrane protein [Roseovarius nubinhibens ISM]
          Length = 221

 Score = 74.1 bits (180), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 44/206 (21%), Positives = 66/206 (32%), Gaps = 22/206 (10%)

Query: 7   AVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYN- 65
           A+   +  LA    A A +           V          P   D+ G Y G    Y  
Sbjct: 31  ALTTIAAGLAITAPAYAGNISAPVVEQPVAVA----PAPVAPASPDWTGFYGGAQLGYGD 86

Query: 66  -GSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGSLRIRG 124
             S G     +  G I AGY+ +    + G   D  +    L    +  +     LR   
Sbjct: 87  VSSNGALNGDDVIGGISAGYDYDLGSWVLGGGLDYDFADINLGGGTNLENVFRAKLRA-- 144

Query: 125 GYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRA 184
           GY+V +  L+Y T G   A    TG          G   G G E   +S+++    E   
Sbjct: 145 GYKVGNG-LIYGTGGYAQADTNTTG-------SEDGYFVGAGYE-HMVSQNISVGGEALY 195

Query: 185 SKYSKVEGFYNTI-----SLGVGMKF 205
            ++  V G    +        V  +F
Sbjct: 196 HEFENVGGTTTDVEAMTYQAKVNFRF 221


>gi|299773237|gb|ADJ38693.1| outer membrane protein P5 [Haemophilus parasuis]
          Length = 362

 Score = 74.1 bits (180), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 38/228 (16%), Positives = 78/228 (34%), Gaps = 31/228 (13%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATN-RYVPIRHDFNGPYAG 59
           M+K  +A+   ++       A AA      + G +    T   +   +  ++  +  YA 
Sbjct: 1   MKKSLIALA--AVKARFASVANAAPQANSFYVGAKAGWATFHNDINQLNSKYKNDARYAT 58

Query: 60  LSALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGS 119
            +  Y         ++    +F GY + D+  +               +     H   G+
Sbjct: 59  SANRYG-----INRNSVTYGVFGGYQIIDNLAVELGYDYFGRVRGNKQEFREFKHSAHGT 113

Query: 120 -LRIRGGYEVSDSLLLYATVGPDVAQKYE-----TGKAGEITPIAIGGTAGVGVEVGGLS 173
            L ++  YEV   L +Y  VG  + +        T +  +   +      G GVE   + 
Sbjct: 114 HLSLKPSYEVLSGLDVYGKVGAALVRNDYKRYFQTREPVKSHNLKTSLIVGAGVEY-AIL 172

Query: 174 ESLVARLEYRAS----KYSKVEG------------FYNTISLGVGMKF 205
             L  R+EY+       ++K E               ++++ G+  +F
Sbjct: 173 PELAFRVEYQWLSNVGNFTKAEVKENRRATYNYSPDSHSVTAGISYRF 220


>gi|27379812|ref|NP_771341.1| outer-membrane immunogenic protein [Bradyrhizobium japonicum USDA
           110]
 gi|27352965|dbj|BAC49966.1| blr4701 [Bradyrhizobium japonicum USDA 110]
          Length = 250

 Score = 74.1 bits (180), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 37/227 (16%), Positives = 65/227 (28%), Gaps = 45/227 (19%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+++ LA     +  A             A        P       V   ++++G Y G 
Sbjct: 1   MKRIVLASASLLVLSALAP----------ASAADLAARPYTKAPVAVASIYNWSGFYIGG 50

Query: 61  SALYNGSF------------------GEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYT 102
           +A    S                   G      A      GY  + S  ++G+E    + 
Sbjct: 51  NAGGGSSHNCWDLTAVGVAAIPVTAEGCHNATGALVGGQIGYRWQSSSWVFGLEAQGDWA 110

Query: 103 VPVLAD----------NIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETG--- 149
               ++            ++     G    + GY  ++ +L Y   G  V     +G   
Sbjct: 111 DLKGSNVSAPAALFPLVNNTKIDAIGLFTGQVGYAWNN-VLWYVKGGAAVTHNKFSGTLA 169

Query: 150 --KAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFY 194
                       GGT G G+E G  + +    +EY      K    +
Sbjct: 170 GITLDTANETRWGGTVGTGIEFGF-APNWSVAVEYNHLFMGKHTDTF 215


>gi|118593217|ref|ZP_01550602.1| outer membrane protein [Stappia aggregata IAM 12614]
 gi|118434108|gb|EAV40764.1| outer membrane protein [Stappia aggregata IAM 12614]
          Length = 251

 Score = 74.1 bits (180), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 33/181 (18%), Positives = 64/181 (35%), Gaps = 10/181 (5%)

Query: 8   VGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGS 67
           + + ++       A AAD              ++    Y+      +     L +   G 
Sbjct: 41  LVLCAVLGVLVVGANAADLDTYETPLYAPTPQSLWAGPYLGFEGGVSQTVTELKSG--GR 98

Query: 68  FGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADN------IHSLHGIGGSLR 121
             + +  +A   +F GYN E S  + GVEG   Y              I +      + +
Sbjct: 99  TKDFSRVDAAFGLFGGYNWEVSRFVLGVEGGAAYLGAREKGTHPTLGAIETGSKWTINAK 158

Query: 122 IRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLE 181
            R G  + + ++ Y ++G    +        E   +++G   G GVEV  + ++   R +
Sbjct: 159 ARVGMPIKN-VMPYLSLGIAATEHSLKANGTERNSVSVGPVLGGGVEV-AVMDAWHLRAD 216

Query: 182 Y 182
           Y
Sbjct: 217 Y 217


>gi|323137480|ref|ZP_08072557.1| Carbohydrate-selective porin OprB [Methylocystis sp. ATCC 49242]
 gi|322397106|gb|EFX99630.1| Carbohydrate-selective porin OprB [Methylocystis sp. ATCC 49242]
          Length = 722

 Score = 74.1 bits (180), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 37/243 (15%), Positives = 61/243 (25%), Gaps = 69/243 (28%)

Query: 19  CSAQAADPVRRAHHGGRGVVPTIATNR--YVPIRHDFNGPYAGLSALYNG---------- 66
            +A  A  +        G  P          P    + G YAG +  +            
Sbjct: 10  SAATTAIVLVLGLTPVPGTEPGAMEGGQLAPPSVFTWTGLYAGANFGHAWASKNAIGLRS 69

Query: 67  --------------------SFGEEAHHNAGGSIFAGYNVEDS-CIMYGVEGDVRYTVPV 105
                                  +   +        GYN + +   + GVE D++     
Sbjct: 70  TNLVDLTTIGFGPASALSASGVADARLNGLFAGGQVGYNWQFAKQFVVGVEADIQGASVD 129

Query: 106 L--------------------ADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVA-- 143
                                + ++        +LR R GY  + +LLLYAT G      
Sbjct: 130 GGGGLANVAAARLAPPAWAVTSASLRRNLEYIATLRGRFGYAATPTLLLYATGGIAHGRA 189

Query: 144 -------------QKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKV 190
                           +    GE     +G   G G+E       +  +LEY       +
Sbjct: 190 RAGIELEQSLTSSDFDDAEVEGEHYGNLMGFVIGGGLE-AAFGRHVSGKLEYLYYDLGTL 248

Query: 191 EGF 193
              
Sbjct: 249 RLG 251


>gi|307294323|ref|ZP_07574167.1| putative outer membrane protein [Sphingobium chlorophenolicum L-1]
 gi|306880474|gb|EFN11691.1| putative outer membrane protein [Sphingobium chlorophenolicum L-1]
          Length = 217

 Score = 73.7 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 45/232 (19%), Positives = 81/232 (34%), Gaps = 42/232 (18%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K+  A  ++  A+AS   AQ  +P                    V     ++   AG 
Sbjct: 1   MRKILAATLLTGAAVASPALAQEPNPTFTGPR--------------VEAILGYDRTGAGS 46

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGSL 120
           S   +    +++       + AGY+V     + GVEG+   +    +    +     G +
Sbjct: 47  SVDNDNDRDDQSIDGLLYGVGAGYDVNLGSAVIGVEGEYTDSTAKSSRTDFTDQFGFGRV 106

Query: 121 R--------IRGGYEVSDSLLLYATVGPDVAQKY----ETGKAGEITPIAIGGTAGVGVE 168
           +         R G   S + L+Y   G    +      +T +  +      G   G GVE
Sbjct: 107 KQGRDLYVGARAGILASPNTLVYVKGGYTNTKLDVLAGDTNQETDTNFKLDGWRIGGGVE 166

Query: 169 VGGLSESLVARLEYRASKYSK---------------VEGFYNTISLGVGMKF 205
              ++ +  A+LEYR SKY                 ++   + +   VG +F
Sbjct: 167 -RAINANSFAKLEYRYSKYEDAHIDFANGASSDEFGIDTDRHQVVASVGWRF 217


>gi|86747693|ref|YP_484189.1| OmpA-like transmembrane domain-containing protein [Rhodopseudomonas
           palustris HaA2]
 gi|86570721|gb|ABD05278.1| OmpA-like transmembrane domain [Rhodopseudomonas palustris HaA2]
          Length = 661

 Score = 73.7 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 40/195 (20%), Positives = 62/195 (31%), Gaps = 41/195 (21%)

Query: 49  IRHDFNGPYAGLSALYNGSFGE-------------EAHHNAGGSIFAGYNV-EDSCIMYG 94
              D++G Y G  A Y     +                        AGYN+   + +++G
Sbjct: 41  PAMDWSGFYVGAHAGYVRGHADARLQDPTFAASQSSGSGGVTAGAQAGYNILTRAGVLFG 100

Query: 95  VEGDVRYTV-----------PVLADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVA 143
           VE D+ +                           G+LR R G       L Y T G    
Sbjct: 101 VEADISFPSYLPANAVLSEFDNATSTAQQHIDFYGTLRARLGVAAG-RWLGYVTGGLAYE 159

Query: 144 QKY--ETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGF-------- 193
            +       AG++    IG  AG G+E G  + +  AR+EY  S +              
Sbjct: 160 HERYLTEPGAGKVLNGRIGWAAGAGLEYGF-TPNWSARIEYLYSDFGNASVGLPTGARYD 218

Query: 194 ----YNTISLGVGMK 204
                 T+ +GV  +
Sbjct: 219 TAMNLQTVRIGVNRR 233


>gi|90579228|ref|ZP_01235038.1| hypothetical outer membrane protein OmpA [Vibrio angustum S14]
 gi|90440061|gb|EAS65242.1| hypothetical outer membrane protein OmpA [Vibrio angustum S14]
          Length = 326

 Score = 73.7 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 35/179 (19%), Positives = 59/179 (32%), Gaps = 6/179 (3%)

Query: 26  PVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSFGEEAHHNAGGSIFAGYN 85
            +  A      V  +     YV  R   +  +         S  +    N  G +FAGY 
Sbjct: 7   MIPLALFVSNSVHASTDNPWYVGARAGAS--HITNMDDAVTSVTKLEDTNFAGGVFAGYQ 64

Query: 86  VEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQK 145
           V     +      +      L +   S    G  L  +  Y +SDS+ ++A  G      
Sbjct: 65  VTPWFALETGYTHLG--NAELDNKQGSYEAQGADLVTKFSYAISDSVDIFAKAGAFYYDW 122

Query: 146 YETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFYNTISLGVGMK 204
              G     +      TAG G+E   +++++  RLEY+           +   LG+   
Sbjct: 123 NAIGSGVSNSDNGWSPTAGAGIEY-FINKNVSTRLEYQYYN-DVAGPDIHFAGLGLAFH 179


>gi|83308753|emb|CAJ01663.1| putative outer-membrane immunogenic protein precursor [Methylocapsa
           acidiphila]
          Length = 282

 Score = 73.7 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 51/250 (20%), Positives = 72/250 (28%), Gaps = 70/250 (28%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+   LA   S+ A+A   SA AAD   RA                      + G Y G 
Sbjct: 1   MRTFLLA---SAGAVALAGSAFAADLPSRA---------PPPAYVPPAPIFTWTGVYIGG 48

Query: 61  SALYNGSFGE------------------------EAHHNAGGSIFAGYNVEDSCIMYGVE 96
              Y  +                              +   G    GYN++    + G+E
Sbjct: 49  QIGYAWTNPNVTYGDAGYTVGGFPLGYADSYNVGGNANGVIGGAHVGYNLQLGQWVLGLE 108

Query: 97  GDVRYTVPVLA---------------DNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPD 141
           GDV  +                       HS  GI GS+R R G    D  LLYAT G  
Sbjct: 109 GDVDGSSISKTVSVSPYSSYYADYIPTTFHSNLGIQGSIRGRVGIAW-DRALLYATGGVA 167

Query: 142 VAQKYE-----------------TGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRA 184
                                         +   +G T G G+E   ++ +   R EYR 
Sbjct: 168 FGGFTSYVSTSYANPQGILSNFPFSGNDSFSQTRVGWTVGGGLEY-AITNNWSVRGEYRY 226

Query: 185 SKYSKVEGFY 194
           + +     + 
Sbjct: 227 TDFGHTSNYL 236


>gi|192288904|ref|YP_001989509.1| carbohydrate-selective porin OprB [Rhodopseudomonas palustris
           TIE-1]
 gi|192282653|gb|ACE99033.1| Carbohydrate-selective porin OprB [Rhodopseudomonas palustris
           TIE-1]
          Length = 689

 Score = 73.7 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 39/208 (18%), Positives = 60/208 (28%), Gaps = 30/208 (14%)

Query: 23  AADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSFGEEAHHNAGGSIFA 82
           AA  + +                +        G     +     +              A
Sbjct: 55  AAGGIGKQRPDPAYDWSGFYVGAHAGYVRGHAGATLQDATSVAQN--SNGAGGITAGAQA 112

Query: 83  GYNVEDS-CIMYGVEGDVRYTV-----------PVLADNIHSLHGIGGSLRIRGGYEVSD 130
           GYN      ++ GVE D+ +                  N        G++R R G  ++ 
Sbjct: 113 GYNFVTGSNLLLGVEADISFPSYLPQNAVLSEFDNGTANTLQHLDYYGTVRARLG-VIAG 171

Query: 131 SLLLYATVGPDVAQKY--ETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYS 188
             L Y T G     +       AG +    IG  AG GVE G  + +   R+EY  S+Y 
Sbjct: 172 RWLGYVTGGLAFEHERYLTDPDAGRVMNARIGWAAGAGVEYGF-APNWSVRIEYLYSQYQ 230

Query: 189 KVEGF------------YNTISLGVGMK 204
                              T+ +GV  K
Sbjct: 231 NASVDLPTGASYATSLNLQTVRVGVNRK 258


>gi|83308663|emb|CAJ01571.1| outer membrane protein [uncultured bacterium]
          Length = 276

 Score = 73.7 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 46/237 (19%), Positives = 68/237 (28%), Gaps = 49/237 (20%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRG------VVPTIATNRYVPIRHD-- 52
           M + FL   V ++AL    +A AAD   RA                      V       
Sbjct: 1   MYRKFLLASVGAIALTG-SAAFAADLPSRAPPPVYLPPPPIFTWTGFYIGGQVGGAWGTG 59

Query: 53  ---FNGPYAGLSALYNGSFGEEAHHNAGGSIFAGYNVEDSCI--------MYGVEGDVRY 101
              F    A      + SFG        G    G++ +            + GVEG V  
Sbjct: 60  GSSFTAFDAVTGRFVDASFGGGNPSGVIGGGHIGFDYQIPTWNWFSSSGVVIGVEGSVDG 119

Query: 102 TVPVLADNIH--------------SLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYE 147
           +       +               +   I GS+R R G    D +L+YAT G        
Sbjct: 120 SSLSKTTTVTLPGIFLNNGFATARTSADIQGSIRGRLGIAW-DRVLVYATGGVAFGGINS 178

Query: 148 T-------------GKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVE 191
                               +    G T G G+E   L+ +     EYR + +  + 
Sbjct: 179 DIQVNGVDAAGVPFFGQRNRSNDRTGWTVGGGIEY-ALTPNWSVGAEYRFTDFGTIS 234


>gi|332717300|ref|YP_004444766.1| 25 kDa outer-membrane immunogenic protein [Agrobacterium sp. H13-3]
 gi|325063985|gb|ADY67675.1| 25 kDa outer-membrane immunogenic protein [Agrobacterium sp. H13-3]
          Length = 219

 Score = 73.7 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 39/184 (21%), Positives = 66/184 (35%), Gaps = 31/184 (16%)

Query: 51  HDFNGPYAGLSALYNGSFGEEA-----------HHNAGGSIFAGYNVEDSC-IMYGVEGD 98
             + G  AG+ A Y  +  + +              A    F G+N +     + G+E D
Sbjct: 38  FSWTGFTAGVQAGYGWNNNDASIVGLPGQTSADFDGALAGGFVGFNYDLGNSWVVGLEAD 97

Query: 99  VRYTVPVLAD-----NIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGE 153
                   +               GS+R R GY   D  L+Y T G   A+ Y       
Sbjct: 98  FEKNWGDDSATILGTGFDYGFDWQGSVRGRVGYAF-DRALVYGTAGWAYARGYAEVPGIA 156

Query: 154 I-TPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFY-----------NTISLGV 201
                  G T GVG++    ++ +  R+EYR + +   +  +           + I +G+
Sbjct: 157 DVKETFNGYTVGVGLDY-AFTDMVFGRVEYRYTDFGDKDFDFGGAAINADVDQHAIRVGL 215

Query: 202 GMKF 205
           G+KF
Sbjct: 216 GVKF 219


>gi|146340936|ref|YP_001205984.1| putative outer-membrane protein [Bradyrhizobium sp. ORS278]
 gi|146193742|emb|CAL77759.1| putative outer-membrane protein, putative secreted protein
           [Bradyrhizobium sp. ORS278]
          Length = 217

 Score = 73.7 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 44/193 (22%), Positives = 63/193 (32%), Gaps = 28/193 (14%)

Query: 39  PTIATNRYVPIRHDFNGPYAGLSALYNGSFGEE--AHHNAGGSIFAGYNVEDSCIMYGVE 96
           PT      +     + G Y G    Y  +      +          GYN +    +YG+E
Sbjct: 27  PTYTKAPVLAPVPTWAGFYLGAFGGYATTDNGGVLSPKGGFAGGTIGYNWQSGAWVYGLE 86

Query: 97  GDVRYTVPV----------LADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKY 146
            D  +               A  I S     G+ R R GY  ++ +LLY T G   A   
Sbjct: 87  ADAAWADIKDSVGGVVPGFGAVGIASKIDATGTARGRVGYAFNN-VLLYGTGGYAWANNK 145

Query: 147 ET----GKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGF--------- 193
            T    G     T    G TAG GVEV   +     + EY    +     F         
Sbjct: 146 ITLSALGVGVSDTQFLSGWTAGGGVEV-LFAPKWSVKAEYLYKSFDGKTYFGGALPTGNL 204

Query: 194 -YNTISLGVGMKF 205
             +++ +GV   F
Sbjct: 205 NLHSVQVGVNYHF 217


>gi|192293657|ref|YP_001994262.1| hypothetical protein Rpal_5301 [Rhodopseudomonas palustris TIE-1]
 gi|192287406|gb|ACF03787.1| conserved hypothetical protein [Rhodopseudomonas palustris TIE-1]
          Length = 561

 Score = 73.7 bits (179), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 33/186 (17%), Positives = 51/186 (27%), Gaps = 36/186 (19%)

Query: 41  IATNRYVPIRHDFNGPYAGLSA-------------LYNGSFGEEAHHNAGGSIFAGYNVE 87
                  P+  ++ G Y G                      G      A   I  GYN +
Sbjct: 27  PPLMPVAPVSWNWTGLYWGAHVGGSFGSSSFSDPAGPALYGGSVRSPAALAGIQIGYNYQ 86

Query: 88  DS-CIMYGVEGDVRYTVPVLAD------------NIHSLHGIGGSLRIRGGYEVSD--SL 132
            +   + GVE D+        +            N         +L  R G+        
Sbjct: 87  PNANWLIGVEADLSSMNAKGTNTCMASSGLFISSNCRVRQDALATLTGRAGFVAGPGGRT 146

Query: 133 LLYATVGPDVAQKYETGKAGEI-------TPIAIGGTAGVGVEVGGLSESLVARLEYRAS 185
           LLYA  G     +      G              G T G G+E   L+ +   +LEY  +
Sbjct: 147 LLYAKGGAAFLSERLDIAVGYPLGNSTDVNDGRWGWTVGAGIE-RALAPAWSVKLEYNYA 205

Query: 186 KYSKVE 191
            +   +
Sbjct: 206 DFGSRD 211


>gi|256809485|gb|ACV30843.1| 25 kDa outer membrane protein [Ochrobactrum cytisi]
          Length = 130

 Score = 73.7 bits (179), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 35/139 (25%), Positives = 58/139 (41%), Gaps = 16/139 (11%)

Query: 8   VGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGS 67
           V  S+  L    +A AAD ++          P +     +  ++ + G Y GL   Y  +
Sbjct: 1   VIASAALLPFSATAFAADAIQEQ--------PPVPAPVEMAPQYSWAGGYTGLYLGYGWN 52

Query: 68  FGEEAH------HNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLA-DNIHSLHGIGGSL 120
             +          +     +AG+N +    +YGVEGD  Y+      D +    G  GSL
Sbjct: 53  KAKTDTVGTIKPDDMKAGAYAGWNFQQDQFVYGVEGDAGYSWAKKTKDGLEVKQGFEGSL 112

Query: 121 RIRGGYEVSDSLLLYATVG 139
           R R GY+++  ++ Y T G
Sbjct: 113 RARLGYDLNP-VMPYITAG 130


>gi|209885046|ref|YP_002288903.1| hypothetical protein OCAR_5916 [Oligotropha carboxidovorans OM5]
 gi|209873242|gb|ACI93038.1| conserved hypothetical protein [Oligotropha carboxidovorans OM5]
          Length = 574

 Score = 73.7 bits (179), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 36/216 (16%), Positives = 60/216 (27%), Gaps = 44/216 (20%)

Query: 16  ASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSFGEEAHH- 74
           A  C A +A            VVP  A+    P+  ++ G Y G          +  +  
Sbjct: 12  ALACLAVSALAFTNVEAREARVVPVSAS----PVLWNWTGFYLGAHLGAGFGTSKVDNPY 67

Query: 75  ------------NAGGSIFAGYNVE--DSCIMYGVEGDVRYTVPVLAD------------ 108
                            +  GYN +   S  ++GVE DV        +            
Sbjct: 68  GPSIYGDTIRLPGGFAGLQGGYNWQGAGSPWVFGVEADVSAVNADGTNTCLAYSGQFVSA 127

Query: 109 NIHSLHGIGGSLRIRGGYEVSD--SLLLYATVGPDVAQKYETGKAGEIT----------P 156
           N  +     GS+  R G  +S     L Y   G        +                  
Sbjct: 128 NCRARQQAMGSITGRIGRTISPDGRTLAYIKGGTAFMSGDLSLTTNAPDYILQPSSERRD 187

Query: 157 IAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEG 192
              G   G G+E   ++ +   + EY  + +   + 
Sbjct: 188 TRWGWMLGAGLE-HAITGAWSVKAEYAYANFGHRDV 222


>gi|260767782|ref|ZP_05876717.1| outer membrane protein A precursor [Vibrio furnissii CIP 102972]
 gi|260617291|gb|EEX42475.1| outer membrane protein A precursor [Vibrio furnissii CIP 102972]
          Length = 332

 Score = 73.7 bits (179), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 35/208 (16%), Positives = 58/208 (27%), Gaps = 42/208 (20%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K  LA  VS+  L +   A A                 +     V      +      
Sbjct: 1   MKK--LAAMVSASLLVASSVAMA----------------DVYVGAKVGKTWLDDACN--- 39

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGSL 120
                 +               GYN         +EG   Y        +        +L
Sbjct: 40  ------NTESCDLDGTTAGALLGYNF---NDWLALEGGYDYLGKFNGAGLDRDTIQAYTL 90

Query: 121 RIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARL 180
             +  Y +++   LY  VG    +                     GVE    + +L  R+
Sbjct: 91  APKLSYALTEQWDLYGKVGAARVR--------YGDASDYSYLGAAGVEYAA-TRNLGVRV 141

Query: 181 EYRA-SKYSK--VEGFYNTISLGVGMKF 205
           EY+  S  +   V    +T +LG+  +F
Sbjct: 142 EYQYLSDMNNDVVRAKAHTTTLGLVYRF 169


>gi|256809429|gb|ACV30815.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809431|gb|ACV30816.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809433|gb|ACV30817.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809435|gb|ACV30818.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809437|gb|ACV30819.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809439|gb|ACV30820.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809441|gb|ACV30821.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809443|gb|ACV30822.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809445|gb|ACV30823.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809519|gb|ACV30860.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809521|gb|ACV30861.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809525|gb|ACV30863.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809539|gb|ACV30870.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
          Length = 130

 Score = 73.3 bits (178), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 36/139 (25%), Positives = 58/139 (41%), Gaps = 16/139 (11%)

Query: 8   VGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGS 67
           V  S+  L    +A AAD ++          P +     +  ++ + G Y GL   Y  +
Sbjct: 1   VIASAALLPFSATAFAADAIQEQ--------PPVPAPVEMAPQYSWAGGYTGLYLGYGWN 52

Query: 68  F------GEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLA-DNIHSLHGIGGSL 120
                  G     +     +AG+N +    +YGVEGD  Y+      D +    G  GSL
Sbjct: 53  KVKTDTVGTVKPDDMKAGAYAGWNFQQDQFVYGVEGDAGYSWAKKTKDGLEVKQGFEGSL 112

Query: 121 RIRGGYEVSDSLLLYATVG 139
           R R GY+++  ++ Y T G
Sbjct: 113 RARLGYDLNP-VMPYITAG 130


>gi|256809411|gb|ACV30806.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
          Length = 130

 Score = 73.3 bits (178), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 35/139 (25%), Positives = 57/139 (41%), Gaps = 16/139 (11%)

Query: 8   VGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGS 67
           V  S+  L    +A AAD ++          P +     +  ++ + G Y GL   Y  +
Sbjct: 1   VIASAALLPFSATAFAADAIQEQ--------PPVPAPVEMAPQYSWAGGYTGLYLGYGWN 52

Query: 68  FGEEAHHNAG------GSIFAGYNVEDSCIMYGVEGDVRYTVPVLA-DNIHSLHGIGGSL 120
             +                +AG+N +    +YGVEGD  Y+      D +    G  GSL
Sbjct: 53  KAKTDTVGTVKPDDMKAGAYAGWNFQQDQFVYGVEGDAGYSWAKKTKDGLEVKQGFEGSL 112

Query: 121 RIRGGYEVSDSLLLYATVG 139
           R R GY+++  ++ Y T G
Sbjct: 113 RARLGYDLNP-IMPYITAG 130


>gi|15420180|gb|AAK97312.1|AF308170_1 Pap31 [Bartonella henselae phage 60457]
          Length = 240

 Score = 73.3 bits (178), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 43/250 (17%), Positives = 71/250 (28%), Gaps = 86/250 (34%)

Query: 13  LALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSFGEEA 72
           +AL S  +AQAAD +         +               + G Y G       S  E  
Sbjct: 1   IALISASAAQAADVIVPHEVAPTVISAPA---------FSWTGFYIGGQVGNFSSKVEIT 51

Query: 73  H----------------HNAGGSIFAGYNVEDSC-IMYGVEGDVRYTVPVLADNIHSL-- 113
                                G I+AG N+     ++ GVE D  +     A    +   
Sbjct: 52  DPNKKDKLFSKDDTPKPSGFMGGIYAGSNMSLGNNMILGVETDAVWADREDAKTSSAKVI 111

Query: 114 -----------------------------------------HGIGGSLRIRGGYEVSDSL 132
                                                        G+ R+R G+  +D +
Sbjct: 112 REDELANFKDSLKNANAVFAKDKTSDDVKQDEKHTDSLALKEKWSGATRVRIGFTAADRI 171

Query: 133 LLYATVGPDVAQKY----------------ETGKAGEITPIAIGGTAGVGVEVGGLSESL 176
           + Y   G   AQ                   + +  + T   +G T G GV+   +++++
Sbjct: 172 MPYVAGGVSYAQVQAVSSTKVTQAADDAEIASAQLFDKTKTLVGFTLGGGVDF-AMTDNV 230

Query: 177 VARLEYRASK 186
           + R EYR S 
Sbjct: 231 LLRAEYRYSD 240


>gi|319898546|ref|YP_004158639.1| Hemin binding protein B [Bartonella clarridgeiae 73]
 gi|319402510|emb|CBI76053.1| putative Hemin binding protein B [Bartonella clarridgeiae 73]
          Length = 609

 Score = 73.3 bits (178), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 21/125 (16%), Positives = 40/125 (32%), Gaps = 24/125 (19%)

Query: 103 VPVLADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDV--------------AQKYET 148
             V     +      G+ RIR G       + Y   G                  ++  +
Sbjct: 487 DLVETYTHNLKQKWSGATRIRLGLAAG-RFMPYIAGGVAYTKIQGTFSKLIKEIGKENTS 545

Query: 149 GKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEG--------FYNTISLG 200
               +     IG T   G +   +++ ++ R EYR S + + +           N + +G
Sbjct: 546 SNLFDSVETMIGYTLSGGFDF-AMTDRVLIRSEYRYSDFGEKKFKKINSKYYKINDVRIG 604

Query: 201 VGMKF 205
           +  KF
Sbjct: 605 LAYKF 609



 Score = 47.1 bits (110), Expect = 0.002,   Method: Composition-based stats.
 Identities = 16/118 (13%), Positives = 32/118 (27%), Gaps = 11/118 (9%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPV----RRAHHGGRGVVPTIATNRYVPIRHDFNGP 56
           M   +L V +S  +       Q AD +     R+                +         
Sbjct: 1   MITKYL-VTISVFSFILASRVQGADIINHQDSRSIVAPVYSWKGFYLGGQIGGFSGLTTF 59

Query: 57  YA---GLSALYNGSFGEEAHH--NAGGSIFAGYNVEDSC-IMYGVEGDVRYTVPVLAD 108
                     +N    + +       G  +AG N +     + GV+ D+ ++      
Sbjct: 60  NYHKYDNIEKWNSIDEDLSSEIFGFTGGFYAGSNFDFGNGFILGVDTDIVFSNKKDTK 117


>gi|256809513|gb|ACV30857.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
          Length = 130

 Score = 73.3 bits (178), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 35/139 (25%), Positives = 59/139 (42%), Gaps = 16/139 (11%)

Query: 8   VGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGS 67
           V  S+  L    +A AAD ++          P +     +  ++ + G Y GL   Y  +
Sbjct: 1   VIASAALLPFSATAFAADAIQEQ--------PPVPAPVEMAPQYSWAGGYTGLYLGYGWN 52

Query: 68  FGEEA------HHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLA-DNIHSLHGIGGSL 120
             +          +     +AG+N +    +YGVEGD  Y+    + D +    G  GSL
Sbjct: 53  KAKTDAVGTIKPDDMKAGAYAGWNFQQDQFVYGVEGDAGYSWAKKSKDGLEVKQGFEGSL 112

Query: 121 RIRGGYEVSDSLLLYATVG 139
           R R GY+++  ++ Y T G
Sbjct: 113 RARLGYDLNP-VMPYITAG 130


>gi|163867547|ref|YP_001608746.1| hemin binding protein B [Bartonella tribocorum CIP 105476]
 gi|161017193|emb|CAK00751.1| hemin binding protein B [Bartonella tribocorum CIP 105476]
          Length = 544

 Score = 73.3 bits (178), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 40/206 (19%), Positives = 60/206 (29%), Gaps = 51/206 (24%)

Query: 48  PIRHDFNGPYAGLSALYNGSFGEEAHHNAGGSIFAGYNVEDSC----------------I 91
                  G ++     Y  S G       G     G+N                      
Sbjct: 342 GTSGAHGGYHSAHGGGYAYSHGTSQSGGHGSGAR-GHNANPHSRSHGAQSTQAADKNESS 400

Query: 92  MYGVEG--------DVRYTVPVLADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVA 143
           +YG+E          +     V   +       GG+ R+R G+  +D  + Y   G    
Sbjct: 401 VYGIEQMRRMASELGLEQGDEVETLDHTFKQNWGGATRVRIGFA-ADRFMPYLAGGIAYG 459

Query: 144 QKYETGKAGEIT---------------PIAIGGTAGVGVEVGGLSESLVARLEYRASKYS 188
           Q  +T                         IG T G GV+   L ++++ R EYR S + 
Sbjct: 460 QFQDTISISVKDEEGTVVSSKNLTDETKTMIGYTLGGGVDFSVL-DNVIVRAEYRYSDFG 518

Query: 189 K---------VEGFYNTISLGVGMKF 205
           K         V    N   +GV  KF
Sbjct: 519 KKKFSKEKLEVNYKTNDFRVGVAYKF 544



 Score = 49.0 bits (115), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 24/143 (16%), Positives = 44/143 (30%), Gaps = 25/143 (17%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M    L +  S  +L S  +A AAD +               ++  V     + G Y G+
Sbjct: 1   MNTKRL-ITASIFSLISASTALAADVLIPHQPASST------SSTIVAPTFSWTGLYLGV 53

Query: 61  SALYNGSFGEEA-----------------HHNAGGSIFAGYNVEDSC-IMYGVEGDVRYT 102
            A    S  + A                      G  +AG N++     ++G++ D+  +
Sbjct: 54  QAGGFSSKADLALVGQEKSFPLDKEFSPKLSGFAGGFYAGSNIDLGDSFIFGIDTDLMLS 113

Query: 103 VPVLADNIHSLHGIGGSLRIRGG 125
                  I        ++    G
Sbjct: 114 GKKHTKTITIGAADNITVENAVG 136


>gi|256809401|gb|ACV30801.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809403|gb|ACV30802.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809405|gb|ACV30803.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809407|gb|ACV30804.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809409|gb|ACV30805.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809413|gb|ACV30807.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809415|gb|ACV30808.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809417|gb|ACV30809.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809419|gb|ACV30810.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809421|gb|ACV30811.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809423|gb|ACV30812.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809425|gb|ACV30813.1| 25 kDa outer membrane protein [Ochrobactrum lupini]
 gi|256809427|gb|ACV30814.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809447|gb|ACV30824.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809449|gb|ACV30825.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809451|gb|ACV30826.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809453|gb|ACV30827.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809455|gb|ACV30828.1| 25 kDa outer membrane protein [Ochrobactrum anthropi ATCC 49188]
 gi|256809457|gb|ACV30829.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809459|gb|ACV30830.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809461|gb|ACV30831.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809463|gb|ACV30832.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809465|gb|ACV30833.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809467|gb|ACV30834.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809469|gb|ACV30835.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809471|gb|ACV30836.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809473|gb|ACV30837.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809475|gb|ACV30838.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809477|gb|ACV30839.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809479|gb|ACV30840.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809481|gb|ACV30841.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809483|gb|ACV30842.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809487|gb|ACV30844.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809489|gb|ACV30845.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809491|gb|ACV30846.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809493|gb|ACV30847.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809495|gb|ACV30848.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809497|gb|ACV30849.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809499|gb|ACV30850.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809501|gb|ACV30851.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809503|gb|ACV30852.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809505|gb|ACV30853.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809507|gb|ACV30854.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809509|gb|ACV30855.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809511|gb|ACV30856.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809515|gb|ACV30858.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809517|gb|ACV30859.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809523|gb|ACV30862.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809527|gb|ACV30864.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809529|gb|ACV30865.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809531|gb|ACV30866.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809533|gb|ACV30867.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
 gi|256809535|gb|ACV30868.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
          Length = 130

 Score = 73.3 bits (178), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 35/139 (25%), Positives = 57/139 (41%), Gaps = 16/139 (11%)

Query: 8   VGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGS 67
           V  S+  L    +A AAD ++          P +     +  ++ + G Y GL   Y  +
Sbjct: 1   VIASAALLPFSATAFAADAIQEQ--------PPVPAPVEMAPQYSWAGGYTGLYLGYGWN 52

Query: 68  FGEEAHHNAG------GSIFAGYNVEDSCIMYGVEGDVRYTVPVLA-DNIHSLHGIGGSL 120
             +                +AG+N +    +YGVEGD  Y+      D +    G  GSL
Sbjct: 53  KAKTDTVGTVKPDDMKAGAYAGWNFQQDQFVYGVEGDAGYSWAKKTKDGLEVKQGFEGSL 112

Query: 121 RIRGGYEVSDSLLLYATVG 139
           R R GY+++  ++ Y T G
Sbjct: 113 RARLGYDLNP-VMPYITAG 130


>gi|159042840|ref|YP_001531634.1| putative outer membrane protein [Dinoroseobacter shibae DFL 12]
 gi|157910600|gb|ABV92033.1| putative outer membrane protein [Dinoroseobacter shibae DFL 12]
          Length = 216

 Score = 72.9 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 34/215 (15%), Positives = 62/215 (28%), Gaps = 20/215 (9%)

Query: 2   QKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLS 61
           +++F       L LA+   +  A     A      V P  A   +      + G Y G  
Sbjct: 11  KEMFRTATAFGLVLAASTGSLYAGNPEPAPVAPVMVAPVPAPAPF------WAGGYIGAQ 64

Query: 62  ALYNGSF--------GEEAHHNAGGSIFAGYNVEDSC-IMYGVEGDVRYTV--PVLADNI 110
             Y            G++      G + AGY  +       G E    +           
Sbjct: 65  LGYAYGDFDIDAAIDGDDNDDGFIGGLTAGYLFDVGSGWYVGPEVQYDWADLEITEDGGD 124

Query: 111 HSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVG 170
            +       L++  G E+ + LL         +          I         G+G +  
Sbjct: 125 TASFDEIARLKLIVGREIGNGLLYGTAGIAYGSLDSAGDVFDGIDGSDTNWLLGLGYDY- 183

Query: 171 GLSESLVARLEYRASKYSKVEGFYNTISLGVGMKF 205
            + ++     EY    +  V+   NT+ +    +F
Sbjct: 184 RVGDNWTVGGEYMYHSFDDVD--LNTLHIKAAYRF 216


>gi|113461178|ref|YP_719247.1| hemagglutinin antigen [Haemophilus somnus 129PT]
 gi|112823221|gb|ABI25310.1| hemagglutinin antigen [Haemophilus somnus 129PT]
          Length = 355

 Score = 72.9 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 38/225 (16%), Positives = 65/225 (28%), Gaps = 39/225 (17%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAG- 59
           M+K  +A+ ++        S QAA                 A   Y   +  +   + G 
Sbjct: 14  MKKTIIALSIA----GFVASVQAA---------------PQANTFYAGAKAGWASFHDGL 54

Query: 60  LSALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGS 119
                +        ++    IF GY + D   +                +       G  
Sbjct: 55  NQFEDSSQKKGTVRNSVAYGIFGGYQITDHVAVELGSEYFGQAKGRKDKDEAKHTAQGMQ 114

Query: 120 LRIRGGYEVSDSLLLYATVGPDVAQK------YETGKAGEITPIAIGGTAGVGVEVGGLS 173
           L ++  Y V + L +Y  VG  + +                  + +      GVE    S
Sbjct: 115 LGLKASYPVLEGLDIYGRVGAALIRSNYLNVEKFESGKDVKNTLKVSPVFAAGVEYSLPS 174

Query: 174 -ESLVARLEYRASK-----YSKVEG-------FYNTISLGVGMKF 205
              L  RLEY+  K       K  G           ++LG+  +F
Sbjct: 175 LPELALRLEYQWVKGVGKALKKSSGERLDYTPSIGAVTLGLSYRF 219


>gi|85714675|ref|ZP_01045662.1| possible outer membrane protein [Nitrobacter sp. Nb-311A]
 gi|85698560|gb|EAQ36430.1| possible outer membrane protein [Nitrobacter sp. Nb-311A]
          Length = 222

 Score = 72.9 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 36/216 (16%), Positives = 67/216 (31%), Gaps = 18/216 (8%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K+ L      ++ ++  +A  A              P      +    H         
Sbjct: 1   MKKILLTTAAVLISASAASAADLAARPYTKAPPYAPPAPIYNWTGFYLGGHIGGAFGGAN 60

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVED-SCIMYGVEGDVRYTVPVLADNIHSLHGIGGS 119
           +    G           G +  GY+ +     ++G+E +  +            +   GS
Sbjct: 61  NIFAPGVAFNNNDGVFMGGVQVGYDTQFSPNWVFGLEANYSFLD----TGSFFANRGLGS 116

Query: 120 LRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVAR 179
           +  R GY    +LL Y   G   A    T           G T G G+E    +++   +
Sbjct: 117 VTGRLGYTWGPALL-YVKGGYGWADSRFT-NGFGGNGGRDGYTVGGGLEY-LFTQNWSGK 173

Query: 180 LEYRASKYSKV----------EGFYNTISLGVGMKF 205
           +EY+      V              +TI +G+  +F
Sbjct: 174 VEYQYYDLGTVNLVAPVVANFRNDQHTIKVGLNYRF 209


>gi|240849918|ref|YP_002971307.1| hemin binding protein B [Bartonella grahamii as4aup]
 gi|240267041|gb|ACS50629.1| hemin binding protein B [Bartonella grahamii as4aup]
          Length = 582

 Score = 72.9 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 37/205 (18%), Positives = 61/205 (29%), Gaps = 33/205 (16%)

Query: 25  DPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSFGEEAHHNAGGSIFAGY 84
           D        G G       +   P     +G           +   + ++++   I    
Sbjct: 387 DANPHGASHGGGHGSGAHAHGANPHASRSHGGQNMAGHGAQSTQAVDKNNSSVYGIE--- 443

Query: 85  NVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQ 144
             +        E  +     V   N       GG+ R+R G+  +D  + Y   G    Q
Sbjct: 444 --QMKR--VASELGLDQEDEVETLNHTFKQNWGGATRVRIGFA-ADRFMPYLAGGIAYGQ 498

Query: 145 KYETGKAGEIT---------------PIAIGGTAGVGVEVGGLSESLVARLEYRASKYS- 188
             +T                         IG T G GV+   L ++++ R EYR S +  
Sbjct: 499 FQDTISISVKDEDGRVVSSKNLADETKTMIGYTLGGGVDFSVL-DNVIVRAEYRYSDFGK 557

Query: 189 --------KVEGFYNTISLGVGMKF 205
                   +V    N   +GV  KF
Sbjct: 558 KKFAKEKFEVNYKTNDFRVGVAYKF 582



 Score = 52.1 bits (123), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 23/138 (16%), Positives = 42/138 (30%), Gaps = 25/138 (18%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M    L +  S  +L S  +A AAD +               ++  V     + G Y G+
Sbjct: 1   MNTKRL-ITASIFSLISTSTALAADVMIPHQPA------PSTSSAIVAPTFSWTGLYLGV 53

Query: 61  SALYNGSFGE-----------------EAHHNAGGSIFAGYNVEDS-CIMYGVEGDVRYT 102
            A    S  +                        G  +AG N++     ++GV+ D+  +
Sbjct: 54  QAGGFSSKSDMALVDQEKNLPLDKEFSPKLSGFVGGFYAGSNIDLGDNFIFGVDTDLMIS 113

Query: 103 VPVLADNIHSLHGIGGSL 120
                  I        ++
Sbjct: 114 GKKHTKTITIGAADNTTV 131


>gi|254470997|ref|ZP_05084400.1| outer membrane protein [Pseudovibrio sp. JE062]
 gi|211960139|gb|EEA95336.1| outer membrane protein [Pseudovibrio sp. JE062]
          Length = 201

 Score = 72.9 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 44/190 (23%), Positives = 73/190 (38%), Gaps = 25/190 (13%)

Query: 39  PTIATNRYVPIRHDFNGPYAGLSALYNGSFGEEAH------HNAGGSIFAGYNVEDSCIM 92
           P +A    +     ++G Y GL   +    G++         +     F GYN     I+
Sbjct: 14  PCVAFADDMSSVGKWDGFYLGLKGGFGQLTGKDTLGSKGTLDSGVVGAFGGYNHSFDRIV 73

Query: 93  YGVEGDV---RYTVPVLADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETG 149
            GVE D+    YT    +    S      S  +R GY+     L Y + G  +A+     
Sbjct: 74  VGVEADLNATNYTSVSDSGVSRSRSKWNTSATVRLGYDAG-MFLPYLSAGVGLAEYEVKR 132

Query: 150 KAGEIT--PIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFY------------N 195
            A         IG   G G+E   ++E++ ARL+Y+  + SK +  +            +
Sbjct: 133 FADGQKSENTHIGLVVGAGLE-AMITENVSARLDYKHMEMSKEKYKFQGFNAFHIEGRQD 191

Query: 196 TISLGVGMKF 205
            ++LGV   F
Sbjct: 192 LVTLGVAYNF 201


>gi|27379782|ref|NP_771311.1| outer-membrane immunogenic protein [Bradyrhizobium japonicum USDA
           110]
 gi|27352935|dbj|BAC49936.1| bll4671 [Bradyrhizobium japonicum USDA 110]
          Length = 282

 Score = 72.9 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 36/237 (15%), Positives = 65/237 (27%), Gaps = 41/237 (17%)

Query: 8   VGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHD---FNGPYAGLSALY 64
           + +++  L+    A AAD +  A               +    H    ++          
Sbjct: 48  LVLTAALLSLATPAFAADIIAPAPVKAPVPAAIFTWTGFYIGAHGGGAWSKWTGIDPTDP 107

Query: 65  NGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLA----------DNIHSLH 114
              +              G N +   ++ G+EG   ++   L             +   +
Sbjct: 108 TAVWTSVTASGGIVGGQIGGNYQIGNVVVGLEGTGAWSSVTLNAGGPFGGGAGFTLSLKN 167

Query: 115 GIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAG---------EITPIAIGGTAGV 165
               ++  R G    D +LLYA  G    +       G           +    G  AG 
Sbjct: 168 DYIATVAGRFGVAF-DRVLLYAKGGAAFTRDKYNANNGLAGALAGSASGSFNRTGWLAGG 226

Query: 166 GVEVGGLSESLVARLEYRASKY-----------------SKVEGFYNTISLGVGMKF 205
           GVE      +   R EY    +                 + V+    T ++GV   F
Sbjct: 227 GVE-WMFMPNWSVRAEYNYMGFAAITEQPVTSGNLAATPANVKLNIQTGTVGVNYHF 282


>gi|91978859|ref|YP_571518.1| OmpA-like transmembrane region [Rhodopseudomonas palustris BisB5]
 gi|91685315|gb|ABE41617.1| OmpA-like transmembrane region [Rhodopseudomonas palustris BisB5]
          Length = 559

 Score = 72.9 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 31/184 (16%), Positives = 52/184 (28%), Gaps = 36/184 (19%)

Query: 44  NRYVPIRHDFNGPYAGLSALYNGSFGEEAHHNAGG-------------SIFAGYNVEDS- 89
               P+  ++ G Y G     +      +     G              I  GYN + + 
Sbjct: 27  PPAAPVLWNWTGLYWGAHLGGSFGASSFSDPAGPGIYGGNVRSPAAMAGIQLGYNYQPNA 86

Query: 90  CIMYGVEGDVRYTVPVLAD------------NIHSLHGIGGSLRIRGGYEVSD--SLLLY 135
             + GVE D+        +            N         ++  R G         LLY
Sbjct: 87  NWLVGVEADLSALNGNGTNSCMVSSGLVISANCRVRQDAMATVTGRAGLVTGPGGRTLLY 146

Query: 136 ATVGPDVAQKYETGKAGE-------ITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYS 188
           A  G     +      G         +    G TAG G+E   L+ +   + EY  + + 
Sbjct: 147 AKGGAAFLSERIDITVGNPLRSSTDNSDGRWGWTAGAGIEQ-ALAPAWSVKFEYDYANFG 205

Query: 189 KVEG 192
             + 
Sbjct: 206 SSDV 209


>gi|330828258|ref|YP_004391210.1| outer membrane protein A [Aeromonas veronii B565]
 gi|328803394|gb|AEB48593.1| Outer membrane protein A [Aeromonas veronii B565]
          Length = 345

 Score = 72.9 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 39/218 (17%), Positives = 68/218 (31%), Gaps = 37/218 (16%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K  + + V+ L      +AQAA                     Y   +  ++  Y   
Sbjct: 1   MKKSLITLLVTGLL---AANAQAAGQ---------------DNTWYGGAKLGWSNFYGID 42

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIG--- 117
            +    + G E +   G  +F GY +  +    G+E    Y      D   +        
Sbjct: 43  ESN-ALTLGNETNDALGAGVFGGYQINKN---LGLELGYDYLGNYKYDATTAAGAFSDEV 98

Query: 118 ----GSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLS 173
                 L ++ G+ V+D+L LY  VG                         +G E     
Sbjct: 99  KAQLAQLTLKLGFPVTDNLDLYGRVGGGYGWADTKSDV-YKDDSRFVMVGALGAEYAFNL 157

Query: 174 ESLVARLEYRAS------KYSKVEGFYNTISLGVGMKF 205
           +   ARLEY+ +        + +      +SL    +F
Sbjct: 158 D-WAARLEYQYTTPYGSRDDTGLRMDNGLLSLAAVYRF 194


>gi|209695194|ref|YP_002263123.1| outer membrane protein, OmpA family [Aliivibrio salmonicida
           LFI1238]
 gi|208009146|emb|CAQ79386.1| outer membrane protein, OmpA family [Aliivibrio salmonicida
           LFI1238]
          Length = 355

 Score = 72.9 bits (177), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 23/140 (16%), Positives = 48/140 (34%), Gaps = 5/140 (3%)

Query: 70  EEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGSLRIRGGYEVS 129
           +    + GG  F GY + +S  +   +  +            +       L  +  Y ++
Sbjct: 71  DCDRTDLGGGFFVGYQINESWGIELGKTFLGAAKAEYFSRKVTGDMETIDLFGKYTYGLT 130

Query: 130 DSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRAS---- 185
           D    +   G             E T      + G G +   L++  + +LEY+      
Sbjct: 131 DRFGFFGKAGLANWNGKTKSDYVETTTFGHDLSVGFGAQY-ALNKRWLTQLEYQYINSIG 189

Query: 186 KYSKVEGFYNTISLGVGMKF 205
             +  E  Y+ +S+G+  +F
Sbjct: 190 DDTVGESDYHLMSIGIIYRF 209


>gi|15420178|gb|AAK97311.1|AF308169_1 Pap31 [Bartonella henselae phage 60457]
          Length = 239

 Score = 72.9 bits (177), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 43/249 (17%), Positives = 72/249 (28%), Gaps = 86/249 (34%)

Query: 13  LALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSFGEEA 72
           +AL S  +AQAAD +         +               + G Y G       S  E  
Sbjct: 1   IALISPSAAQAADVIVPHEVAPTVISAPA---------FSWTGFYIGGQVGNFSSKVEIT 51

Query: 73  H----------------HNAGGSIFAGYNVEDSC-IMYGVEGDVRYTVPVLADNIHSL-- 113
                                G I+AG N++    ++ GVE D  +     A    +   
Sbjct: 52  DPNKKDKLFSKDDTPKPSGFMGGIYAGSNMDLGNNMILGVETDAVWADREDAKTSSAKVI 111

Query: 114 -----------------------------------------HGIGGSLRIRGGYEVSDSL 132
                                                        G+ R+R G+  +D +
Sbjct: 112 REDELANFKDSLKNANAVFAKDKTMDDVKQDEKHTDSLALKEKWSGATRVRIGFTAADRI 171

Query: 133 LLYATVGPDVAQKY----------------ETGKAGEITPIAIGGTAGVGVEVGGLSESL 176
           + Y   G   AQ                   + +  + T   +G T G GV+   +++++
Sbjct: 172 MPYVAGGVSYAQVQAVSSTKVTQAADDAEIASAQLFDKTKTLVGFTLGGGVDF-AMTDNV 230

Query: 177 VARLEYRAS 185
           + R EYR S
Sbjct: 231 LLRAEYRYS 239


>gi|49474039|ref|YP_032081.1| hemin binding protein d [Bartonella quintana str. Toulouse]
 gi|21689907|gb|AAM68131.1| hemin-binding protein D [Bartonella quintana]
 gi|49239543|emb|CAF25900.1| Hemin binding protein d [Bartonella quintana str. Toulouse]
          Length = 294

 Score = 72.9 bits (177), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 24/118 (20%), Positives = 42/118 (35%), Gaps = 24/118 (20%)

Query: 110 IHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQK-------------YETGKAGEITP 156
                   G+ R+R G+   + L+ Y   G    Q                +    +   
Sbjct: 179 ATLKQKWSGATRVRVGFS-GERLMPYIAGGVAYTQIQNTFVAPPNFVVIDFSRFLHDEKK 237

Query: 157 IAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFY---------NTISLGVGMKF 205
             +G T G GV+   ++++++ R EYR S + K +            N   +GV  KF
Sbjct: 238 TFVGYTLGGGVDF-AMTDNVIMRAEYRYSDFGKKKFGQDRVEIGYKTNDFRVGVAYKF 294



 Score = 52.5 bits (124), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 26/135 (19%), Positives = 41/135 (30%), Gaps = 35/135 (25%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M K +L +  S  +L S   AQAAD +          VP             + G Y G 
Sbjct: 1   MAKKYL-ITTSIFSLISISVAQAADVIIPEQPESVVAVPA----------FSWTGFYLGG 49

Query: 61  SALYNGSFGEEA-----------------------HHNAGGSIFAGYNVEDS-CIMYGVE 96
                 S  +                              G I+ G+N +     + GV+
Sbjct: 50  QIGNFSSKVDLNYLRDLRDQEVGKWASVKKELLPKPSGFVGGIYGGFNFDFGKGFVIGVD 109

Query: 97  GDVRYTVPVLADNIH 111
            DV ++    + N +
Sbjct: 110 TDVIWSNKKESKNFN 124


>gi|75677026|ref|YP_319447.1| outer membrane autotransporter barrel [Nitrobacter winogradskyi
           Nb-255]
 gi|74421896|gb|ABA06095.1| outer membrane autotransporter barrel [Nitrobacter winogradskyi
           Nb-255]
          Length = 652

 Score = 72.9 bits (177), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 37/236 (15%), Positives = 58/236 (24%), Gaps = 49/236 (20%)

Query: 18  FCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSFGEEAHHNAG 77
           F   Q A     A     GV P   T  Y+             S    G+          
Sbjct: 408 FSPDQVAGAPLFAKAPAMGVAPYNWTGFYIGASTGVLNGRTDWSFPGFGTGANPRFAGFA 467

Query: 78  GSIFAGYNVEDSCIMYGVEGDVRYTVPVLAD--------NIHSLHGIGGSLRIRGGYEVS 129
           G    GY+ +    + G+EG    +    A            +     G+   + GY + 
Sbjct: 468 GGGQIGYDWQTGPWVVGIEGAFNASNANGARSCPNALFYTCRNEIDWLGTATAKLGYALW 527

Query: 130 DSLLLYATVGPDVAQKYETGK-----------------------AGEITPIAIGGTAGVG 166
              L+Y   G                                      +  A+G T G G
Sbjct: 528 SRSLVYLRGGAAFGNTRIVSTCNTGPNGQYIDYSIPALITQPGCGASSSRTAVGWTIGYG 587

Query: 167 VEVGGLSESLVARLEYRASKYSK---------------VEGFYNTI--SLGVGMKF 205
            E   LS +   R E                       V+   +    ++G+  +F
Sbjct: 588 AEF-ALSRNWTVRAESNYFDLGTERHSLAQGGGIPPIQVDVRNHGFISTVGLNYRF 642


>gi|260426559|ref|ZP_05780538.1| conserved hypothetical protein [Citreicella sp. SE45]
 gi|260421051|gb|EEX14302.1| conserved hypothetical protein [Citreicella sp. SE45]
          Length = 199

 Score = 72.9 bits (177), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 37/204 (18%), Positives = 67/204 (32%), Gaps = 18/204 (8%)

Query: 11  SSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNG---- 66
           S + L    +   A  +         V P        P+  D+ GP  G    Y      
Sbjct: 5   SLILLPFLATPALAGSLEPTPVEPAPVAPLAP--VASPVTGDWTGPSVGAQLGYGSVDTD 62

Query: 67  SFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGSLRIRGGY 126
             G+++       + A Y+ +    + G       T   L D           +  R GY
Sbjct: 63  GAGDDSEDGMVYGLRAFYDHDFGNWVAGAGVQYDATDIDLGD--AGDLDGIARVGGRVGY 120

Query: 127 EVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASK 186
           ++    ++Y T G   A    T         + G   G GVE   +S+++    E   ++
Sbjct: 121 DLG-RTMVYGTGGYAHA---TTDGGSLDAGSSGGYYVGAGVET-FVSDNVTLNGEVNYNE 175

Query: 187 YSKVE-----GFYNTISLGVGMKF 205
           +S  +         T ++G+  +F
Sbjct: 176 FSDFDDDDLEVGATTATVGINYRF 199


>gi|7188822|gb|AAF37889.1|AF234271_1 outer membrane protein A [Shigella flexneri]
          Length = 246

 Score = 72.9 bits (177), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 37/216 (17%), Positives = 70/216 (32%), Gaps = 32/216 (14%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K  +A+ V+         AQAA                     Y   +  ++  +   
Sbjct: 1   MKKTAIAIAVALA--GFATVAQAA---------------PKDNTWYTGAKLGWSQYHDT- 42

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGSL 120
              +  + G    +  G   F GY V            +        +   +    G  L
Sbjct: 43  --GFIPNNGPTHENQLGAGAFGGYQVNPYVGFEMGYDWLGRMPYKGDNINGAYKAQGVQL 100

Query: 121 RIRGGYEVSDSLLLYATVGPDVAQKYET-----GKAGEITPIAIGGTAGVGVEVGGLSES 175
             + GY ++D L +Y  +G  V +         G + +     +      GVE   ++  
Sbjct: 101 TAKLGYPITDDLDIYTRLGGMVWRADTKANVPGGASFKDHDTGVSPVFAGGVEY-AITPE 159

Query: 176 LVARLEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
           +  RLEY+ +      + +    +   +SLGV  +F
Sbjct: 160 IATRLEYQWTNNIGDANTIGTRPDNGLLSLGVSYRF 195


>gi|27380621|ref|NP_772150.1| outer-membrane immunogenic protein [Bradyrhizobium japonicum USDA
           110]
 gi|27353786|dbj|BAC50775.1| outer-membrane immunogenic protein precursor [Bradyrhizobium
           japonicum USDA 110]
          Length = 237

 Score = 72.9 bits (177), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 32/204 (15%), Positives = 56/204 (27%), Gaps = 34/204 (16%)

Query: 34  GRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSFGEEAHHN---AGGSIFAGYNVED-S 89
                          + +++ G Y G       +       +     G +  G++ +   
Sbjct: 26  QPRAYTKAPAYTPPQVIYNWTGFYIGGHVGGAFAGDSSFQSSDARFLGGVQGGFDYQFAP 85

Query: 90  CIMYGVEGDVRY-------TVPVLADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDV 142
             + GVE    +           L   + S     GS+  R GY      L+YA  G   
Sbjct: 86  NWVVGVEAQYSWLPTNNNGVTFPLGTQVTSNTDQLGSVTGRIGYTWGP-ALVYAKGGYAW 144

Query: 143 AQKYETGK-------AGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEG--- 192
                                   G T G G+E    + S  A+ EY+   +        
Sbjct: 145 RNGGLGVNVAGVPQGFTATGNNKDGYTVGAGLEY-MFAPSWSAKAEYQYYNFGSTTFTSG 203

Query: 193 -----------FYNTISLGVGMKF 205
                        +T+ +GV  +F
Sbjct: 204 PADIVGVRGREDEHTVKVGVNYRF 227


>gi|85713860|ref|ZP_01044849.1| possible outer membrane protein [Nitrobacter sp. Nb-311A]
 gi|85698986|gb|EAQ36854.1| possible outer membrane protein [Nitrobacter sp. Nb-311A]
          Length = 224

 Score = 72.9 bits (177), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 45/219 (20%), Positives = 77/219 (35%), Gaps = 22/219 (10%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K+ LA  V+ + LA+   AQAAD   R +       P      +       +   A  
Sbjct: 1   MKKILLA-SVAIVGLAAIAPAQAADLAARPYTKAPPYAPPAPIYNWTGFYLGGHIGGAFG 59

Query: 61  SALYNGSFG---EEAHHNAGGSIFAGYNVED-SCIMYGVEGDVRYTVPVLADNIHSLHGI 116
            A    + G           G +  GY+ +     ++G+E +  +            +  
Sbjct: 60  GANNIFAPGVAFNNNDGVFMGGVQVGYDTQFSPNWVFGLEANYSFLD----TGSFFANRG 115

Query: 117 GGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESL 176
            GS+  R GY    +LL Y   G   A    T   G       G T G G+E    +++ 
Sbjct: 116 LGSVTGRLGYTWGPALL-YVKGGYGWADSRFTNGFGGN-GGRDGYTVGGGLEY-LFTQNW 172

Query: 177 VARLEYRASKYSKV----------EGFYNTISLGVGMKF 205
             ++EY+      V              +T+ +G+  +F
Sbjct: 173 SGKVEYQYYDLGTVNLVAPVVANFRNDQHTVKVGLNYRF 211


>gi|192289353|ref|YP_001989958.1| porin [Rhodopseudomonas palustris TIE-1]
 gi|192283102|gb|ACE99482.1| porin [Rhodopseudomonas palustris TIE-1]
          Length = 243

 Score = 72.9 bits (177), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 33/208 (15%), Positives = 56/208 (26%), Gaps = 42/208 (20%)

Query: 38  VPTIATNRYVPIRHDFNGPYAGLSALYNGSFGEEAHHNAG--------GSIFAGYNVED- 88
             T A        +++ G Y G       S                  G + AGY+ +  
Sbjct: 28  PYTKAPAYAPAPVYNWTGFYIGGHIGGAFSGDNSIGTGVTASDNGKFLGGVQAGYDWQFA 87

Query: 89  SCIMYGVEGDVRY--------------TVPVLADNIHSLHGIGGSLRIRGGYEVSDSLLL 134
              + GVEG   +                               S+  R GY    +LL 
Sbjct: 88  PNWVLGVEGQYSWLSGTNQSVAFGGTLNGAPGVFTYADNQRGLASVTGRLGYTWGPALL- 146

Query: 135 YATVGPDVAQKYETGKAGEI---------TPIAIGGTAGVGVEVGGLSESLVARLEYRAS 185
           Y   G   A    +                    G T G G+E    + +   ++EY+  
Sbjct: 147 YVKGGWAYADYSSSLTFVPNAGGFAAVAIDSKKDGYTVGGGLEY-LFAPNWSGKIEYQYY 205

Query: 186 KYSKVE--------GFYNTISLGVGMKF 205
            +  V+           + +  G+  +F
Sbjct: 206 DFGNVDLGNGFSAKNDEHVVKAGLNYRF 233


>gi|160873823|ref|YP_001553139.1| OmpA/MotB domain-containing protein [Shewanella baltica OS195]
 gi|160859345|gb|ABX47879.1| OmpA/MotB domain protein [Shewanella baltica OS195]
          Length = 369

 Score = 72.5 bits (176), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 36/203 (17%), Positives = 57/203 (28%), Gaps = 11/203 (5%)

Query: 12  SLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSFGEE 71
            L+L  +    AA+    A         T+ T     +                    + 
Sbjct: 22  LLSLLCYGVTHAAEQQNPAQLIDEDKPQTLITLPEAYLYMGSEIGINHYQHGCESWSIDC 81

Query: 72  AHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGSLRI-----RGGY 126
             ++   S FAGY             D+        +         GS+R          
Sbjct: 82  DKNSTMASFFAGYQFNHHLAFEVAYIDLGKAEATYLEASKQNI-YQGSMRGLNLSSVASI 140

Query: 127 EVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRA-S 185
           +    L L+A  G         G    I       + GVG+    LS+S  ARL+Y    
Sbjct: 141 DFGADLALFAKAGVFNWHGENKGPFSTIKADDWSPSFGVGMTY-QLSDSWQARLQYEYFH 199

Query: 186 KYSKVEGF---YNTISLGVGMKF 205
                +      +  SLG+  +F
Sbjct: 200 HLGNDDIGGTNAHATSLGISYQF 222


>gi|316932990|ref|YP_004107972.1| carbohydrate-selective porin OprB [Rhodopseudomonas palustris DX-1]
 gi|315600704|gb|ADU43239.1| Carbohydrate-selective porin OprB [Rhodopseudomonas palustris DX-1]
          Length = 696

 Score = 72.5 bits (176), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 44/229 (19%), Positives = 74/229 (32%), Gaps = 46/229 (20%)

Query: 18  FCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSFGEEA----- 72
              A AAD VR A    R V     +  Y+         ++  S+   G  G        
Sbjct: 43  TAPAAAADLVRTAPLAPRAV--FDWSGFYIGAHFSAVAGHSNWSSAPAGGSGSIDLFDAF 100

Query: 73  -----HHNAGGSIFAGYNVEDS-CIMYGVEGDVRYTVPVLADNIHS-----------LHG 115
                  +    + AGYN       + GVE D+     +  +  ++              
Sbjct: 101 QLFKGTGSYVVGLQAGYNWMLPSRWLIGVEADLNSPNTLGGNTGNTLPSGTVGGHDHQAL 160

Query: 116 IGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITP-------IAIGGTAGVGVE 168
           +GG++R R GY +    L Y T G   +                      +G +AG G++
Sbjct: 161 LGGTVRGRLGYALGG-WLPYVTAGFAWSYDRLRWPPDPALAQQETALLWRLGWSAGAGID 219

Query: 169 VGGLSESLVARLEYRASKYSK-------------VEGFYNTISLGVGMK 204
              LS +  AR EY A+ +                +   + + LG+  +
Sbjct: 220 -LPLSPAWSARAEYLATGFGNGTVSFPIAGERVTSDVLTHAVRLGLNYR 267


>gi|14331084|emb|CAC40971.1| hypothetical protein [Vibrio pommerensis]
          Length = 378

 Score = 72.5 bits (176), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 37/223 (16%), Positives = 72/223 (32%), Gaps = 40/223 (17%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K  LA+ V  +       A A++ V   + GG+  +                      
Sbjct: 7   MKKQTLALWVGLVLAGQASMALASNQVGEFYVGGKAGLTQF-----------------SD 49

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLAD--NIHSLHGIGG 118
               N    EE        ++ GY   D   +      +  +    +       +     
Sbjct: 50  ECGANSLDCEEQSEGF--GVYGGYQALDWLAVEVGYDSLGKSKADYSALMKPGEVAHYDA 107

Query: 119 SLRI-----RGGYEVSDSLLLYATVGPDVAQKYETGKAG-----EITPIAIGGTAGVGVE 168
           +++      +  Y +++   L+A  G  + Q  ++G                   G GVE
Sbjct: 108 TVQGIELGLKADYALTERAGLFAKAGTLLWQVEKSGSEPGLGSVNQEEDGSSLMLGAGVE 167

Query: 169 VGGLSESLVARLEYRASKYSKVEG------FYNTISLGVGMKF 205
              L+E    RLEY+   +++V G        + I +G+  +F
Sbjct: 168 Y-RLTEHWNTRLEYQY--FNEVGGEKTGGSDIHFIGVGLDYRF 207


>gi|317491503|ref|ZP_07949939.1| OmpA transmembrane domain-containing protein [Enterobacteriaceae
           bacterium 9_2_54FAA]
 gi|316921050|gb|EFV42373.1| OmpA transmembrane domain-containing protein [Enterobacteriaceae
           bacterium 9_2_54FAA]
          Length = 351

 Score = 72.5 bits (176), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 41/219 (18%), Positives = 69/219 (31%), Gaps = 37/219 (16%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K   A+ ++         AQAA                     YV  +  ++  Y   
Sbjct: 1   MKKT--AIALAVALAGFATVAQAA---------------PKDDTWYVGGKLGWSHYYDNS 43

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTV--PVLADNIHSLHGIGG 118
               +           GG  F GY    +    G E    +        DN  +    G 
Sbjct: 44  IN--HFGSTNVRPDQFGGGAFFGYQ---ANPYLGFEMGYDWLGRMEYRGDNNGAFKSQGV 98

Query: 119 SLRIRGGYEVSDSLLLYATVGPDVAQKY------ETGKAGEITPIAIGGTAGVGVEVGGL 172
            L  +  Y ++D L +Y  +G  V +          G+  +     +   A +GVE   L
Sbjct: 99  QLAAKLSYPIADDLDIYTRLGGMVWRADGSANSATKGRYIDSNDTGVSPLAAIGVEY-AL 157

Query: 173 SESLVARLEYRA-SKYSKVEG-----FYNTISLGVGMKF 205
           ++    RL+Y+  S                +S+GV  +F
Sbjct: 158 NKDWATRLDYQFVSNIGDANETAARPDNTLLSVGVTYRF 196


>gi|315266048|gb|ADT92901.1| OmpA/MotB domain protein [Shewanella baltica OS678]
          Length = 365

 Score = 72.5 bits (176), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 36/203 (17%), Positives = 57/203 (28%), Gaps = 11/203 (5%)

Query: 12  SLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSFGEE 71
            L+L  +    AA+    A         T+ T     +                    + 
Sbjct: 18  LLSLLCYGVTHAAEQQNPAQLIDEDKPQTLITLPEAYLYMGSEIGINHYQHGCESWSIDC 77

Query: 72  AHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGSLRI-----RGGY 126
             ++   S FAGY             D+        +         GS+R          
Sbjct: 78  DKNSTMASFFAGYQFNHHLAFEVAYIDLGKAEATYLEASKQNI-YQGSMRGLNLSSVASI 136

Query: 127 EVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRA-S 185
           +    L L+A  G         G    I       + GVG+    LS+S  ARL+Y    
Sbjct: 137 DFGADLALFAKAGVFNWHGENKGPFSTIKADDWSPSFGVGMTY-QLSDSWQARLQYEYFH 195

Query: 186 KYSKVEGF---YNTISLGVGMKF 205
                +      +  SLG+  +F
Sbjct: 196 HLGNDDIGGTNAHATSLGISYQF 218


>gi|146338464|ref|YP_001203512.1| hypothetical protein BRADO1381 [Bradyrhizobium sp. ORS278]
 gi|146191270|emb|CAL75275.1| hypothetical protein BRADO1381 [Bradyrhizobium sp. ORS278]
          Length = 549

 Score = 72.1 bits (175), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 23/167 (13%), Positives = 48/167 (28%), Gaps = 32/167 (19%)

Query: 70  EEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLAD------NIHSLHGIGGSLRIR 123
                +  G +  G + +    + G++         ++        +++      +  +R
Sbjct: 376 SSNGSDVVGGLQLGCDYQLDRFVVGIQAMADLGNINVSGPLAPGLTLNTRTSNLYTATVR 435

Query: 124 GGYEVSDSLLLYATVGPDVAQKYETGKAGEITPI------AIGGTAGVGVEVGGLSESLV 177
            GY V+  +L Y   G    +                     G T G GVE    + +  
Sbjct: 436 AGYLVTPEILAYVRGGAAWTRTTVGVANTATGQSASVAFNRSGWTVGAGVE-WMFARNWS 494

Query: 178 ARLEYRASKYSKV-------------------EGFYNTISLGVGMKF 205
           A  EY  + +                      +   +T  +GV  +F
Sbjct: 495 AFAEYDYADFGTATGVLPGAAAITGGPNVVSQKTQLHTAMIGVNYRF 541


>gi|15420176|gb|AAK97310.1|AF308168_1 Pap31 [Bartonella henselae phage 60457]
          Length = 245

 Score = 72.1 bits (175), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 45/255 (17%), Positives = 75/255 (29%), Gaps = 86/255 (33%)

Query: 7   AVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNG 66
            +  S +AL S  +AQAAD +         +               + G Y G       
Sbjct: 1   LMTTSVIALISASAAQAADVIVPHEVAPTVISAPA---------FSWTGFYIGGQVGNFS 51

Query: 67  SFGEEAH----------------HNAGGSIFAGYNVEDSC-IMYGVEGDVRYTV------ 103
           S  E                       G I+AG N++    ++ GVE D  +        
Sbjct: 52  SKVEITDPNKKDKLFSKDDTPKPSGFMGGIYAGSNMDLGNNMILGVETDAVWADREDAKT 111

Query: 104 -------------------------------------PVLADNIHSLHGIGGSLRIRGGY 126
                                                    D++       G+ R+R G+
Sbjct: 112 SSAEAIGQDELETFRDSLKKANAAFAQGKTSDNVAAVDKHTDSLALKEKWSGATRVRIGF 171

Query: 127 EVSDSLLLYATVGPDVAQKY----------------ETGKAGEITPIAIGGTAGVGVEVG 170
             +D ++ Y   G   AQ                   T +  + T   +G T G GV+  
Sbjct: 172 TAADRIMPYVAGGVSYAQVQAVSSTKVTQAADDAEIATAQLFDKTKTLVGFTLGGGVDF- 230

Query: 171 GLSESLVARLEYRAS 185
            ++++++ R EYR S
Sbjct: 231 AMTDNVLLRAEYRYS 245


>gi|85714944|ref|ZP_01045929.1| outer membrane autotransporter barrel protein [Nitrobacter sp.
           Nb-311A]
 gi|85698141|gb|EAQ36013.1| outer membrane autotransporter barrel protein [Nitrobacter sp.
           Nb-311A]
          Length = 654

 Score = 72.1 bits (175), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 30/202 (14%), Positives = 49/202 (24%), Gaps = 32/202 (15%)

Query: 24  ADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSFGEEAHHNAGGSIFAG 83
           A    +A        P   T  Y+             S    G+     +    G    G
Sbjct: 416 APMFTKAVKAPVMAGPYNWTGLYIGASAGVLNGRNDWSFPGLGTRTNPRYAGFAGGGQIG 475

Query: 84  YNVEDSCIMYGVEGDVRYTVPVLAD--------NIHSLHGIGGSLRIRGGYEVSDSLLLY 135
           Y+ +    + G+EG +  +    A            +     G+   + GY + +  L+Y
Sbjct: 476 YDWQIGTWVVGLEGSLMGSNARGARSCPNALFYTCENEMNWLGTATAKLGYTIWNRSLVY 535

Query: 136 ATVGPDVAQKYETGK-----------------------AGEITPIAIGGTAGVGVEVGGL 172
              G                                      +  A G T G+G E   L
Sbjct: 536 LRGGAAFGNTRIVTNCNTGPDRGYIDYSIPAVIAQPGCGANSSKTAAGWTVGLGTEF-AL 594

Query: 173 SESLVARLEYRASKYSKVEGFY 194
           + S   R E             
Sbjct: 595 TRSWTVRAESNYFDLGTERYSL 616


>gi|116254616|ref|YP_770452.1| putative outer-membrane immunogenic protein precursor [Rhizobium
           leguminosarum bv. viciae 3841]
 gi|115259264|emb|CAK10397.1| putative outer-membrane immunogenic protein precursor [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 226

 Score = 72.1 bits (175), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 44/225 (19%), Positives = 68/225 (30%), Gaps = 34/225 (15%)

Query: 2   QKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLS 61
           ++   +VGVS L     C A AAD    +                 P    + G YAGL 
Sbjct: 15  KRKIFSVGVSML---MACGASAADLADHSVPSAPSYD--------APGTFSWAGAYAGLH 63

Query: 62  ALYNGSFGEEAHHN--AGGSIFAGYNVEDSCIMYGVEGDVRY-TVPVLADNIHSLHGIGG 118
                S     ++          GYN +    ++G E +  Y    V     +      G
Sbjct: 64  GGVAASKFNPFNNGRAPAVGAQVGYNFQAGSGVFGAELEGSYLNNEVRVPVGNVESRFRG 123

Query: 119 SLRIRGGYEVSDSLLLYATVGPDVAQKY-------ETGKAGEITPIAIGGTAGVGVEVGG 171
           + + + G    D   +Y T G    +                      G   G GVE   
Sbjct: 124 AAKAKAGLGF-DRTFVYGTAGVTTTEFEGHRLVSGSDKWKSGPDSWKHGYLFGGGVE-HA 181

Query: 172 LSESLVARLEYRAS-----------KYSKVEGFYNTISLGVGMKF 205
            S  + A++EY                S+ +   N I  G+  +F
Sbjct: 182 FSGGVSAKIEYNYVINNAVPTTSGGISSRSDLNDNVIEAGLNFRF 226


>gi|256809537|gb|ACV30869.1| 25 kDa outer membrane protein [Ochrobactrum anthropi]
          Length = 130

 Score = 72.1 bits (175), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 34/139 (24%), Positives = 55/139 (39%), Gaps = 16/139 (11%)

Query: 8   VGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGS 67
           V   +  L    +A AAD ++          P +        ++ + G Y GL   Y  +
Sbjct: 1   VIALAALLPFSATAFAADAIQEQ--------PPVPAPVEKAPQYSWAGGYTGLYLGYGWN 52

Query: 68  FGEEAHHNAG------GSIFAGYNVEDSCIMYGVEGDVRYTVPVLA-DNIHSLHGIGGSL 120
             +                +AG+N +    +YGVEGD  Y+      D +    G  GSL
Sbjct: 53  KAKTDTVGTVKPDDMKAGAYAGWNFQQDQFVYGVEGDAGYSWAKKTKDGLEVKQGFEGSL 112

Query: 121 RIRGGYEVSDSLLLYATVG 139
           R R GY+++  ++ Y T G
Sbjct: 113 RARLGYDLNP-VMPYITAG 130


>gi|86749319|ref|YP_485815.1| putative outer membrane protein [Rhodopseudomonas palustris HaA2]
 gi|86572347|gb|ABD06904.1| putative outer membrane protein [Rhodopseudomonas palustris HaA2]
          Length = 237

 Score = 72.1 bits (175), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 39/238 (16%), Positives = 68/238 (28%), Gaps = 44/238 (18%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K  L+   +    A    A AAD   R  +                + +++ G Y G 
Sbjct: 1   MKKFLLS---AVALGALGAPAFAADLGPRPAYTKAPPATAPT------VVYNWTGFYIGG 51

Query: 61  SALYNGSFGEE---AHHNAGGSIFAGYNVED-SCIMYGVEGDVRYTVPVLA-------DN 109
           +     +             G +  G++ +     + G+E    +               
Sbjct: 52  NVGGAFAGSNNLQSDSGRFMGGVQGGFDYQFAPNWVVGLEAQYSWMASNNTGVIFPAGST 111

Query: 110 IHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKY--------ETGKAGEITPIAIGG 161
                   GS+  R GY    +LL YA  G                            G 
Sbjct: 112 ATENTRGLGSVTGRIGYTWGPALL-YAKGGYAFRDSSLGVATAGGIPAAYSTSGSRNDGY 170

Query: 162 TAGVGVEVGGLSESLVARLEYRASKYSKV--------------EGFYNTISLGVGMKF 205
           T G G+E    + S  A++EY+  K+                     +T+  G+  +F
Sbjct: 171 TVGAGLEY-MFAPSWSAKVEYQYYKFDNTAFTSGPADMVGTTFRNDDHTVKAGINYRF 227


>gi|27376315|ref|NP_767844.1| outer-membrane immunogenic protein [Bradyrhizobium japonicum USDA
           110]
 gi|27349455|dbj|BAC46469.1| outer-membrane immunogenic protein precursor [Bradyrhizobium
           japonicum USDA 110]
          Length = 241

 Score = 72.1 bits (175), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 45/241 (18%), Positives = 73/241 (30%), Gaps = 46/241 (19%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K+  A  V+ L + +   A  AD   R ++             YV   +++ G Y G 
Sbjct: 1   MKKILFA-TVALLVVGAAAPAVGADLGNRNYYKAPAPA-------YVAPIYNWTGFYLGA 52

Query: 61  SALYNGSF---------GEEAHHNAGGSIFAGYNVEDS-CIMYGVEGDVRYTVPV----- 105
                 S          G   +    G +  G + + +   + GVEG   +         
Sbjct: 53  HVGGAFSSDNNFNGLSTGNNGNGRFLGGVQVGADWQFNPNFVVGVEGQYSWLSGSVGAVF 112

Query: 106 -LADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAG-------EITPI 157
                  +     GS+  R GY     LL Y   G   +   E    G            
Sbjct: 113 PGGVAYTNDQRGLGSITGRVGYTWGPGLL-YVKGGYAYSDNNEKVTVGGVPTGFIIDGDH 171

Query: 158 AIGGTAGVGVEVGGLSESLVARLEYRASKYSKV-------------EGFYNTISLGVGMK 204
             G T G G+E    + +  A+ EY+   +                    +T   GV  +
Sbjct: 172 RNGYTVGAGLEY-MFAPNWSAKAEYQYYNFGDAHFTAGPLAGTGNFTTDDHTFKAGVNYR 230

Query: 205 F 205
           F
Sbjct: 231 F 231


>gi|163736518|ref|ZP_02143937.1| hypothetical protein RGBS107_15341 [Phaeobacter gallaeciensis
           BS107]
 gi|161390388|gb|EDQ14738.1| hypothetical protein RGBS107_15341 [Phaeobacter gallaeciensis
           BS107]
          Length = 194

 Score = 72.1 bits (175), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 35/206 (16%), Positives = 61/206 (29%), Gaps = 22/206 (10%)

Query: 7   AVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNG 66
            V ++++A A    A A +             PT           D+ G Y G       
Sbjct: 4   IVSMAAIAAALSTPAFAGNLEEPVVAPA----PTAPPVVVANDGGDWTGAYIGGQIGQLD 59

Query: 67  SFGEE--AHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGSLRIRG 124
           +      +  +    + AGYN +    + G E D   T   L     +        +++ 
Sbjct: 60  ADTSNGLSGDDVSYGVHAGYNYDFGRFVLGGEIDYDATDVDLGGGA-ATVDSVMRGKVKA 118

Query: 125 GYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRA 184
           GY+    +L Y T G                    G   G+GV    +++      E   
Sbjct: 119 GYDFGP-VLAYVTGGVAQVDTSV--------GDETGEFYGIGVAY-RVTDQWTVGGEVLE 168

Query: 185 SKYSK-----VEGFYNTISLGVGMKF 205
             +       +     T+SL    +F
Sbjct: 169 HDFDNLGSSGISADATTVSLRASYQF 194


>gi|158425350|ref|YP_001526642.1| outer membrane protein Omp31 precursor [Azorhizobium caulinodans
           ORS 571]
 gi|158332239|dbj|BAF89724.1| outer membrane protein Omp31 precursor [Azorhizobium caulinodans
           ORS 571]
          Length = 233

 Score = 71.7 bits (174), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 39/214 (18%), Positives = 63/214 (29%), Gaps = 35/214 (16%)

Query: 25  DPVRRAHHGGRGVVPTIATNRYVPIRHDFNGP----YAGLSALYNGSFGEEAHHNAGGSI 80
           D   R       V      +          G     Y                       
Sbjct: 22  DLSTRYPVKAPVVAVVPVFSWTGFYIGANAGFGGDKYNYDFGAPGFGSATANSSGFFAGG 81

Query: 81  FAGYNVED-SCIMYGVEGDVRYTVPVLA---------DNIHSLHGIGGSLRIRGGYEVSD 130
             GYN +  + ++ G+E D++++               N++S     G++R R GY   D
Sbjct: 82  QLGYNYQFANNVVLGLETDIQWSGIEGDTTLASGGSVANLNSSLDYFGTVRARVGYAF-D 140

Query: 131 SLLLYATVGPDVAQKY--------ETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEY 182
             L Y T G    +           T   GE +    G T G GVE    + +   + EY
Sbjct: 141 RFLPYITGGFAYGESKTSITTITPTTLTFGEGSGTKTGWTLGGGVEY-AFTNNWTFKTEY 199

Query: 183 RASKYSK-----------VEGFYNTISLGVGMKF 205
                             V+  ++T+  G+  KF
Sbjct: 200 LYVDLDDSNYGVGAGAVNVDNKFHTVKAGINYKF 233


>gi|323139011|ref|ZP_08074071.1| porin [Methylocystis sp. ATCC 49242]
 gi|322395765|gb|EFX98306.1| porin [Methylocystis sp. ATCC 49242]
          Length = 291

 Score = 71.7 bits (174), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 42/254 (16%), Positives = 69/254 (27%), Gaps = 61/254 (24%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGV------VPTIATNRYVPIRHDFN 54
           M+K+  +V V +L   +  SA AAD   R                              +
Sbjct: 1   MRKIAFSVAVLAL---TAGSALAADLPSRKEAPVYVPPPPPPMWVGFYVGLNAGGTWAAS 57

Query: 55  GPYAGLSALYNGSFGE----------------EAHHNAGGSIFAGYNVED-SCIMYGVEG 97
              A  +                           +    G    GYN +  +  + GVE 
Sbjct: 58  TNSASDAWGLANGGTPIHGWVAAASAASWQNGGNNSGFIGGGQIGYNWQFMNSFIAGVEA 117

Query: 98  DVRY--------------------TVPVLADNIHSLHGIGGSLRIRGGYEVSDSLLLYAT 137
           D++                     T  V   N  S     G++R R G+  + ++L+Y T
Sbjct: 118 DIQGVAGNSPNRDIFGSSFDPISGTNIVTFGNRSSRLDYLGTVRGRLGWLFTPTMLVYGT 177

Query: 138 VGPDVAQKYETGKA--------------GEITPIAIGGTAGVGVEVGGLSESLVARLEYR 183
            G        +                        +G TAG G+E      +  A++EY 
Sbjct: 178 GGLAYGGVSTSATFVTSEIGFPFNSVASASFADTRVGWTAGGGIE-WMFMPNWSAKVEYL 236

Query: 184 ASKYSKVEGFYNTI 197
                 V      +
Sbjct: 237 YYDLGTVSATAVAV 250


>gi|117619103|ref|YP_858241.1| outer membrane protein A [Aeromonas hydrophila subsp. hydrophila
           ATCC 7966]
 gi|117560510|gb|ABK37458.1| outer membrane protein P5 [Aeromonas hydrophila subsp. hydrophila
           ATCC 7966]
          Length = 352

 Score = 71.7 bits (174), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 40/223 (17%), Positives = 69/223 (30%), Gaps = 40/223 (17%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M K  + + VS L      +AQAA                     Y   +  ++  Y   
Sbjct: 1   MNKTLITLLVSGLL---AANAQAAGQ---------------DNTWYGGAKLGWSNFYGVD 42

Query: 61  SALY---NGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLAD-------NI 110
                  + +  EE  ++ G   F GY +  +  +      +        D       + 
Sbjct: 43  HNQAIKDDYAISEEDKNDVGAGAFLGYQINQNLGVELGYDWLGKYKYTATDKLIPTDISR 102

Query: 111 HSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVG 170
             +      L ++ G  VS+SL LY  +G   A    T                +G E  
Sbjct: 103 DEIKAQLAQLTMKIGLPVSESLDLYTRLGGAYA---WTDSKQLDNDNGAAFVGALGAEY- 158

Query: 171 GLSESLVARLEYRAS--------KYSKVEGFYNTISLGVGMKF 205
             +    ARLEY+ +          +  E     +++GV  +F
Sbjct: 159 AFNRDWAARLEYQYTTPLGDKALDKTGAELDNGLLAVGVVYRF 201


>gi|119383601|ref|YP_914657.1| putative outer membrane protein [Paracoccus denitrificans PD1222]
 gi|119373368|gb|ABL68961.1| putative outer membrane protein [Paracoccus denitrificans PD1222]
          Length = 199

 Score = 71.7 bits (174), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 43/221 (19%), Positives = 72/221 (32%), Gaps = 38/221 (17%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K+  A   S +A  ++     A  V +       V  T  +        D+ G YAGL
Sbjct: 1   MKKVGYAALASLIAGGAYAGGYVAPVVEQPVVAPAPVTITPES--------DWTGFYAGL 52

Query: 61  SALYNGSFGE------EAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLH 114
                           +     G  + AGY  +    + G E D       ++ + +   
Sbjct: 53  QYGKGSGDLGNRGALADFGDYDGYGLHAGYQRDLGRFVLGGELDYN----KISPDENYDD 108

Query: 115 GIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSE 174
           G    LR+R G ++    L Y T+G          K         G T G+G +   ++E
Sbjct: 109 GDLTRLRLRAGADMG-RFLPYVTLGAA--------KISVDDFSETGLTYGLGADF-KVTE 158

Query: 175 SLVARLEYRASKYSKV----------EGFYNTISLGVGMKF 205
                 EY  S +  V          +   + + L    +F
Sbjct: 159 RFTVGAEYSRSDFKDVLEDETGISGRDLDTDLVQLRASYRF 199


>gi|323138252|ref|ZP_08073324.1| putative outer-membrane immunogenic protein precursor
           [Methylocystis sp. ATCC 49242]
 gi|322396504|gb|EFX99033.1| putative outer-membrane immunogenic protein precursor
           [Methylocystis sp. ATCC 49242]
          Length = 255

 Score = 71.4 bits (173), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 52/247 (21%), Positives = 71/247 (28%), Gaps = 46/247 (18%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGV-------VPTIATNRYVPIRH-- 51
           M+K  L     SLA+ +  SA AAD   R                        +      
Sbjct: 1   MKKTLLT--AVSLAVLAAGSAFAADLPSRKEAPVYVPPPPPPPMWTGFYAGVNIGGGWDA 58

Query: 52  DFNGPYAGLSALYNGSFGEEAHHNAGGSIFAGYNVED-SCIMYGVEGDVRYTVPVLA--- 107
                 A      NG           G    GYN +     + GVE D + T        
Sbjct: 59  GNGNGNAWNLFGANGGVTNNMSGGVVGGGQVGYNYQITPMFLVGVETDFQGTSMGSGMNN 118

Query: 108 ---------DNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIA 158
                        +     G++R R G  ++ +LL+Y T G   A     G   + +   
Sbjct: 119 NNWLWGWNGRAQGTSLDWFGTVRGRAGVTITPTLLVYGTGGFAYAGVQRNGGF-QTSATQ 177

Query: 159 IGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFY--------------------NTIS 198
            G TAG GVE      +  A+ EY  +  S                          NTI 
Sbjct: 178 TGWTAGGGVE-WMFMPNWSAKAEYLYTDVSGGGTNNWWFQNNAGLGLNSTNNHTRWNTIR 236

Query: 199 LGVGMKF 205
            GV   F
Sbjct: 237 AGVNYHF 243


>gi|119944462|ref|YP_942142.1| OmpA/MotB domain-containing protein [Psychromonas ingrahamii 37]
 gi|119863066|gb|ABM02543.1| OmpA/MotB domain protein [Psychromonas ingrahamii 37]
          Length = 331

 Score = 71.4 bits (173), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 34/155 (21%), Positives = 56/155 (36%), Gaps = 7/155 (4%)

Query: 43  TNRYVPIRHDFNGPYAGLSALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYT 102
              Y   R    G +    A    +   +  ++  G IF GYN +       VE    Y 
Sbjct: 27  NPWYTGARLG--GAHYSDFAENIWTPDNQDQNDLAGGIFLGYNYKP---WLAVETGYTYL 81

Query: 103 VPVLADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGT 162
                 N  S+   G  L  +  ++ +DSL ++A  G         G+        +  T
Sbjct: 82  GEAQFGNNRSVEQQGIDLVGKFTWQATDSLDVFAKAGGFYYFADGKGEFNTSHDRGLIPT 141

Query: 163 AGVGVEVGGLSESLVARLEYR-ASKYSKVEGFYNT 196
            G GVE    ++++ ARLEY+        +   +T
Sbjct: 142 TGAGVEY-FFNKNVSARLEYQYYHDIDLKDSGVDT 175


>gi|322515689|ref|ZP_08068662.1| OmpA protein [Actinobacillus ureae ATCC 25976]
 gi|322118234|gb|EFX90526.1| OmpA protein [Actinobacillus ureae ATCC 25976]
          Length = 383

 Score = 71.4 bits (173), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 44/247 (17%), Positives = 79/247 (31%), Gaps = 51/247 (20%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K  +A+ VS LALAS   AQAA      + G +    +   +    ++   +  Y   
Sbjct: 1   MKKTVIALAVSGLALASV--AQAAPQQNTFYAGAKVGQSSFH-HGVNQLKFGHDDRYNDE 57

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNV-EDSCIMYGVEGDVRYT----VPVLADNIHSLHG 115
           +  Y         ++    +F GY +   +      E    Y                  
Sbjct: 58  TRTYG-----INRNSVTYGVFGGYQILNQNNFGLAAELGYDYYGRVRGNKGEFRSFKHSA 112

Query: 116 IGGSLRIRGGYEVSDSLLLYATVGPDVAQKY--------ETGKAGEITPIAIGGTAGVGV 167
            G +  ++  YEV  +L +Y  VG  V +                +   +      G GV
Sbjct: 113 HGLNFALKPSYEVLPNLDVYGKVGVAVVRNDYKFYSAENTNEPTEKFHKLKASTILGAGV 172

Query: 168 EVGGLSESLVARLEYRAS----------KYSKVEG-------------------FYNTIS 198
           E   L   L AR+EY+             ++K                        ++++
Sbjct: 173 EYVIL-PELAARVEYQYLNKAGNLNKAGNFNKAGNFNKALVRSGGQDVSYQYAPDIHSVT 231

Query: 199 LGVGMKF 205
           +G+  +F
Sbjct: 232 VGLSYRF 238


>gi|21111442|gb|AAM39773.1| membrane protein [Xanthomonas campestris pv. campestris str. ATCC
           33913]
 gi|66572140|gb|AAY47550.1| membrane protein [Xanthomonas campestris pv. campestris str. 8004]
          Length = 377

 Score = 71.4 bits (173), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 40/245 (16%), Positives = 65/245 (26%), Gaps = 47/245 (19%)

Query: 1   MQKLFLA-VGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVP----------- 48
           M+   LA   +   ALA    AQ+          G  V                      
Sbjct: 99  MKTTPLASAALVLFALAPSAWAQSGPADWSGFSLGANVGGADPAGVSGGRFGFDTNLDGR 158

Query: 49  ------IRHDFNGPYAGLSALYNGSFGEEAH-----HNAGGSIFAGYNVEDSCIMYGVEG 97
                      +    G            +        A   + AGY+ +    +YGV  
Sbjct: 159 DGDQVSTATGADAFSPGFCGGAAAGRTPASGCSKDKGGAEYGVRAGYDWQVGDWVYGVVA 218

Query: 98  DVRYTVPVLADNIHSLHGIGGS----------LRIRGGYEVS--DSLLLYATVGPDVAQK 145
           +        + +  S      +          LR R GY        L Y T G    + 
Sbjct: 219 EYTRNDLRDSVSAFSTTPALYTFTRQLNRTAALRGRVGYAFGAQGDYLAYVTAGVARGEF 278

Query: 146 Y--------ETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFYNTI 197
                         G     A G  AG+G++   LS+ +   +EY  ++    +     +
Sbjct: 279 DHSFASSNTANSFTGSGGDSANGYQAGIGLQ-RRLSDHVSVGVEYLFTRLQDEDT---RV 334

Query: 198 SLGVG 202
            +G G
Sbjct: 335 RVGPG 339


>gi|253688926|ref|YP_003018116.1| OmpA domain protein transmembrane region-containing protein
           [Pectobacterium carotovorum subsp. carotovorum PC1]
 gi|251755504|gb|ACT13580.1| OmpA domain protein transmembrane region-containing protein
           [Pectobacterium carotovorum subsp. carotovorum PC1]
          Length = 366

 Score = 71.4 bits (173), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 38/229 (16%), Positives = 65/229 (28%), Gaps = 45/229 (19%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K   A+ V+    +    AQAA                     Y   +   +  +   
Sbjct: 1   MKKT--AIAVAVALASFATIAQAA---------------PKDNTWYTGGKLGVSQFHDTG 43

Query: 61  SAL--YNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTV-------PVLADNIH 111
                Y G          G   F GY    +    G E    +            A +  
Sbjct: 44  FYGNGYTGVNNNPIKSKLGAGAFVGYQ---ANPYLGFELGYDWLGRMKYAGSTSSAADSA 100

Query: 112 SLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYE---------TGKAGEITPIAIGGT 162
           S    G  L  +  Y V   L +Y  +G  V +            T          +   
Sbjct: 101 SFKAQGIQLAAKLSYPVLPDLDVYTRLGGMVWRADSHAATSVNTGTRADITNDDTGVSPL 160

Query: 163 AGVGVEVGGLSESLVARLEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
           A +GVE   + ++   R++Y+          V    +   +S+G+  +F
Sbjct: 161 AAIGVEY-AIDKNWATRVDYQWVSNIGDAGTVGARPDNMLMSVGLSYRF 208


>gi|15420170|gb|AAK97307.1|AF308165_1 Pap31 [Bartonella henselae phage 60457]
          Length = 243

 Score = 71.4 bits (173), Expect = 8e-11,   Method: Composition-based stats.
 Identities = 45/253 (17%), Positives = 74/253 (29%), Gaps = 86/253 (33%)

Query: 9   GVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSF 68
             S +AL S  +AQAAD +         +               + G Y G       S 
Sbjct: 1   TTSVIALISASAAQAADVIVPHEVAPTVISAPA---------FSWTGFYIGGQVGNFSSK 51

Query: 69  GEEAH----------------HNAGGSIFAGYNVEDSC-IMYGVEGDVRYTV-------- 103
            E                       G I+AG N++    ++ GVE D  +          
Sbjct: 52  VEITDPNKKDKLFSKDDTPKPSGFMGGIYAGSNMDLGNNMILGVETDAVWADREDAKTSS 111

Query: 104 -----------------------------------PVLADNIHSLHGIGGSLRIRGGYEV 128
                                                  D++       G+ R+R G+  
Sbjct: 112 AEAIGQDELETFRDSLKKANAAFAQGKTSDNVAAVDKHTDSLALKEKWSGATRVRIGFTA 171

Query: 129 SDSLLLYATVGPDVAQKY----------------ETGKAGEITPIAIGGTAGVGVEVGGL 172
           +D ++ Y   G   AQ                   T +  + T   +G T G GV+   +
Sbjct: 172 ADRIMPYVAGGVSYAQVQAVSSTKVTQAADDAEIATAQLFDKTKTLVGFTLGGGVDF-AM 230

Query: 173 SESLVARLEYRAS 185
           +++++ R EYR S
Sbjct: 231 TDNVLLRAEYRYS 243


>gi|239758178|gb|ACN65406.2| outer membrane protein A precursor [Edwardsiella tarda]
          Length = 351

 Score = 71.4 bits (173), Expect = 8e-11,   Method: Composition-based stats.
 Identities = 38/218 (17%), Positives = 69/218 (31%), Gaps = 36/218 (16%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K   A+ +S         AQAA                     YV  +  ++   +  
Sbjct: 1   MKKT--AIALSVALAGFATVAQAA---------------PKDNTWYVGGKLGWSHFISNS 43

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVL-ADNIHSLHGIGG- 118
               +    +   +  G   F GY    +    G E    +   +    ++++     G 
Sbjct: 44  FE--DMGTTKSHPNQLGAGAFFGYQ---ANPYLGFEMGYDWLGRMGYTGDVNAKFKSQGV 98

Query: 119 SLRIRGGYEVSDSLLLYATVGPDVAQKY-----ETGKAGEITPIAIGGTAGVGVEVGGLS 173
            L  +  Y + D L +Y  +G  V +       + G         +   A +GVE   L+
Sbjct: 99  QLAAKLSYPLMDDLDVYTRLGGMVWRSDIHGAADGGDYTSSHDTGVSPLAAIGVEY-ALN 157

Query: 174 ESLVARLEYRASKYSKVEG------FYNTISLGVGMKF 205
           +    RL+Y+                   +SLGV  +F
Sbjct: 158 KDWATRLDYQYVNKVGTRSETGARPDNTMLSLGVVYRF 195


>gi|27380105|ref|NP_771634.1| hypothetical protein blr4994 [Bradyrhizobium japonicum USDA 110]
 gi|27353259|dbj|BAC50259.1| blr4994 [Bradyrhizobium japonicum USDA 110]
          Length = 296

 Score = 71.4 bits (173), Expect = 8e-11,   Method: Composition-based stats.
 Identities = 34/205 (16%), Positives = 55/205 (26%), Gaps = 43/205 (20%)

Query: 38  VPTIATNRYVPIRHDFNGPYAGLSALYNG----------------SFGEEAHHNAGGSIF 81
             T A    V   +D++G Y G++                       G            
Sbjct: 64  PYTKAPAPMVAAIYDWSGFYIGINGGGGSAHSCWDFVTPVTGTLVGEGCHNATGGTIGGQ 123

Query: 82  AGYNVEDSCIMYGVEGDVRYTVPVLAD--------------NIHSLHGIGGSLRIRGGYE 127
            GY  + +  ++G+EG   +      +                 S     G +  + GY 
Sbjct: 124 VGYRWQSASWVFGLEGQGNWADFSGDNISLLFPGSALVTGDRNRSRIDSFGLITGQVGYA 183

Query: 128 VSDSLLLYATVGPDVAQKYETGKAGEIT-----------PIAIGGTAGVGVEVGGLSESL 176
            + S+LLY   G  V        A   T               G T G G+E G  + + 
Sbjct: 184 WN-SVLLYVKGGAAVVGDKFDIYAAPGTPGAGTLLASGRDTRWGATVGAGLEFGF-APNW 241

Query: 177 VARLEYRASKYSKVEGFYNTISLGV 201
              +EY                 G+
Sbjct: 242 SVGVEYDHIFLGHQTRDLTVPGTGL 266


>gi|319409089|emb|CBI82733.1| Hemin binding protein b [Bartonella schoenbuchensis R1]
          Length = 367

 Score = 71.0 bits (172), Expect = 8e-11,   Method: Composition-based stats.
 Identities = 28/120 (23%), Positives = 52/120 (43%), Gaps = 25/120 (20%)

Query: 109 NIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYE--------------TGKAGEI 154
           N        G+ R+R G+ V+D ++ Y  VG   AQ  +              +    + 
Sbjct: 250 NHTLRQKWSGATRMRIGF-VADRIMPYIAVGVTYAQLQDIFSRSVEVAGKEINSFNLSDE 308

Query: 155 TPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSK---------VEGFYNTISLGVGMKF 205
           T + +G T G G++   ++++++ R+EYR S + K         ++   N   +GV  KF
Sbjct: 309 TKMMVGYTLGGGIDF-AMADNVILRVEYRYSDFGKQKFAKDKLELDYKTNDFRVGVAYKF 367



 Score = 56.7 bits (135), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 23/136 (16%), Positives = 40/136 (29%), Gaps = 26/136 (19%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAAD---PVRRAHHGGRGVVPTIATNRYVPIRHDFNGPY 57
           M   +L V  S   L +    QAAD   P             ++ +         ++G Y
Sbjct: 1   MNTKYL-VSTSIFTLFTASMTQAADIRIPRESRPVVAPVEASSVVSPVIAAPIFSWDGFY 59

Query: 58  AGLSALYNGSFGEEA---------------------HHNAGGSIFAGYNVEDSC-IMYGV 95
            G       S  + +                          G ++AG NV      + GV
Sbjct: 60  LGGQIGGFSSKSDRSLYAKQGSSREWAPVGKDALPQLSGFMGGLYAGANVSLGNSFVLGV 119

Query: 96  EGDVRYTVPVLADNIH 111
           + D+ ++       I+
Sbjct: 120 DTDIAWSNKQDTKVIN 135


>gi|91978029|ref|YP_570688.1| carbohydrate-selective porin OprB [Rhodopseudomonas palustris
           BisB5]
 gi|91684485|gb|ABE40787.1| Carbohydrate-selective porin OprB [Rhodopseudomonas palustris
           BisB5]
          Length = 724

 Score = 71.0 bits (172), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 43/225 (19%), Positives = 69/225 (30%), Gaps = 54/225 (24%)

Query: 32  HGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSFGE--------------------- 70
               G +   A     P   D+NG Y G    Y     +                     
Sbjct: 73  PAAGGGIVVKAPAAGGPAVFDWNGFYIGGHFSYVAGRSDWTAQPAGVSGTIDLFDAFDAF 132

Query: 71  EAHHNAGGSIFAGYNVEDS-CIMYGVEGDVRYTVPVLAD-----------NIHSLHGIGG 118
           +   +    + AGYNV      + G+E D+     +  +                  + G
Sbjct: 133 KGTGSYTLGLQAGYNVLLPSRWLLGLEADLTSPNRIGGNASISPPTGTIGGHDHQTQLAG 192

Query: 119 SLRIRGGYEVSDSLLLYATVGPDV------AQKYETGKAGEITPIAIGGTAGVGVEVGGL 172
           ++R R GY + D  L YAT G                         +G  AG GVE   L
Sbjct: 193 TVRGRLGYAL-DGWLPYATAGFAWSYDRLRWPSEAAATEETALLWRLGWAAGAGVE-LPL 250

Query: 173 SESLVARLEYRASKYSK-------------VEGFYNTISLGVGMK 204
           S +  AR+EY A+ + +              +   + + LG+  +
Sbjct: 251 SPAWTARVEYLATGFGRDTARFPIAGHQIESDALIHAVRLGLNYR 295


>gi|312114480|ref|YP_004012076.1| porin [Rhodomicrobium vannielii ATCC 17100]
 gi|311219609|gb|ADP70977.1| porin [Rhodomicrobium vannielii ATCC 17100]
          Length = 288

 Score = 71.0 bits (172), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 48/275 (17%), Positives = 73/275 (26%), Gaps = 75/275 (27%)

Query: 3   KLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRH----------- 51
           K  LA  V+   LA    A AAD    +      +V       +    H           
Sbjct: 5   KFALASTVALGTLAIAAQANAADIYTPSMKDAPIIVVPPTWTGFYFGGHLGAAWTQLETR 64

Query: 52  ---DFNGPYAGLSALYNGSFGEEAHHNAGGSIFAGYNVEDS-CIMYGVEGDVRYTVPVLA 107
               ++G      +            +A G    GYN +     + G+E D+        
Sbjct: 65  KNEYWDGYDDSDLSFATFGGKNLNDQSAFGGGQFGYNWQTGGNFVLGIEVDIGGLGSDNE 124

Query: 108 D---------------------NIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKY 146
                                 N+ S  G  G +  R GY   ++LL YA  G    Q  
Sbjct: 125 RTFLATTYNDVTFSSAYSTAVVNVKSEGGFYGDVTGRLGYAWGNTLL-YAKGGFAWIQPE 183

Query: 147 ET---------------GKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYS--- 188
                              +        G T G G+E   L+ +   ++EY    +    
Sbjct: 184 LKVRTVVSIDDDPNGTYTSSHTYDDTLTGWTIGGGLEF-LLNPNWSVKVEYLHYDFELDN 242

Query: 189 -------------------KVEGFYNTISLGVGMK 204
                              K     +T+ LGV  K
Sbjct: 243 NNNRRWNDWDVDYNNWRLFKDSFTVDTVKLGVNYK 277


>gi|37525710|ref|NP_929054.1| outer membrane protein A [Photorhabdus luminescens subsp. laumondii
           TTO1]
 gi|36785139|emb|CAE14068.1| Outer membrane protein A precursor (Outer membrane protein II*)
           [Photorhabdus luminescens subsp. laumondii TTO1]
          Length = 368

 Score = 71.0 bits (172), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 27/182 (14%), Positives = 53/182 (29%), Gaps = 17/182 (9%)

Query: 40  TIATNRYVPIRHDFNGPYAGLSALYNG----SFGEEAHHNAGGSIFAGYNVEDSCIMYGV 95
                 Y   +  ++  +               G    +  G   F GY           
Sbjct: 23  PKDNTWYTGGKLGWSQYHDVNFYGNGYTSAIGNGPTHKNQLGAGAFLGYQANPYLGFEIG 82

Query: 96  EGDVRYTVPVLADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYE------TG 149
              +       + N  +    G  +  +  Y + D L +Y  +G  V +         T 
Sbjct: 83  YDWLGRMPYKGSVNNGAFKAHGFQMATKLSYPIMDDLDIYTRLGGMVWRADSKATYSATN 142

Query: 150 KAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRAS----KYSKVEGFYNT--ISLGVGM 203
              +     +   A +GVE   +++    RL+Y+          V    +   +S+GV  
Sbjct: 143 THLKNHDTGVSPLAAIGVEY-AITKDWATRLDYQWVNNIGDAGSVGARPDNGLLSVGVSY 201

Query: 204 KF 205
           +F
Sbjct: 202 RF 203


>gi|330446544|ref|ZP_08310196.1| ompA family protein [Photobacterium leiognathi subsp. mandapamensis
           svers.1.1.]
 gi|328490735|dbj|GAA04693.1| ompA family protein [Photobacterium leiognathi subsp. mandapamensis
           svers.1.1.]
          Length = 325

 Score = 70.6 bits (171), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 43/204 (21%), Positives = 67/204 (32%), Gaps = 24/204 (11%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M KL + V +   +L+S   A                  +     YV  R   +      
Sbjct: 1   MDKLLIVVPLVVTSLSSIAHA------------------STDNPWYVGARAGASFLTNMD 42

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGSL 120
            A    S  E  + N  G +FAGY V     +      +      L +   S    G  L
Sbjct: 43  DA--VTSVTEIQNTNFAGGVFAGYQVTPWFALETGYTHLG--NAKLDNGQGSYEAQGADL 98

Query: 121 RIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARL 180
             +  +  +DSL +YA  G         G     +      TAG G+E   ++++L  RL
Sbjct: 99  VTKFSFSATDSLDIYAKAGAFYYDWNAIGSGVTNSDNGWSPTAGAGLEY-FINKNLSTRL 157

Query: 181 EYRASKYSKVEGFYNTISLGVGMK 204
           EY+           +   LG+   
Sbjct: 158 EYQYYN-DVGGPDIHFAGLGLAYH 180


>gi|300722575|ref|YP_003711865.1| outer membrane protein 3a [Xenorhabdus nematophila ATCC 19061]
 gi|218157851|gb|ACK58677.1| OpnT [Xenorhabdus nematophila]
 gi|297629082|emb|CBJ89667.1| outer membrane protein 3a (II*;G;d) [Xenorhabdus nematophila ATCC
           19061]
          Length = 369

 Score = 70.6 bits (171), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 28/187 (14%), Positives = 56/187 (29%), Gaps = 22/187 (11%)

Query: 40  TIATNRYVPIRHDFNGPYAGLSALYNG----SFGEEAHHNAGGSIFAGYNVEDSCIMYGV 95
                 Y   +  ++  +               G       G   + GY           
Sbjct: 21  PKDNTWYTGGKLGWSQYHDVNFYGNGYDTRIGNGSTHKSQLGAGAYVGYQANPYLGFELG 80

Query: 96  EGDVRYTVPVLADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAG--- 152
              +       + N  +    G  L  +  Y V D+L +Y  +G  V +   +       
Sbjct: 81  YDWLGRMAYKGSINNGAFRAQGVQLTTKLSYPVMDNLDVYTRLGGMVWRTDSSATYNANA 140

Query: 153 --------EITPIAIGGTAGVGVEVGGLSESLVARLEYRAS----KYSKVEGFYNT--IS 198
                   +     +   A +GVE   L+++L  R++Y+        + V    +   +S
Sbjct: 141 ASPTQLRKKDHDTGVSPLAAIGVEY-ALAKNLATRIDYQWVNNIGDATTVGARPDNGMLS 199

Query: 199 LGVGMKF 205
           +GV  +F
Sbjct: 200 VGVSYRF 206


>gi|86751658|ref|YP_488154.1| outer membrane protein [Rhodopseudomonas palustris HaA2]
 gi|86574686|gb|ABD09243.1| outer membrane protein [Rhodopseudomonas palustris HaA2]
          Length = 238

 Score = 70.6 bits (171), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 30/199 (15%), Positives = 55/199 (27%), Gaps = 36/199 (18%)

Query: 41  IATNRYVPIRHDFNGPYAGLSALYNGSFGEEAHHNAG--------GSIFAGYNVED-SCI 91
                     +++ G Y G       +                  G +  GY+ +     
Sbjct: 32  APVYAPPAPIYNWTGFYIGGHIGGAFAGDNSIGTGVTAGSDGKFLGGVQVGYDWQFAPSW 91

Query: 92  MYGVEGDVRYT------------VPVLADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVG 139
           + GVEG   +                             S+  R GY    +LL Y   G
Sbjct: 92  VLGVEGQYSWLSGTNDAVSFTVPGVAGTYTYADNQRGLASVTGRLGYTWGPALL-YVKGG 150

Query: 140 PDVAQKYETGKAG-----EITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVE--- 191
              A    +           T    G T G G+E    +++   ++EY+   +  V+   
Sbjct: 151 WAYADYTSSLTLSGVGTVSSTSSQDGYTVGGGLEY-LFAQNWSGKIEYQYYDFGNVDLGA 209

Query: 192 -----GFYNTISLGVGMKF 205
                   + +  G+  +F
Sbjct: 210 GFTAKNDQHVVKAGLNYRF 228


>gi|163868669|ref|YP_001609878.1| hemin binding protein E [Bartonella tribocorum CIP 105476]
 gi|161018325|emb|CAK01883.1| hemin binding protein E [Bartonella tribocorum CIP 105476]
          Length = 309

 Score = 70.6 bits (171), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 28/120 (23%), Positives = 45/120 (37%), Gaps = 21/120 (17%)

Query: 105 VLADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYET-----------GKAGE 153
            L  N        G+ R+R G      ++ Y   G    Q  +             K  +
Sbjct: 192 SLTFNHTFKQKWTGATRVRLGLSAH-RVMPYIAGGIAYGQFQDVLSTVITGDESFNKTSD 250

Query: 154 ITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSK--------VEGFYNTISLGVGMKF 205
           +T   +G T G GV+   ++++LV R EYR S + K        ++   N    G+  KF
Sbjct: 251 VTKTMVGYTLGGGVDF-AMTDNLVVRAEYRYSDFGKKKFKDEIEIKYKTNDFRAGIAYKF 309



 Score = 42.1 bits (97), Expect = 0.051,   Method: Composition-based stats.
 Identities = 23/155 (14%), Positives = 37/155 (23%), Gaps = 38/155 (24%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M   F  +  S  +L S    QAAD V             + +         ++G Y G 
Sbjct: 1   MNTKF--ITASVFSLISPSILQAADVVAPEEPVH------VVSEVVTSSDFSWSGFYFGG 52

Query: 61  SALYNGSFGEEAH-----------------------------HNAGGSIFAGYNVEDS-C 90
                 S                                       G ++AG N +    
Sbjct: 53  QIGGFSSKISGTTRDVDTPLYPDEESKNKPWVPLEKQYKPELSGFVGGLYAGVNFDLGNN 112

Query: 91  IMYGVEGDVRYTVPVLADNIHSLHGIGGSLRIRGG 125
           ++ G++ D+  T                S     G
Sbjct: 113 LIVGLDTDILLTEKKDTKTFIHTEESSASGSGTEG 147


>gi|134095715|ref|YP_001100790.1| hypothetical protein HEAR2547 [Herminiimonas arsenicoxydans]
 gi|133739618|emb|CAL62669.1| Conserved hypothetical protein [Herminiimonas arsenicoxydans]
          Length = 278

 Score = 70.6 bits (171), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 35/192 (18%), Positives = 53/192 (27%), Gaps = 38/192 (19%)

Query: 43  TNRYVPIRHDFNGPYAGLSALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYT 102
                      +   A   A         +H         GYN     I  G+E D+++T
Sbjct: 57  GVPGYFAGVGGDASGAIAQASSLTGRYASSHKGGAVGAHLGYNWPSGKIFLGLESDIQFT 116

Query: 103 VPVLADNIHS--------------------LHGIGGSLRIRGGYEVSDSLLLYATVGPDV 142
                  +++                          +LR R GY V+D  LLY T G  V
Sbjct: 117 DLKDNAALNTINPVTGYPGNPMSANVRQVNTVDYLVTLRGRIGY-VNDQWLLYGTGGVAV 175

Query: 143 AQKYETGKA----------------GEITPIAIGGTAGVGVEVGGLSESLVARLEYRASK 186
            +                              +G   G G E   ++++   R+EY    
Sbjct: 176 GRVNTNINYKGSYLSAPTIVFDDLNAGSRSTRLGFVLGAGAEY-AIAKNWAVRVEYLYYD 234

Query: 187 YSKVEGFYNTIS 198
             K    YN  S
Sbjct: 235 LGKSSQSYNVTS 246


>gi|294635647|ref|ZP_06714122.1| outer membrane protein A [Edwardsiella tarda ATCC 23685]
 gi|291090994|gb|EFE23555.1| outer membrane protein A [Edwardsiella tarda ATCC 23685]
          Length = 356

 Score = 70.6 bits (171), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 37/217 (17%), Positives = 69/217 (31%), Gaps = 35/217 (16%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K   A+ ++         AQAA                     YV  +  ++  +   
Sbjct: 7   MKKT--AIALAVALAGFATVAQAA---------------PKDDTWYVGGKLGWS--HYIG 47

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSL--HGIGG 118
           ++  N    +   +  G   F GY    +    G E    +   +      +      G 
Sbjct: 48  NSFENMDSTKSHPNQLGAGAFFGYQ---ANPYLGFEMGYDWLGRMGYTGDVNGKFKAQGI 104

Query: 119 SLRIRGGYEVSDSLLLYATVGPDVAQKY----ETGKAGEITPIAIGGTAGVGVEVGGLSE 174
            L  +  Y + D+L +Y  +G  V +      +           +   A +GVE   L++
Sbjct: 105 QLAAKLSYPLMDNLDVYTRLGGMVWRADAHASDATDYVSGHDTGVSPLAAIGVEY-ALNK 163

Query: 175 SLVARLEYRASK------YSKVEGFYNTISLGVGMKF 205
               RL+Y+          +        +SLGV  +F
Sbjct: 164 DWATRLDYQYVNKIGTSSQTGARPDNTLLSLGVVYRF 200


>gi|170717767|ref|YP_001784833.1| OmpA domain-containing protein [Haemophilus somnus 2336]
 gi|168825896|gb|ACA31267.1| OmpA domain protein transmembrane region-containing protein
           [Haemophilus somnus 2336]
          Length = 342

 Score = 70.6 bits (171), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 38/225 (16%), Positives = 64/225 (28%), Gaps = 39/225 (17%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAG- 59
           M+K  +A+ ++        S QAA                 A   Y   +  +   + G 
Sbjct: 1   MKKTIIALSIA----GFVASVQAA---------------PQANTFYAGAKAGWASFHDGL 41

Query: 60  LSALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGS 119
                +        ++    IF GY + D   +                        G  
Sbjct: 42  NQFENSTEKKGTVRNSVAYGIFGGYQITDHVAVELGSEYFGQAKGRKDKKEAKHTAQGMQ 101

Query: 120 LRIRGGYEVSDSLLLYATVGPDVAQKYE-------TGKAGEITPIAIGGTAGVGVEVGGL 172
           L ++  Y V + L +Y  VG  + +              G    + +      GVE    
Sbjct: 102 LGLKASYPVLEGLDIYGRVGAALIRSNYLNVKNFENSADGVKNTLKVSPVFAAGVEYSLP 161

Query: 173 S-ESLVARLEYRASK-YSKVEGF----------YNTISLGVGMKF 205
           S   L  RLEY+  K   K                 ++LG+  +F
Sbjct: 162 SLPELALRLEYQWVKGVGKARKNDGKRFDYTPSIGAVTLGLSYRF 206


>gi|319406584|emb|CBI80226.1| Hemin binding protein C [Bartonella sp. 1-1C]
          Length = 304

 Score = 70.6 bits (171), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 50/315 (15%), Positives = 83/315 (26%), Gaps = 121/315 (38%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M  +   +  S +AL +  +AQAAD       G   VV              + G Y G 
Sbjct: 1   MNNMKCLITASVVALMTASAAQAADIKVPQEIGETIVVAPA---------FSWTGFYLGG 51

Query: 61  SALYNGSFGEEAH--------------------HNAGGSIFAGYNVEDSC-IMYGVEGDV 99
                 S    +                         G  +AG NV+    ++ GV+ DV
Sbjct: 52  QIGGFSSKTSFSSLADGDSKKWFPLDKKLSPKPSGFIGGFYAGSNVDLGNGLILGVDTDV 111

Query: 100 RYTVPVLADNIHSL---------------------------------------------- 113
            ++      N                                                  
Sbjct: 112 VFSGRKDTRNDTMTSELGKDKNNNVPTGAKDNGNPKPEKEPGKEPGKEPEKEPEKESDVK 171

Query: 114 -HGIGGSLRIR--------GGYEVSDSLLLYATVGPDVAQKYET---------------- 148
                 +L+ +         G+  +D ++ Y   G    Q  +T                
Sbjct: 172 FTKYDHTLKAKWAGATRVRIGFA-ADRIMPYVAGGVAYTQLQDTFTTLTGIQKIPVQKAD 230

Query: 149 ---------GKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSK---------V 190
                        + +   IG T   GV+   ++++++ R EYR S + K         V
Sbjct: 231 GKDEETSGKSNTVDESKTMIGYTLAAGVDF-AMTDNVLLRAEYRYSDFGKKKLHNDKFEV 289

Query: 191 EGFYNTISLGVGMKF 205
               N   +GV  KF
Sbjct: 290 NYKANDFRVGVAYKF 304


>gi|156739546|gb|ABU93433.1| Omp25 [Brucella abortus]
          Length = 109

 Score = 70.6 bits (171), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 33/109 (30%), Positives = 54/109 (49%), Gaps = 3/109 (2%)

Query: 69  GEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLA-DNIHSLHGIGGSLRIRGGYE 127
           G     +     FAG+N +   I+YGVEGD  Y+    + D +    G  GSLR R GY+
Sbjct: 2   GSIKPDDWKAGAFAGWNFQQDQIVYGVEGDAGYSWAKKSKDGLEVKQGFEGSLRARVGYD 61

Query: 128 VSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESL 176
           ++  ++ Y T G   +Q        + +   +G TAG G+E   L++++
Sbjct: 62  LNP-VMPYLTAGIAGSQIKLNNGLDDESKFRVGWTAGAGLE-AKLTDNI 108


>gi|238919302|ref|YP_002932817.1| outer membrane protein A [Edwardsiella ictaluri 93-146]
 gi|238868871|gb|ACR68582.1| outer membrane protein A [Edwardsiella ictaluri 93-146]
          Length = 353

 Score = 70.6 bits (171), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 37/218 (16%), Positives = 69/218 (31%), Gaps = 36/218 (16%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K   A+ ++         AQAA                     YV  +  ++   +  
Sbjct: 1   MKKT--AIALAVALAGFATVAQAA---------------PKDDTWYVGGKLGWSHFISNS 43

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTV-PVLADNIHSLHGIGG- 118
               +    +   +  G   F GY    +    G E    +        ++++     G 
Sbjct: 44  FE--DMGTTKSHPNQLGAGAFFGYQ---ANPYLGFEMGYDWLGRMSYTGDVNAKFKSQGV 98

Query: 119 SLRIRGGYEVSDSLLLYATVGPDVAQKYE-----TGKAGEITPIAIGGTAGVGVEVGGLS 173
            L  +  Y + D+L +Y  +G  V +         G+        +   A +GVE   L+
Sbjct: 99  QLAAKLSYPLMDNLDVYTRLGGMVWRSDIHGAANGGEYTSSHDTGVSPLAAIGVEY-ALN 157

Query: 174 ESLVARLEYRASKYSKVEG------FYNTISLGVGMKF 205
           +    RL+Y+                   +SLGV  +F
Sbjct: 158 KDWATRLDYQYVNKVGTSSETGARPDNTMLSLGVVYRF 195


>gi|145688456|gb|ABP88969.1| outer membrane protein A [Edwardsiella tarda]
          Length = 351

 Score = 70.2 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 37/218 (16%), Positives = 69/218 (31%), Gaps = 36/218 (16%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K   A+ ++         AQAA                     YV  +  ++   +  
Sbjct: 1   MKKT--AIALAVALAGFATVAQAA---------------PKDNTWYVGGKLGWSHFISNS 43

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVL-ADNIHSLHGIGG- 118
               +    +   +  G   F GY    +    G E    +   +    ++++     G 
Sbjct: 44  FE--DMGTTKPHPNQLGAGAFFGYQ---ANPYLGFEMGYDWLGRMGYTGDVNAKFKSQGV 98

Query: 119 SLRIRGGYEVSDSLLLYATVGPDVAQKY-----ETGKAGEITPIAIGGTAGVGVEVGGLS 173
            L  +  Y + D L +Y  +G  V +       + G         +   A +GVE   L+
Sbjct: 99  QLAAKLSYPLMDDLDVYTRLGGMVWRSDIHGAADGGDYTSSHDTGVSPLAAIGVEY-ALN 157

Query: 174 ESLVARLEYRASKYSKVEG------FYNTISLGVGMKF 205
           +    RL+Y+                   +SLGV  +F
Sbjct: 158 KDWATRLDYQYVNKVGTRSETGARPDNTMLSLGVVYRF 195


>gi|156739538|gb|ABU93429.1| Omp25 [Brucella abortus]
 gi|156739542|gb|ABU93431.1| Omp25 [Brucella abortus]
 gi|156739562|gb|ABU93441.1| Omp25 [Brucella melitensis]
 gi|156739574|gb|ABU93447.1| Omp25 [Brucella melitensis]
 gi|156739596|gb|ABU93458.1| Omp25 [Brucella suis]
 gi|156739600|gb|ABU93460.1| Omp25 [Brucella suis]
 gi|156739604|gb|ABU93462.1| Omp25 [Brucella suis]
 gi|156739616|gb|ABU93468.1| Omp25 [Brucella melitensis]
 gi|156739628|gb|ABU93474.1| Omp25 [Brucella abortus]
          Length = 108

 Score = 70.2 bits (170), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 33/109 (30%), Positives = 54/109 (49%), Gaps = 3/109 (2%)

Query: 69  GEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLA-DNIHSLHGIGGSLRIRGGYE 127
           G     +     FAG+N +   I+YGVEGD  Y+    + D +    G  GSLR R GY+
Sbjct: 1   GSIKPDDWKAGAFAGWNFQQDQIVYGVEGDAGYSWAKKSKDGLEVKQGFEGSLRARVGYD 60

Query: 128 VSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESL 176
           ++  ++ Y T G   +Q        + +   +G TAG G+E   L++++
Sbjct: 61  LNP-VMPYLTAGIAGSQIKLNNGLDDESKFRVGWTAGAGLE-AKLTDNI 107


>gi|154246410|ref|YP_001417368.1| porin [Xanthobacter autotrophicus Py2]
 gi|154160495|gb|ABS67711.1| porin [Xanthobacter autotrophicus Py2]
          Length = 258

 Score = 70.2 bits (170), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 40/227 (17%), Positives = 68/227 (29%), Gaps = 36/227 (15%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAG- 59
           M++L LA   +    A    A AAD   +       V P  +   +    +   G     
Sbjct: 1   MKRLLLA---TVAFAALSAPAMAADLATKYPVKAVAVAPVFSWTGFYIGANVGYGGDKFT 57

Query: 60  -------LSALYNGSFGEEAHHNAGGSIFAGYNVED-SCIMYGVEGDVRYTVPVLADNIH 111
                      Y  +               GYN +  + ++ G E D++++      +  
Sbjct: 58  FDEVESYNGYPYYATSTSLNSSGFFAGGQIGYNYQFANNVVLGAETDLQWSGIEGKADYS 117

Query: 112 S---------------LHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKA----- 151
           S                    G++R R GY   D  L Y T G    +   +G       
Sbjct: 118 SVYLYGGYPYTSSFGASVDYFGTIRARIGYAF-DRFLPYITGGAAYGKTKVSGSYYDYSV 176

Query: 152 --GEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFYNT 196
                +    G T G GVE   ++ +   + EY        +  Y +
Sbjct: 177 GGFSASGTNWGWTVGGGVEY-AITNNWTFKTEYLYVDLGSTDYTYAS 222


>gi|300021628|ref|YP_003754239.1| hypothetical protein Hden_0091 [Hyphomicrobium denitrificans ATCC
           51888]
 gi|299523449|gb|ADJ21918.1| hypothetical protein Hden_0091 [Hyphomicrobium denitrificans ATCC
           51888]
          Length = 500

 Score = 70.2 bits (170), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 31/209 (14%), Positives = 63/209 (30%), Gaps = 22/209 (10%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFN------ 54
           M+ +  ++  ++L  +   +A A  P          +     +  Y      +       
Sbjct: 1   MKLVLGSLSAAALLCSMASAAYADGPFGSLKDTAPVIEQPTWSGVYFGAGWGYGHNRSKN 60

Query: 55  -GPYAGLSALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSL 113
               +   A  + S  E A       ++          + G+ GD+  +     +     
Sbjct: 61  NYRDSSGDADSSSSRTEHADGGLVSLLYGADRQIGDRFVVGIFGDIDLSDITRGNRDEHN 120

Query: 114 ---HGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTA-GVGVEV 169
                   ++  R G+ ++   L++AT G   A     G      P + G T  G G   
Sbjct: 121 ALEIDRAWAIGARAGFLLNSRTLIFATAGYTQAHFDNDGWWDIDPPSSPGTTLRGRGSRT 180

Query: 170 G-----------GLSESLVARLEYRASKY 187
                        L+++   R E R S +
Sbjct: 181 FGGYFVGGGVETRLTDNFFLRGEVRYSDF 209


>gi|296445958|ref|ZP_06887908.1| OmpA domain protein transmembrane region-containing protein
           [Methylosinus trichosporium OB3b]
 gi|296256476|gb|EFH03553.1| OmpA domain protein transmembrane region-containing protein
           [Methylosinus trichosporium OB3b]
          Length = 275

 Score = 70.2 bits (170), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 41/248 (16%), Positives = 61/248 (24%), Gaps = 62/248 (25%)

Query: 19  CSAQAADPVRRAHHG------GRGVVPTIATNRYVPIRHDFNG-------PYAGLSALYN 65
            SA AAD   +             +              D  G                 
Sbjct: 16  GSALAADLPSKKMAPMLPPPPPPPLWSGFYVGLNAGYTWDERGNVLVNSPANIWAVGASG 75

Query: 66  GSFGEEAHHNAGGSIFAGYNVEDSC-IMYGVEGDVRYTVPVLAD--------------NI 110
                 ++    G    GYN +     + GVE D++      +                 
Sbjct: 76  SGALATSNDGFIGGGQIGYNYQFGQTFVVGVEADIQGVGGSNSSATVGNFVTPVSSAITA 135

Query: 111 HSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGE-------------ITPI 157
                  G++R R GY +S +LLLY T G    Q        +              +  
Sbjct: 136 SKQLDYLGTVRGRAGYLISPTLLLYGTGGVAYGQANLNATVTQTGLNGATGSATVGFSDT 195

Query: 158 AIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFY--------------------NTI 197
            +G TAG GVE         A+ EY      +                         + +
Sbjct: 196 RVGWTAGGGVE-WLFMPQWSAKAEYLYYDLGRASASNTLAFQGVNVGATTVSSSFKGHVV 254

Query: 198 SLGVGMKF 205
             GV   F
Sbjct: 255 RAGVNYHF 262


>gi|260459523|ref|ZP_05807778.1| outer membrane protein-like protein [Mesorhizobium opportunistum
           WSM2075]
 gi|259035077|gb|EEW36333.1| outer membrane protein-like protein [Mesorhizobium opportunistum
           WSM2075]
          Length = 436

 Score = 70.2 bits (170), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 40/229 (17%), Positives = 65/229 (28%), Gaps = 33/229 (14%)

Query: 3   KLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSA 62
           K      VS  AL    +A AAD V+     G                +        +  
Sbjct: 8   KSIFLGAVSVFALM--SAAHAADVVQPVEASGFNWSGLYVGFGVGAGANVHKLGSDFIPI 65

Query: 63  LYNGSFGEEAHHNAGGSIFAGYNVED-SCIMYGVEGDVRYTVPVL-----ADNIHSLHGI 116
             NG  GE       G + AGY+       + G   DV              +       
Sbjct: 66  SLNGIGGE----GVYGELTAGYDYMVSPRFLLGGLLDVHVGDIKTKIDAAGFDASIQETY 121

Query: 117 GGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGE-ITPIAIGGTAGVGVEVGGLSES 175
           G    +R GY  + + L Y   G    +      AG        G   G G+E   ++ +
Sbjct: 122 GFDAGLRVGYLFTPNTLGYVLGGYSWQKYKLDSNAGFGFDWDQSGYFVGGGIET-AINSN 180

Query: 176 LVARLEYRASKYS-------------------KVEGFYNTISLGVGMKF 205
              + EYR +++                     ++   +T  +    +F
Sbjct: 181 WTIKTEYRYTRFGTKGDLLSEAGLIGAPDGLLNLDTSRHTFQIAANYRF 229



 Score = 62.9 bits (151), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 38/201 (18%), Positives = 67/201 (33%), Gaps = 39/201 (19%)

Query: 43  TNRYVPIRHDFNGPYAGLSALYNGS-------------FGEEAHHNAGGSIFAGYNVEDS 89
              +    +++ G Y G       S             F       A G +  GY+ +  
Sbjct: 236 GAAFETPAYNWTGFYIGGGLGAGASVHQIEIPPLGGAKFNGLGGEGAFGELNVGYDQDFG 295

Query: 90  CIMYGVEGDVRYTVPV-----LADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQ 144
             + GV  D RY+           +I+     G  +  R G ++++S L YA  G     
Sbjct: 296 SWVAGVMVDARYSGMTSKLDLGVGSINVDTDYGFDVLGRVGMKMNESTLAYALAGYSWQH 355

Query: 145 KYETGKAGEITPIAI---GGTAGVGVEVGGLSESLVARLEYRASKYSKVEG--------- 192
                             G + G G+E   +S ++   LEYR S++++ +          
Sbjct: 356 FDLNASDPVGDIADWGSSGFSVGAGLET-AVSSNMTIGLEYRYSQFAEKDLSFLLGSGAP 414

Query: 193 --------FYNTISLGVGMKF 205
                    ++T+ LG   KF
Sbjct: 415 DGLVTTTPSFHTVRLGAKYKF 435


>gi|156739532|gb|ABU93426.1| Omp25 [Brucella suis]
 gi|156739566|gb|ABU93443.1| Omp25 [Brucella melitensis]
 gi|156739572|gb|ABU93446.1| Omp25 [Brucella melitensis]
 gi|156739576|gb|ABU93448.1| Omp25 [Brucella melitensis]
          Length = 106

 Score = 70.2 bits (170), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 32/105 (30%), Positives = 53/105 (50%), Gaps = 3/105 (2%)

Query: 73  HHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLA-DNIHSLHGIGGSLRIRGGYEVSDS 131
             +     FAG+N +   I+YGVEGD  Y+    + D +    G  GSLR R GY+++  
Sbjct: 3   PDDWKAGAFAGWNFQQDQIVYGVEGDAGYSWAKKSKDGLEVKQGFEGSLRARVGYDLNP- 61

Query: 132 LLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESL 176
           ++ Y T G   +Q        + +   +G TAG G+E   L++++
Sbjct: 62  VMPYLTAGIAGSQIKLNNGLDDESKFRVGWTAGAGLE-AKLTDNI 105


>gi|311277854|ref|YP_003940085.1| OmpA/MotB domain-containing protein [Enterobacter cloacae SCF1]
 gi|308747049|gb|ADO46801.1| OmpA/MotB domain protein [Enterobacter cloacae SCF1]
          Length = 347

 Score = 70.2 bits (170), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 41/220 (18%), Positives = 72/220 (32%), Gaps = 34/220 (15%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K  +A+ +  L   +  +A AA                 A   Y   +  ++  Y+  
Sbjct: 1   MKKTLVALTI--LNACTMSTAFAA---------------ADAGTWYGGAKFGWS-HYSDT 42

Query: 61  SALYNGSFG-------EEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSL 113
           SA  + +         +    N GG IF GY + +   + G    +        +     
Sbjct: 43  SANNDFNDNMRQATDFDTNSDNVGGGIFGGYQINNWLAVEGGYDYLGNMQFNGNNGAAGG 102

Query: 114 --HGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGG 171
                G  L ++  Y +SDS  LY   G    +              +     VG E   
Sbjct: 103 KMKSQGLQLSLKASYGLSDSWDLYGRAGAMGYRAETEAAGHSTFDTGVRPLLAVGTEY-A 161

Query: 172 LSESLVARLEYRA-SKYSKVE-----GFYNTISLGVGMKF 205
            + SL  RLEY+  S              ++++ G+  +F
Sbjct: 162 FTPSLAGRLEYQWVSNVGNENQIGMTADASSVTAGIVYRF 201


>gi|156739530|gb|ABU93425.1| Omp25 [Brucella suis]
 gi|156739540|gb|ABU93430.1| Omp25 [Brucella abortus]
 gi|156739558|gb|ABU93439.1| Omp25 [Brucella melitensis]
 gi|156739590|gb|ABU93455.1| Omp25 [Brucella suis]
 gi|156739594|gb|ABU93457.1| Omp25 [Brucella suis]
 gi|156739614|gb|ABU93467.1| Omp25 [Brucella melitensis]
 gi|156739630|gb|ABU93475.1| Omp25 [Brucella suis]
          Length = 128

 Score = 69.8 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 38/129 (29%), Positives = 60/129 (46%), Gaps = 9/129 (6%)

Query: 55  GPYAGLSALYNGSF------GEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLA- 107
           G Y GL   Y  +       G     +     FAG+N +   I+YGVEGD  Y+    + 
Sbjct: 1   GGYTGLYLGYGWNKAKTSTVGSIKPDDWKAGAFAGWNFQQDQIVYGVEGDAGYSWAKKSK 60

Query: 108 DNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGV 167
           D +    G  GSLR R GY+++  ++ Y T G   +Q        + +   +G TAG G+
Sbjct: 61  DGLEVKQGFEGSLRARVGYDLNP-VMPYLTAGIAGSQIKLNNGLDDESKFRVGWTAGAGL 119

Query: 168 EVGGLSESL 176
           E   L++++
Sbjct: 120 E-AKLTDNI 127


>gi|156739552|gb|ABU93436.1| Omp25 [Brucella abortus]
          Length = 123

 Score = 69.8 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 34/123 (27%), Positives = 56/123 (45%), Gaps = 9/123 (7%)

Query: 61  SALYNGSF------GEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLA-DNIHSL 113
              Y  +       G     +     FAG+N +   I+YGVEGD  Y+    + D +   
Sbjct: 2   YLGYGWNKAKTSTVGSIKPDDWKAGAFAGWNFQQDQIVYGVEGDAGYSWAKKSKDGLEVK 61

Query: 114 HGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLS 173
            G  GSLR R GY+++  ++ Y T G   +Q        + +   +G TAG G+E   L+
Sbjct: 62  QGFEGSLRARVGYDLNP-VMPYLTAGIAGSQIKLNNGLDDESKFRVGWTAGAGLE-AKLT 119

Query: 174 ESL 176
           +++
Sbjct: 120 DNI 122


>gi|156739520|gb|ABU93420.1| Omp25 [Brucella canis]
 gi|156739522|gb|ABU93421.1| Omp25 [Brucella canis]
          Length = 128

 Score = 69.8 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 38/129 (29%), Positives = 60/129 (46%), Gaps = 9/129 (6%)

Query: 55  GPYAGLSALYNGSF------GEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLA- 107
           G Y GL   Y  +       G     +     FAG+N +   I+YGVEGD  Y+    + 
Sbjct: 1   GGYTGLYLGYGWNKAKTSTVGSIKPDDWKAGAFAGWNFQKDQIVYGVEGDAGYSWAKKSK 60

Query: 108 DNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGV 167
           D +    G  GSLR R GY+++  ++ Y T G   +Q        + +   +G TAG G+
Sbjct: 61  DGLEVKQGFEGSLRARVGYDLNP-VMPYLTAGIAGSQIKLNNGLDDESKFRVGWTAGAGL 119

Query: 168 EVGGLSESL 176
           E   L++++
Sbjct: 120 E-AKLTDNI 127


>gi|261344255|ref|ZP_05971899.1| outer membrane protein A [Providencia rustigianii DSM 4541]
 gi|282567857|gb|EFB73392.1| outer membrane protein A [Providencia rustigianii DSM 4541]
          Length = 353

 Score = 69.8 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 28/178 (15%), Positives = 58/178 (32%), Gaps = 16/178 (8%)

Query: 40  TIATNRYVPIRHDFNGPY---AGLSALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVE 96
                 Y   +  ++          A      G++     G  ++AGY         G E
Sbjct: 23  PKDNTWYTGGKLGWSHYEHAKFTDEAGDTVGTGKKTRDQLGAGLYAGYQY---NQYMGFE 79

Query: 97  GDVRYTVPVLADNIHSLHGIGG--SLRIRGGYEVSDSLLLYATVGPDVAQKYET-GKAGE 153
               +   +     +         SL  +  Y + + L +Y  +G  V +       +G+
Sbjct: 80  MGYDWFGKMKYKGTNPGSVSSMGVSLTTKLSYPIMEDLDVYTRLGGMVYRTEAKVNNSGK 139

Query: 154 ITPIAIGGTAGVGVEVGGLSESLVARLEYRAS----KYSKVEGFYNT--ISLGVGMKF 205
            T   +     +GVE   ++  L  RL+Y+          +    +   +S+G+  +F
Sbjct: 140 ETDTGVSPVYALGVEY-AITPELATRLDYQWVSGMGDKDNIGVSPDNGMLSVGLAYRF 196


>gi|330448107|ref|ZP_08311755.1| ompA family protein [Photobacterium leiognathi subsp. mandapamensis
           svers.1.1.]
 gi|328492298|dbj|GAA06252.1| ompA family protein [Photobacterium leiognathi subsp. mandapamensis
           svers.1.1.]
          Length = 348

 Score = 69.8 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 35/188 (18%), Positives = 58/188 (30%), Gaps = 24/188 (12%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M K ++A+    LAL    +A AA              P  A  R     +         
Sbjct: 1   MSKKYIALLP--LALIISTAASAATM-----------NPFYAGVRVGGAHYSNFQQNYQD 47

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGSL 120
                         +    +FAGYN+      + VE    +       +          L
Sbjct: 48  VTG-----INLNKDDVAAGLFAGYNITP---WFAVETGYTWLGEAKFQHNKIKQHAF-DL 98

Query: 121 RIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARL 180
             +  + ++D   ++  +G         G   +     + GT G GVE   L++ L  RL
Sbjct: 99  TGKATWHLNDKWGVFGKLGGSYMLTDFHGYGIKDIDEHLVGTVGAGVEY-QLTDHLSTRL 157

Query: 181 EYR-ASKY 187
           EY+     
Sbjct: 158 EYQLYHDL 165


>gi|269138621|ref|YP_003295321.1| outer membrane protein A [Edwardsiella tarda EIB202]
 gi|267984281|gb|ACY84110.1| outer membrane protein A [Edwardsiella tarda EIB202]
 gi|304558635|gb|ADM41299.1| Outer membrane protein A precursor [Edwardsiella tarda FL6-60]
          Length = 351

 Score = 69.8 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 37/218 (16%), Positives = 69/218 (31%), Gaps = 36/218 (16%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K   A+ ++         AQAA                     YV  +  ++   +  
Sbjct: 1   MKKT--AIALAVALAGFATVAQAA---------------PKDDTWYVGGKLGWSHFISNS 43

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVL-ADNIHSLHGIGG- 118
               +    +   +  G   F GY    +    G E    +   +    ++++     G 
Sbjct: 44  FE--DMGTTKSHPNQLGAGAFFGYQ---ANPYLGFEMGYDWLGRMGYTGDVNAKFKSQGV 98

Query: 119 SLRIRGGYEVSDSLLLYATVGPDVAQKY-----ETGKAGEITPIAIGGTAGVGVEVGGLS 173
            L  +  Y + D L +Y  +G  V +       + G         +   A +GVE   L+
Sbjct: 99  QLAAKLSYPLMDDLDVYTRLGGMVWRSDIHGAADGGDYTSSHDTGVSPLAAIGVEY-ALN 157

Query: 174 ESLVARLEYRASKYSKVEG------FYNTISLGVGMKF 205
           +    RL+Y+                   +SLGV  +F
Sbjct: 158 KDWATRLDYQYVNKVGTRSETGARPDNTMLSLGVVYRF 195


>gi|253720368|gb|ACT33424.1| outer membrane protein A precursor [Edwardsiella tarda]
          Length = 351

 Score = 69.8 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 37/218 (16%), Positives = 69/218 (31%), Gaps = 36/218 (16%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K   A+ ++         AQAA                     YV  +  ++   +  
Sbjct: 1   MKKT--AIALAVALAGFATVAQAA---------------PKDDTWYVGGKLGWSHFISNS 43

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVL-ADNIHSLHGIGG- 118
               +    +   +  G   F GY    +    G E    +   +    ++++     G 
Sbjct: 44  FE--DMGTTKSHPNQLGAGAFFGYQ---ANPYLGFEMGYDWLGRMGYTGDVNAKFKSQGV 98

Query: 119 SLRIRGGYEVSDSLLLYATVGPDVAQKY-----ETGKAGEITPIAIGGTAGVGVEVGGLS 173
            L  +  Y + D L +Y  +G  V +       + G         +   A +GVE   L+
Sbjct: 99  QLAAKLSYPLMDDLDVYTRLGGMVWRSDIHGAADGGDYTSSHDTGVSPLAAIGVEY-ALN 157

Query: 174 ESLVARLEYRASKYSKVEG------FYNTISLGVGMKF 205
           +    RL+Y+                   +SLGV  +F
Sbjct: 158 KDWATRLDYQYVNKVGTRSETGARPDNTMLSLGVVYRF 195


>gi|294677984|ref|YP_003578599.1| hypothetical protein RCAP_rcc02462 [Rhodobacter capsulatus SB 1003]
 gi|294476804|gb|ADE86192.1| membrane protein, putative [Rhodobacter capsulatus SB 1003]
          Length = 209

 Score = 69.8 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 44/214 (20%), Positives = 68/214 (31%), Gaps = 14/214 (6%)

Query: 1   MQKLFLA-VGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAG 59
           M+KL +A V ++SLA  +         V           P               G   G
Sbjct: 1   MKKLSVAIVAMASLAAPALAGGLTPPVVESEPTVAATPAPAPVQAWDGFYAGITGGSVTG 60

Query: 60  LSALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGS 119
             A Y               +F GYN++   ++YG E   + T   L             
Sbjct: 61  GGASYAPGGAAFGMGRGSYGVFGGYNLQSGALVYGGEIAAQATDFNLD-GAPGKFDNMID 119

Query: 120 LRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVAR 179
           L+ R G       L YA VG            G+    A G   G+GV+   +++     
Sbjct: 120 LKARAGMAYG-KALPYAFVGYSRGDWK--NGDGQTNGAADGMNYGLGVDY-AVNDKWSVG 175

Query: 180 LEYRASKYS--------KVEGFYNTISLGVGMKF 205
            E    + S         V+  +NT+ +  G +F
Sbjct: 176 AELMRRELSTDFDGSARSVDTNFNTVQVRAGFRF 209


>gi|156739536|gb|ABU93428.1| Omp25 [Brucella abortus]
          Length = 105

 Score = 69.4 bits (168), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 32/105 (30%), Positives = 53/105 (50%), Gaps = 3/105 (2%)

Query: 73  HHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLA-DNIHSLHGIGGSLRIRGGYEVSDS 131
             +     FAG+N +   I+YGVEGD  Y+    + D +    G  GSLR R GY+++  
Sbjct: 3   PDDWKAGAFAGWNFQQDQIVYGVEGDAGYSWAKKSKDGLEVKQGFEGSLRARVGYDLNP- 61

Query: 132 LLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESL 176
           ++ Y T G   +Q        + +   +G TAG G+E   L++++
Sbjct: 62  VMPYLTAGIAGSQIKLNNGLDDESKFRVGWTAGAGLE-AKLTDNI 105


>gi|90409122|ref|ZP_01217243.1| outer membrane protein A [Psychromonas sp. CNPT3]
 gi|90309773|gb|EAS37937.1| outer membrane protein A [Psychromonas sp. CNPT3]
          Length = 318

 Score = 69.4 bits (168), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 26/144 (18%), Positives = 47/144 (32%), Gaps = 9/144 (6%)

Query: 70  EEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVP----VLADNIHSLHGIGGSLRIRGG 125
           +    +  G  +AGY       +     ++           A+   +    G  +     
Sbjct: 44  DCDATDIAGGFYAGYQFNKYFALEAAYLNLGKVDAIYPINEAEKNFTGSMQGIEISALAL 103

Query: 126 YEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRAS 185
           Y +S+    +A  G    Q    G         +  T G+G+    +S+   ARLEY+  
Sbjct: 104 YPLSNDFNAFAKAGVFNWQAKSEGGPLTQKDYGLSPTIGLGLSY-QISKQWQARLEYQYF 162

Query: 186 -KYSKVEGF---YNTISLGVGMKF 205
                 E      +  SLG+  +F
Sbjct: 163 ANIGSAEIGGANAHLSSLGISYQF 186


>gi|296446346|ref|ZP_06888291.1| putative 31 kDa outer-membrane immunogenic protein precursor
           [Methylosinus trichosporium OB3b]
 gi|296256119|gb|EFH03201.1| putative 31 kDa outer-membrane immunogenic protein precursor
           [Methylosinus trichosporium OB3b]
          Length = 247

 Score = 69.4 bits (168), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 32/207 (15%), Positives = 51/207 (24%), Gaps = 41/207 (19%)

Query: 40  TIATNRYVPIRHDFNGPYAGLSALYNGSFGEEAHHNAGGSIFAG---------------- 83
                   P    + G Y G +  Y         ++  G   AG                
Sbjct: 27  APPMLPPPPPPPMWTGFYLGANVGYGWLDNYTRGNSITGWNGAGWVAGAPNVADNGSSNG 86

Query: 84  ---------YNVED-SCIMYGVEGDVRYTVPVLAD----NIHSLHGIGGSLRIRGGYE-V 128
                    YN +     + GVE D++                     G++R R G    
Sbjct: 87  GVVGGGQVGYNYQFHPAWVVGVEADMQAANIGDNGPSFLGTTRAVDWFGTVRARIGTTLF 146

Query: 129 SDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYS 188
           S  LL+Y T G                     G    G      + +  A++EY  +   
Sbjct: 147 SPELLIYGTGGFAYGDVRLKHALLGTLGQTGTGWTAGGGLEWLFAPNWSAKVEYLYTDIG 206

Query: 189 KVEGF----------YNTISLGVGMKF 205
             +              ++  GV   F
Sbjct: 207 SSDWGGFNNFEQRVHVQSVRAGVNYHF 233


>gi|310816178|ref|YP_003964142.1| outer membrane protein [Ketogulonicigenium vulgare Y25]
 gi|308754913|gb|ADO42842.1| outer membrane protein [Ketogulonicigenium vulgare Y25]
          Length = 202

 Score = 69.4 bits (168), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 34/210 (16%), Positives = 66/210 (31%), Gaps = 13/210 (6%)

Query: 1   MQKLFLAVGVSSLALASFCSA-QAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAG 59
           M+ L +A      +     +   AA  +         +        +          Y  
Sbjct: 1   MKNLIVATTALVASATFAQAGGLAAPTIEAPVAAPVVIAAPAPVTTWAGAYAGAALTYGE 60

Query: 60  LSALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLAD-NIHSLHGIGG 118
                +     E+    G ++  GY+ +    + G+  +  Y           +      
Sbjct: 61  TEG--SVGGTSESIDGVGVALRGGYDWQFGSWVLGLGAEYAYNNEDGDVFGATAERKDSA 118

Query: 119 SLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVA 178
           ++  R GY + D+ L Y + G   +     G     +    G T GVGVE    ++++  
Sbjct: 119 AVFARAGYAL-DTWLPYVSAGYTWSDAEVAGT----SYDLEGATYGVGVE-KLFTQNISG 172

Query: 179 RLEYRASKYSK---VEGFYNTISLGVGMKF 205
             EY  + +     V      + LGV  +F
Sbjct: 173 FAEYSFADFDDVQGVSVEGQGVKLGVNYRF 202


>gi|27380285|ref|NP_771814.1| hypothetical protein blr5174 [Bradyrhizobium japonicum USDA 110]
 gi|27353449|dbj|BAC50439.1| blr5174 [Bradyrhizobium japonicum USDA 110]
          Length = 256

 Score = 69.4 bits (168), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 38/223 (17%), Positives = 63/223 (28%), Gaps = 40/223 (17%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+KL +A     +A+     A AAD   R +      +        V   +D+ G Y G 
Sbjct: 1   MKKLLVA-AAGMMAVGLSAPASAADLAARPYTKAPPPI--------VAPIYDWTGFYIGA 51

Query: 61  SALYNGS--------------FGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVL 106
           +  +  S               G  +          GY  + +  + G+E    +     
Sbjct: 52  NGGWGQSRGCVDFVTLAGTVAGGCASRSGGLVGGQIGYRWQTNQFVLGLEAQGDWADIKN 111

Query: 107 AD--------NIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKA------- 151
                     +        G    + G+  + SLL Y   G  V                
Sbjct: 112 TRVSLIDPLLSTTGKTDGIGLFTAQLGWAWNASLL-YVKGGAAVTHNRLDVFNNLTGVGL 170

Query: 152 GEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFY 194
              +    GG  GVG E G  + +    +EY           +
Sbjct: 171 DSASHTRWGGALGVGWEYGF-APNWSVGVEYDHLWMGNDNRTF 212


>gi|156739580|gb|ABU93450.1| Omp25 [Brucella canis]
          Length = 105

 Score = 69.4 bits (168), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 32/105 (30%), Positives = 53/105 (50%), Gaps = 3/105 (2%)

Query: 73  HHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLA-DNIHSLHGIGGSLRIRGGYEVSDS 131
             +     FAG+N +   I+YGVEGD  Y+    + D +    G  GSLR R GY+++  
Sbjct: 2   PDDWKAGAFAGWNFQKDQIVYGVEGDAGYSWAKKSKDGLEVKQGFEGSLRARVGYDLNP- 60

Query: 132 LLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESL 176
           ++ Y T G   +Q        + +   +G TAG G+E   L++++
Sbjct: 61  VMPYLTAGIAGSQIKLNNGLDDESKFRVGWTAGAGLE-AKLTDNI 104


>gi|86748027|ref|YP_484523.1| outer membrane autotransporter [Rhodopseudomonas palustris HaA2]
 gi|86571055|gb|ABD05612.1| outer membrane autotransporter [Rhodopseudomonas palustris HaA2]
          Length = 638

 Score = 69.4 bits (168), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 37/223 (16%), Positives = 59/223 (26%), Gaps = 45/223 (20%)

Query: 27  VRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALY-----------NGSFGEEAHHN 75
              A                V   +++ G + G S               G+  +     
Sbjct: 408 APEAVAAAPLYTKAAKAPILVHSAYNWTGFFVGGSFGVLNGRTDWTFQPGGTTTDPRFAG 467

Query: 76  AGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLAD--------NIHSLHGIGGSLRIRGGYE 127
           A G    GY+ +    + GVEG +  T    A            +     G+   + GY 
Sbjct: 468 AIGGGQIGYDYQFGKWVVGVEGALNATNANGARPCPSSVFFTCETNVSWMGTATAKLGYA 527

Query: 128 VSDSLLLYATVGPDVAQKYETGK--------------AGEITPIAIGGTAGVGVEVGGLS 173
             D  L Y   G        T                    +    G T G+G E   LS
Sbjct: 528 FWDRSLWYVRGGGAFGDLKVTTTCNTGPFNPLGLAGCGENASRSRAGWTIGIGSEF-ALS 586

Query: 174 ESLVARLEYRASKYS---------KVEGFYNTI--SLGVGMKF 205
           ++   R E                 ++   N    ++GV  +F
Sbjct: 587 KNWTVRTETNYFDMGRERYVLPTSTIDVKQNGFISTVGVNYRF 629


>gi|90424285|ref|YP_532655.1| hypothetical protein RPC_2788 [Rhodopseudomonas palustris BisB18]
 gi|90106299|gb|ABD88336.1| conserved hypothetical protein [Rhodopseudomonas palustris BisB18]
          Length = 578

 Score = 69.4 bits (168), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 38/243 (15%), Positives = 63/243 (25%), Gaps = 74/243 (30%)

Query: 35  RGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSF----------------GEEAHHNAGG 78
                     +  P+  ++ G Y G                         G +       
Sbjct: 328 PPSAAVGFATKAPPLAVNWTGVYVGGQLGAGFGPKHWSDSIGSTTSLVNPGSDFPAGTPP 387

Query: 79  SIFAG------------------YNVEDSCIMYGVEGDVRYTVPVLADNIHSLHG----- 115
            +  G                  YN +    + GVE DV +     +  I+S  G     
Sbjct: 388 GLNVGGFGKSTPMAGGLGGAQLGYNFQTGRTVLGVEADVAFADLKGSHTIYSGLGGGQAE 447

Query: 116 ----IGGSLRIRGGYEVSDSLLLYATVG-PDVAQKYETGK------------AGEITPIA 158
                 GS+  R GY V  +LL     G   V                       +    
Sbjct: 448 AHTTALGSVTGRVGYAVERNLLYVKAGGAWAVTDHTLDTSSIFIPSQGEGCCHDNVRSTR 507

Query: 159 IGGTAGVGVEVGGLSESLVARLEYRASKYS-----------------KVEGFYNTISLGV 201
           +G T G G+E   +     A+LEY    +                   ++  ++ + +GV
Sbjct: 508 LGWTVGAGLEY-AVDRHWSAKLEYDYMDFGSQSVSFPVNARLGLPSVDIDQAFHVVKMGV 566

Query: 202 GMK 204
             K
Sbjct: 567 NYK 569


>gi|323137959|ref|ZP_08073033.1| hypothetical protein Met49242DRAFT_2421 [Methylocystis sp. ATCC
           49242]
 gi|322396678|gb|EFX99205.1| hypothetical protein Met49242DRAFT_2421 [Methylocystis sp. ATCC
           49242]
          Length = 837

 Score = 69.4 bits (168), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 25/168 (14%), Positives = 43/168 (25%), Gaps = 34/168 (20%)

Query: 59  GLSALYNGSFGEEAHHNAGGSIFAGYNVED-SCIMYGVEGDVRYTVPVLADNI------- 110
            ++     +          G +  G N       + GVE D+                  
Sbjct: 626 PVAFSAAPTDTGNHLAGFIGGLQLGANWNFSGNFLAGVETDLHGVSGNTDTKWQLTSANG 685

Query: 111 -----------HSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGE------ 153
                       +     G++R R GY  + +LL+Y T G                    
Sbjct: 686 GGDTFLTYEQRTATLNYLGTVRGRLGYLATPTLLVYGTGGMAYGGVVSNTAIFTRRVGGT 745

Query: 154 --------ITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGF 193
                        +G +AG GVE      +  A+++Y           
Sbjct: 746 SQTQVNPVFQDTLVGWSAGGGVE-WMFLPNWSAKVDYLHYDLGNARAS 792


>gi|296445833|ref|ZP_06887785.1| putative outer-membrane immunogenic protein precursor [Methylosinus
           trichosporium OB3b]
 gi|296256661|gb|EFH03736.1| putative outer-membrane immunogenic protein precursor [Methylosinus
           trichosporium OB3b]
          Length = 277

 Score = 69.4 bits (168), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 45/235 (19%), Positives = 71/235 (30%), Gaps = 40/235 (17%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K  +A  + +LA     SA AAD   R         P               G     
Sbjct: 1   MKKYVVAASMLALAFGM-GSASAADLPSRKDAPAFLPPPPPPPMWTGFYVGLNAGYGWTN 59

Query: 61  SALYNGSFGEE--------------------AHHNAGGSIFAGYNVEDSC-IMYGVEGDV 99
           +     S+ +                     ++    G    GYN +     + G+E D+
Sbjct: 60  NNTVTQSYADTGSAGFGAQALGGNFPWNASVSNDGFIGGGQIGYNAQVYNSFVVGLEADM 119

Query: 100 R----------YTVPVLADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETG 149
           +          Y  P  + +I       G++R R GY V+ +LL YAT G    Q   +G
Sbjct: 120 QGVASDRQAASYYGPTASASISRSLDYLGTVRGRVGYLVTPTLLAYATGGLAYGQANLSG 179

Query: 150 KA-------GEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFYNTI 197
                       +   +G + G G E         A+ EY             + 
Sbjct: 180 AYYGTATGSDSFSDTRVGYSVGGGFE-WLFMPHWSAKAEYLYYDLGNATTPGASF 233


>gi|163851436|ref|YP_001639479.1| carbohydrate-selective porin OprB [Methylobacterium extorquens PA1]
 gi|163663041|gb|ABY30408.1| Carbohydrate-selective porin OprB [Methylobacterium extorquens PA1]
          Length = 703

 Score = 69.4 bits (168), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 39/229 (17%), Positives = 68/229 (29%), Gaps = 41/229 (17%)

Query: 2   QKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLS 61
           ++  ++ G++ +      +  AAD   RA           A  +        N  +   +
Sbjct: 11  KQGAVSAGLAVILGVHAGAGMAADLAERARPRFIDWSGFYAGVQGSAGASFGNYDFGPTT 70

Query: 62  ALY------------NGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADN 109
                                     A G  FAG+N +D  ++YG+E D+          
Sbjct: 71  IGSRRVRSISTGDATGSRDLGGDATTAVGGAFAGWNWQDGALVYGIEADLVGANLKRGAR 130

Query: 110 IHS-----------------LHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYE----- 147
             +                    + G+ R R GY   ++ L+YAT G   A         
Sbjct: 131 SDATGFGYEGIDPPFALIREKTDVFGAARARLGYAFGNN-LIYATAGLTGANGRVLATYP 189

Query: 148 -----TGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVE 191
                           +G T G GV+   +   L   ++YR S   +  
Sbjct: 190 DLAGGPTATATRNVSYLGFTLGAGVQF-AVDPHLSLGIDYRYSDLGESG 237


>gi|261317611|ref|ZP_05956808.1| LOW QUALITY PROTEIN: porin [Brucella pinnipedialis B2/94]
 gi|265988645|ref|ZP_06101202.1| LOW QUALITY PROTEIN: porin [Brucella pinnipedialis M292/94/1]
 gi|261296834|gb|EEY00331.1| LOW QUALITY PROTEIN: porin [Brucella pinnipedialis B2/94]
 gi|264660842|gb|EEZ31103.1| LOW QUALITY PROTEIN: porin [Brucella pinnipedialis M292/94/1]
          Length = 134

 Score = 69.4 bits (168), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 26/126 (20%), Positives = 43/126 (34%), Gaps = 25/126 (19%)

Query: 103 VPVLADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGE--------I 154
              L   + S     G++R R G  + D  + Y   G        +    +         
Sbjct: 11  DLDLTTGVDSKLRWSGAVRARMGVAM-DRWMPYIAGGVAFGNVKNSVSLTDGIESIGVSQ 69

Query: 155 TPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFY---------------NTISL 199
           +    G  AG GV+    +++++ RLEYR + Y   +                  + I L
Sbjct: 70  SKTMTGWAAGAGVDYAA-TDNVIVRLEYRYTDYGHKDFSVVDGDLSVEARNKFKTHDIRL 128

Query: 200 GVGMKF 205
           GV  KF
Sbjct: 129 GVAYKF 134


>gi|220925103|ref|YP_002500405.1| porin [Methylobacterium nodulans ORS 2060]
 gi|219949710|gb|ACL60102.1| porin [Methylobacterium nodulans ORS 2060]
          Length = 287

 Score = 69.4 bits (168), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 41/253 (16%), Positives = 66/253 (26%), Gaps = 65/253 (25%)

Query: 3   KLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSA 62
           K  L    +   +    SA AAD  RR                       + G YAG +A
Sbjct: 2   KSLLKSATALAGVLVAGSALAADLPRRV---------APPPVFTPVPVFTWTGFYAGFNA 52

Query: 63  LYNGSFGEEA---------------------------HHNAGGSIFAGYNVED---SCIM 92
            Y  S  +                             +    G    GYN +    S ++
Sbjct: 53  GYGFSTNDNNTPTVLGVGPATGLVFAPTVIAFQNRNNNDGFVGGGQVGYNYQFTPGSGVV 112

Query: 93  YGVEGDVRYTVPVLADNIH-----------------SLHGIGGSLRIRGGYEVSDSLLLY 135
            G+E D ++       N                   S     G++R R GY    +L+  
Sbjct: 113 IGLEADAQFADFGRNRNRFLATGPIAAQTVFNPAGISGLDWFGTVRGRLGYAFDRTLVYA 172

Query: 136 ATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSES---------LVARLEYRASK 186
                  +                G TAG GVE    ++S         +  ++E     
Sbjct: 173 TGGFAYGSGGGRDFGLPNRDDFQTGWTAGGGVEYALPTDSFLNFFKSNAVTVKVEGLYVN 232

Query: 187 YSKVEGFYNTISL 199
             +        ++
Sbjct: 233 LERERNRSGAFAV 245


>gi|319408046|emb|CBI81700.1| Outer membrane protein, omp25/ropB family [Bartonella
           schoenbuchensis R1]
          Length = 273

 Score = 69.4 bits (168), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 38/258 (14%), Positives = 70/258 (27%), Gaps = 84/258 (32%)

Query: 29  RAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSFGEEAHH-------------- 74
                   +V       +VP    + G Y G            +                
Sbjct: 17  SVVRASGYMVIQEPMPVFVPSTFSWEGLYLGGQVGGALGKLSVSSRVISGKNTVTKKSQI 76

Query: 75  ---------NAGGSIFAGYNV--EDSCIMYGVEGDVRYT--------------------- 102
                       G  +AG N+  +D+ ++  V+ D+ ++                     
Sbjct: 77  VSSDKYNLAGFIGGFYAGSNLRLDDNGLILSVDTDIVWSNQKNVQFGKRMIVGDQSARVH 136

Query: 103 -----------------VPVLADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQK 145
                               +  N        G+ R+R G+  +D ++ Y   G    + 
Sbjct: 137 NALVSRFGHKKSGLVKVGDEVTYNTTRKEKWAGATRVRFGFA-ADRIMPYIAGGIAYTKV 195

Query: 146 YETGKAGEIT----------PIAIGGTAGVGVEVGGLSESLVARLEYRASKYS------- 188
             T      +             IG T G GV    +S++++ R EYR S +        
Sbjct: 196 QITPWFLVNSANPLNLMTEKKAMIGYTLGAGVNF-AVSDNVILRGEYRYSDFGKKKFMES 254

Query: 189 --KVEGFYNTISLGVGMK 204
              V    + + +GV  K
Sbjct: 255 PVNVSYSTHDLRVGVAYK 272


>gi|46397579|gb|AAS91718.1| OmpA [Bibersteinia trehalosi]
 gi|46397584|gb|AAS91722.1| OmpA [Bibersteinia trehalosi]
 gi|46397589|gb|AAS91726.1| OmpA [Bibersteinia trehalosi]
 gi|46397594|gb|AAS91730.1| OmpA [Bibersteinia trehalosi]
          Length = 360

 Score = 69.0 bits (167), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 45/235 (19%), Positives = 80/235 (34%), Gaps = 49/235 (20%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K  +A+ V+  A+AS  +A                    A + YV  +  +   + G+
Sbjct: 1   MKKSLVALAVAGFAVASANAA------------------PEANSVYVGAKAGWASFHDGI 42

Query: 61  SA--LYNGSFGEEAHHNAGGSIFAGYNV------EDSCIMYGVEGDVRYTVPVLADNIHS 112
           S     NG       ++     F GY +      E     +G    +  T    +     
Sbjct: 43  SQIDHKNGGKYGINKNSVTYGAFVGYQIIDNLAAEVGYEYFGRVRGLEQTKAGGSKKTFR 102

Query: 113 LHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKY------ETGKAGEITPIAIGGTAGVG 166
               G ++ ++G YEV   L  YA  G  +          +T    + +        G G
Sbjct: 103 HSAHGTTIALKGNYEVISGLDTYAKAGIALVNNSYKTVNVDTKVPTKTSRFQSSLILGAG 162

Query: 167 VEVGGLSESLVARLEYRA----------------SKYSKVEGFYNTISLGVGMKF 205
           VE   ++ SL AR+EY+                  + S      +++S G+  +F
Sbjct: 163 VEY-AITPSLGARIEYQWLNNAGKASYATLRRMGVEGSDYRPDISSVSAGLTYRF 216


>gi|310816897|ref|YP_003964861.1| outer membrane protein [Ketogulonicigenium vulgare Y25]
 gi|308755632|gb|ADO43561.1| outer membrane protein [Ketogulonicigenium vulgare Y25]
          Length = 237

 Score = 69.0 bits (167), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 44/236 (18%), Positives = 74/236 (31%), Gaps = 33/236 (13%)

Query: 2   QKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLS 61
           +K  +A  V + ++ S  +A A    +        +             +   G    +S
Sbjct: 3   KKFIVASAVVAASVGSVNTAVAGGLSQEIVEAPVVIPVAPVLTNRFAGGYVGLGYGHVVS 62

Query: 62  AL------------YNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPV---- 105
           +               G  G+         + AGY   +  ++YG    VR         
Sbjct: 63  SDDRVGMVDQTTNLLTGVLGDLDLEGGAAILQAGYRWANGNLVYGPTLRVRGGGIDAELT 122

Query: 106 LADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGK---AGEITPIAIGGT 162
                 S      +LR   GY V+ SLLLY  VG   A+             T    G  
Sbjct: 123 GTSTGSSTVNWEAALRGNLGYTVTPSLLLYGFVGYTYAEVEYDVAGAINVAETVNFGGVN 182

Query: 163 AGVGVEVGGLSESLVARLEYRASKYSKVEG-------------FYNTISLGVGMKF 205
           AG+G E   L+++     EY  + Y                   ++++++GV   F
Sbjct: 183 AGLGAEY-ALNDNWSLFGEYEYAGYEGKNLVDPAINQHTRPTPDFHSVNIGVNFSF 237


>gi|156739528|gb|ABU93424.1| Omp25 [Brucella melitensis]
          Length = 124

 Score = 69.0 bits (167), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 34/123 (27%), Positives = 56/123 (45%), Gaps = 9/123 (7%)

Query: 61  SALYNGSF------GEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLA-DNIHSL 113
              Y  +       G     +     FAG+N +   I+YGVEGD  Y+    + D +   
Sbjct: 3   YLGYGWNKAKTSXVGSIKPDDWKAGAFAGWNFQQDQIVYGVEGDAGYSWAKKSKDGLEVK 62

Query: 114 HGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLS 173
            G  GSLR R GY+++  ++ Y T G   +Q        + +   +G TAG G+E   L+
Sbjct: 63  QGFEGSLRARVGYDLNP-VMPYLTAGIAGSQIKLNNGLDDESKFRVGWTAGAGLE-AKLT 120

Query: 174 ESL 176
           +++
Sbjct: 121 DNI 123


>gi|220979417|gb|ACL97990.1| outer membrane protein B3 [Rhizobium leguminosarum bv. viciae]
          Length = 216

 Score = 69.0 bits (167), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 44/225 (19%), Positives = 68/225 (30%), Gaps = 34/225 (15%)

Query: 2   QKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLS 61
           ++   +VGVS L     C A AAD    +                 P    + G YAGL 
Sbjct: 5   KRKIFSVGVSML---MACGASAADLADHSVPSAPSYD--------APGTFSWAGAYAGLH 53

Query: 62  ALYNGSFGEEAHHN--AGGSIFAGYNVEDSCIMYGVEGDVRY-TVPVLADNIHSLHGIGG 118
                S     ++          GYN +    ++G E +  Y    V     +      G
Sbjct: 54  GGVAASKFNPFNNGRAPAVGAQVGYNFQAGSGVFGAELEGSYLNNEVRVPVGNVESRFRG 113

Query: 119 SLRIRGGYEVSDSLLLYATVGPDVAQKY-------ETGKAGEITPIAIGGTAGVGVEVGG 171
           + + + G    D   +Y T G    +                      G   G GVE   
Sbjct: 114 AAKAKAGLGF-DRTFVYGTAGVTTTEFEGHRLVSGSDKWKSGPDSWKHGYLFGGGVE-HA 171

Query: 172 LSESLVARLEYRAS-----------KYSKVEGFYNTISLGVGMKF 205
            S  + A++EY                S+ +   N I  G+  +F
Sbjct: 172 FSGGVSAKIEYNYVINNAVPTTSGGISSRSDLNDNVIEAGLNFRF 216


>gi|289209019|ref|YP_003461085.1| OmpA domain protein transmembrane region-containing protein
           [Thioalkalivibrio sp. K90mix]
 gi|288944650|gb|ADC72349.1| OmpA domain protein transmembrane region-containing protein
           [Thioalkalivibrio sp. K90mix]
          Length = 210

 Score = 69.0 bits (167), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 35/215 (16%), Positives = 60/215 (27%), Gaps = 15/215 (6%)

Query: 1   MQKLFLA-VGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAG 59
           M++   A V VS+L L    SA A     R                        +     
Sbjct: 1   MKRYLAAGVAVSALVLLGSQSALAQQDRDRTTQERDRTTGVYMGLGTGFSSLKNDSDEVA 60

Query: 60  LSALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVR----YTVPVLADNIHSLHG 115
                  S       +     F GYN      + G   D+           A +      
Sbjct: 61  DFIGSGTSDYSIDDDDNVWRGFVGYNFNRYLAVEGFYTDLGEVTLRGDEDGAHSSVRSTA 120

Query: 116 IGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEI-----TPIAIGGTAGVGVEVG 170
            G S+  +    +   +  +A VG         G  G+      +        GVG++V 
Sbjct: 121 YGASVLGKL--PIGPYVEAFAKVGAAKWDADVRGNLGDEGRTLRSQDGFDPVYGVGMQVN 178

Query: 171 GLSESLVARLEYRASKYSKVEGFYNTISLGVGMKF 205
               + + R EY    +   +   +  +  +G +F
Sbjct: 179 L--NAFMIRAEYERYDF-DSDYKMDAFTASLGWRF 210


>gi|148258469|ref|YP_001243054.1| hypothetical protein BBta_7274 [Bradyrhizobium sp. BTAi1]
 gi|146410642|gb|ABQ39148.1| putative exported protein of unknown function [Bradyrhizobium sp.
           BTAi1]
          Length = 693

 Score = 69.0 bits (167), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 43/239 (17%), Positives = 70/239 (29%), Gaps = 68/239 (28%)

Query: 32  HGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSFGEEA------------------- 72
                    +     V    D+ G Y G    Y       +                   
Sbjct: 27  ASAESGRVPLPVQASVSSIFDWTGFYVGTHFGYAAGASNWSATQADGSAPRLMGRLDFYP 86

Query: 73  -------HHNAGGSIFAGYNVE-DSCIMYGVEGDVRY-----------TVPVLADNIHSL 113
                    +    + AGYN +  S ++ GVE D+ +           T      +    
Sbjct: 87  QYDAFKGTGSFSSGLQAGYNYQAASRLLLGVEADISFPNSVSATQTFSTTLGDQASYGET 146

Query: 114 HGIGGSLRIRGGYEVSDSLLLYATVGPDV---------------AQKYETGKAGEITPIA 158
               GS+R R GY   D+ L+Y T G                        G   + +   
Sbjct: 147 VLHAGSVRGRVGYAF-DNWLVYGTGGFGWSFDQFTRTQLMGSPMGGSAVPGTLEKHSLWR 205

Query: 159 IGGTAGVGVEVGGLSESLVARLEYRASKYSKV-------------EGFYNTISLGVGMK 204
           +G  AG GVE   ++ S  A+LEY  S++                +   ++I LG+  +
Sbjct: 206 LGWVAGAGVE-LPVAPSWTAKLEYLLSEFGGQSISFPAGAQKFEGDYASHSIRLGLNYQ 263


>gi|310815861|ref|YP_003963825.1| putative outer-membrane immunogenic protein precursor
           [Ketogulonicigenium vulgare Y25]
 gi|308754596|gb|ADO42525.1| putative outer-membrane immunogenic protein precursor
           [Ketogulonicigenium vulgare Y25]
          Length = 220

 Score = 68.7 bits (166), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 40/226 (17%), Positives = 79/226 (34%), Gaps = 27/226 (11%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+  F+ + ++   + +   A AA   +              +  YV    + +     +
Sbjct: 1   MKISFMTLIIAGAVVGTLPMAAAA---QHVPRIVVMTPSVGFSGGYVGFGLNRDSGSIDM 57

Query: 61  SALYN-------GSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLA------ 107
           +           G+         G ++ AGY+      ++GV G++  +           
Sbjct: 58  NGETGDQAQQLLGTRSLGEPSGLGLNLRAGYDWRTGNTIFGVWGEIAQSWAKDDVVIPAV 117

Query: 108 -DNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVG 166
            D      G   +  +R GY++   +++Y+  G           +G  +  + G + GVG
Sbjct: 118 SDTWSVGFGTSTAAMLRLGYDMGG-VMVYSNAGYRWTDVELETFSGAYSDRSGGISYGVG 176

Query: 167 VEVGGLSESLVARLEYRASKYSKVEG-------FYNTISLGVGMKF 205
           +E    S  +   LE+      KV+          NT +LGV  KF
Sbjct: 177 IETEF-SHHMSGYLEF-HRNTGKVDIEGLTADLSLNTFTLGVNYKF 220


>gi|148253089|ref|YP_001237674.1| OmpA-like transmembrane domain-containing protein [Bradyrhizobium
           sp. BTAi1]
 gi|146405262|gb|ABQ33768.1| OmpA-like transmembrane domain protein [Bradyrhizobium sp. BTAi1]
          Length = 598

 Score = 68.7 bits (166), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 38/164 (23%), Positives = 59/164 (35%), Gaps = 31/164 (18%)

Query: 70  EEAHHNAGGSIFAGYNVEDS-CIMYGVEGDVR-----------YTVPVLADNIHSLHGIG 117
           + +  +  G +  GYN E    ++ GVE D+            ++       +       
Sbjct: 5   KSSVGSLFGGLQLGYNRELPSRVVLGVETDLSFPNYLDFDDIIWSGVNANGRVTEKVDYY 64

Query: 118 GSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEIT-----PIAIGGTAGVGVEVGGL 172
           GSLR R GY  +   L+YAT G   +Q   T    +           G  AG GVE   +
Sbjct: 65  GSLRGRIGYAPA-RWLIYATAGLAYSQGRLTEDPFDPATQKKIGFRAGWVAGAGVE-APV 122

Query: 173 SESLVARLEYRASKYSK------------VEGFYNTISLGVGMK 204
             +  AR+EY  S +                   +T+ LG+  K
Sbjct: 123 DGNWTARIEYLYSNFGSLNVMLPSGTSYGSTFDLHTVRLGLNRK 166


>gi|156739612|gb|ABU93466.1| Omp25 [Brucella canis]
          Length = 104

 Score = 68.7 bits (166), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 32/105 (30%), Positives = 53/105 (50%), Gaps = 3/105 (2%)

Query: 73  HHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLA-DNIHSLHGIGGSLRIRGGYEVSDS 131
             +     FAG+N +   I+YGVEGD  Y+    + D +    G  GSLR R GY+++  
Sbjct: 1   PDDWKAGAFAGWNFQKDQIVYGVEGDAGYSWAKKSKDGLEVKQGFEGSLRARVGYDLNP- 59

Query: 132 LLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESL 176
           ++ Y T G   +Q        + +   +G TAG G+E   L++++
Sbjct: 60  VMPYLTAGIAGSQIKLNNGLDDESKFRVGWTAGAGLE-AKLTDNI 103


>gi|148255369|ref|YP_001239954.1| putative outer-membrane immunogenic protein [Bradyrhizobium sp.
           BTAi1]
 gi|146407542|gb|ABQ36048.1| putative outer-membrane immunogenic protein precursor
           [Bradyrhizobium sp. BTAi1]
          Length = 262

 Score = 68.7 bits (166), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 38/225 (16%), Positives = 68/225 (30%), Gaps = 35/225 (15%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATN-------RYVPIRHDF 53
           M+KL LAV       A   +A AAD   R +       P   +               + 
Sbjct: 1   MKKLLLAVTA---MAAMTGTASAADLAARPYTKAPIAAPLAPSWTGFYIFGGGGGGLWNA 57

Query: 54  NGPYAGLSALYN--GSFGEEAHHNAGGSIFAGYNVEDSC-IMYGVEGDVRYTVPVLAD-- 108
           +      +      G   ++      G++ AGY+ + +   + G   D ++         
Sbjct: 58  DTTINSTATGAALIGLNQKQGGEGWFGTVGAGYDWQVNPTWVIGAFADGQFGSIKGTIQD 117

Query: 109 -----NIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETG----------KAGE 153
                  +  +    ++  R GY V+ ++L Y   G   +    T               
Sbjct: 118 QGALIAGNIKNDYSWAVGGRVGYLVAPNVLSYVNAGYSSSHWKGTTLLSTVTGGASGLHT 177

Query: 154 ITPIAIGGTAGVGVE-----VGGLSESLVARLEYRASKYSKVEGF 193
                 G   G GVE      G  +     + EYR++ Y +    
Sbjct: 178 DGFDRSGWFIGGGVENNLNIFGISAPGWFMKTEYRSAFYDRKNIS 222


>gi|319407469|emb|CBI81119.1| Hemin binding protein d [Bartonella sp. 1-1C]
          Length = 270

 Score = 68.7 bits (166), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 38/276 (13%), Positives = 69/276 (25%), Gaps = 87/276 (31%)

Query: 8   VGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGS 67
           +  S   L S   AQA D V               +   +     + G Y G        
Sbjct: 4   LTASVFTLFSISIAQATDFVI-------PYQSHTDSPFVLSSAFSWQGFYFGARIGGFSG 56

Query: 68  --------------------FGEEAHHNAGGSIFAGYNVEDSC-IMYGVEGDVRYTVPVL 106
                                         G ++AG ++      + G + +V ++    
Sbjct: 57  PITSSIMDENNVERNIIFQDQSSPKLSGVVGGLYAGLDINIHNIFVVGCDTNVDWSGVKD 116

Query: 107 ADNIHS-------------------------LHGIGGSLRIRGGYEVSDSLLLYATVGPD 141
              I                                 ++R R G+   D ++ Y   G  
Sbjct: 117 TKVIDVIASLQADLKYGNGGGEVDFGIKQSLQQKWLSAIRWRVGFSF-DRVMPYVAGGVS 175

Query: 142 VAQKYETGKA-----------------------GEITPIAIGGTAGVGVEVGGLSESLVA 178
           ++Q   T                                 +G T G G++   ++++ + 
Sbjct: 176 LSQFRSTYSKFLVASNNNSSIRSLSEKPLPVSSTSNVNTMVGYTIGGGLDF-AITDNFIL 234

Query: 179 RLEYRASKYSKVE---------GFYNTISLGVGMKF 205
           R EY  S + + E            N    G+  KF
Sbjct: 235 RAEYNYSDFGRKELVNSKIKFSYKSNAFYFGLAYKF 270


>gi|92117608|ref|YP_577337.1| putative outer-membrane protein precursor [Nitrobacter hamburgensis
           X14]
 gi|91800502|gb|ABE62877.1| putative outer-membrane protein precursor [Nitrobacter hamburgensis
           X14]
          Length = 251

 Score = 68.7 bits (166), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 35/209 (16%), Positives = 56/209 (26%), Gaps = 30/209 (14%)

Query: 14  ALASFCSAQAADP-VRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSFGEEA 72
            L     A A       A        P       +   +D++G Y G +  +  S     
Sbjct: 4   LLIGVVGALAIGLGAAPATAADLAPRPYTKAPPMIAAIYDWSGFYVGANGGWGSSRSCWD 63

Query: 73  HHNAGGSI-----------FAGYNVEDSCIMYGVEGDVRYTVPVLAD--------NIHSL 113
                                GY  + + +++G+E    +      +          HS 
Sbjct: 64  LTAPVAGGCHDATGGTIGGQIGYRWQSNNLVFGLEAQGNWADLNGRNVSIDFSRFTNHSR 123

Query: 114 HGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETG--------KAGEITPIAIGGTAGV 165
               G    + GY   D+ LLY   G  V                A  +     GG  GV
Sbjct: 124 LDAFGLFTGQIGYSW-DATLLYVKGGAAVTSNRYRSVDNVSGLQAADSVNDTRWGGVVGV 182

Query: 166 GVEVGGLSESLVARLEYRASKYSKVEGFY 194
           G+E G  + +     EY           +
Sbjct: 183 GLEYGF-APNWSLGFEYDHIFMGNSSHTF 210


>gi|33151318|ref|NP_872671.1| major outer membrane protein [Haemophilus ducreyi 35000HP]
 gi|1872470|gb|AAB49273.1| major outer membrane protein [Haemophilus ducreyi]
 gi|33147538|gb|AAP95060.1| major outer membrane protein [Haemophilus ducreyi 35000HP]
          Length = 403

 Score = 68.7 bits (166), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 37/264 (14%), Positives = 76/264 (28%), Gaps = 69/264 (26%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATN-RYVPIRHDFNGPYAG 59
           M+K  + + V    L++  +A AA      + G +    +   +      ++  +  Y  
Sbjct: 1   MKKTLVTLSV----LSATSAAFAAPDANTFYLGAKAGWASTHKDINQFDSKYQNDKRYNP 56

Query: 60  LSALYNGSFGEEAHHNAGGSIFAGYN-VEDSCIMYGVEGDVRYTV--------------- 103
               +         ++    +F GY     + +   +E    Y                 
Sbjct: 57  EFTTWG-----IHRNSVTYGVFGGYQIFNQNKMGLALELGYDYYGQMKGSSQNKVALDVP 111

Query: 104 -------------PVLADNIHSLHGIGGS-LRIRGGYEVSDSLLLYATVGPDVAQKYETG 149
                        P    N    H   G+ L ++  YE+  +L +Y  VG  + +     
Sbjct: 112 TPRGPRPPIHKPKPKGDLNRQFKHTAHGANLSLKPSYEILPNLDVYGKVGMGLVRNDYKF 171

Query: 150 KAGEITPI------------AIGGTAGVGVEVGGLSESLVARLEYRASK----------Y 187
                +                    G GVE   ++  L  R EY+             Y
Sbjct: 172 ILDLQSKDQHVKDETKLHTLKPSLLLGTGVEY-AITPELALRTEYQYLNKAGNLYKAAKY 230

Query: 188 SKVEG------FYNTISLGVGMKF 205
             +          +++S+G+  +F
Sbjct: 231 KNISTSLAYAPDIHSVSVGLSYRF 254


>gi|323136029|ref|ZP_08071112.1| hypothetical protein Met49242DRAFT_0499 [Methylocystis sp. ATCC
           49242]
 gi|322399120|gb|EFY01639.1| hypothetical protein Met49242DRAFT_0499 [Methylocystis sp. ATCC
           49242]
          Length = 582

 Score = 68.7 bits (166), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 40/236 (16%), Positives = 60/236 (25%), Gaps = 53/236 (22%)

Query: 8   VGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFN------------- 54
              +         A  AD                 T  YV                    
Sbjct: 12  AACALTFAGFCAPASGADLPSFKGAPVAPPPVFTWTGLYVGFNFGHTWTASDPVSIGSVN 71

Query: 55  ------GPYAGLSALYNGSFGEEAHHNAGGSIFAGYNVEDSC-IMYGVEGDVRYTVPVLA 107
                   +   SAL      +           AGYN + S  ++ G E D++       
Sbjct: 72  PFDLSGAGFGPASALGATGAVDARLGGYFFGGQAGYNWQFSEKLIAGFEADIQGAGVRGG 131

Query: 108 DNIHS-----------------LHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGK 150
            ++ S                      G++R R GY V+ + + Y T G           
Sbjct: 132 GHLASILPAPAGFAVSGVKLSRGLEYFGTVRGRFGYAVTPTFMAYVTGGLAYGGVTADSA 191

Query: 151 AGE---------------ITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVE 191
             +                    +G T G G EV  LS ++ A+LEY       V 
Sbjct: 192 IRQSLTPSLLLAEPGKLDYFDNRVGWTVGAGGEV-ALSRNISAKLEYLYYDLGGVT 246


>gi|312113917|ref|YP_004011513.1| hypothetical protein Rvan_1143 [Rhodomicrobium vannielii ATCC
           17100]
 gi|311219046|gb|ADP70414.1| hypothetical protein Rvan_1143 [Rhodomicrobium vannielii ATCC
           17100]
          Length = 292

 Score = 68.7 bits (166), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 42/244 (17%), Positives = 63/244 (25%), Gaps = 64/244 (26%)

Query: 15  LASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYA--------GLSALYNG 66
           + +  SA AAD   R      G                  G            +      
Sbjct: 1   MVAGNSALAADLYGRGGGLKDGPFYEAPALWQGFYLGGHVGAAWSKADVDDTFIYVGDPT 60

Query: 67  SFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADN----------------- 109
             G+    +  G    GYN +    ++GVEGD+ Y     + +                 
Sbjct: 61  YKGDLNTTSLTGGGQLGYNFQRGNFVFGVEGDIGYLKVDASKDVAFRPTSCVGTYTSAPY 120

Query: 110 --------------IHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKA---- 151
                           +   + G +  R GY   D  L YA  G          K     
Sbjct: 121 TVNYDPKMCAVDTKYSASGDLYGDITGRLGYAF-DRTLFYAKGGVAFLNGEFDAKYLGQN 179

Query: 152 -------------------GEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEG 192
                                 +   +G T GVGVE   L+ S   + EY+   +  +  
Sbjct: 180 CASLGSDSHCLGNALSKFDYSHSETLVGWTIGVGVEY-KLTPSWSLKAEYQHFNFGSISY 238

Query: 193 FYNT 196
            YN 
Sbjct: 239 SYND 242


>gi|91978079|ref|YP_570738.1| putative outer membrane protein [Rhodopseudomonas palustris BisB5]
 gi|91684535|gb|ABE40837.1| putative outer membrane protein [Rhodopseudomonas palustris BisB5]
          Length = 235

 Score = 68.7 bits (166), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 28/185 (15%), Positives = 48/185 (25%), Gaps = 17/185 (9%)

Query: 25  DPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSFGEEAHHNAGGSIFAGY 84
                           +                     L  G  G        G +  G+
Sbjct: 26  PLKAAPPVPALYNWTGVYIGINGSAVLSDKRWDYFGPLLPTGDDGAHNFTGLFGGVQVGF 85

Query: 85  NVEDSCIMYGVEGDVRYTVPVLAD--------NIHSLHGIGGSLRIRGGYEVSDSLLLYA 136
           + +    ++GVE    +                  +L    G +  R GY ++++LL Y 
Sbjct: 86  DYQVGSWVFGVEAQGDWGRARGTSDSLLFANQTNRTLIDAFGLINGRFGYALNNALL-YV 144

Query: 137 TVGPDVAQKYET-------GKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSK 189
             G  V Q+                +    G T G G+E    SE +    EY       
Sbjct: 145 KGGAGVVQEKYDVFATDTGVTFTNASETRWGSTVGAGLE-LAFSEHISVAAEYNHIFLGS 203

Query: 190 VEGFY 194
            +  +
Sbjct: 204 RDVAF 208


>gi|49473905|ref|YP_031947.1| hemin binding protein b [Bartonella quintana str. Toulouse]
 gi|21689905|gb|AAM68130.1| hemin-binding protein B [Bartonella quintana]
 gi|49239408|emb|CAF25746.1| Hemin binding protein b [Bartonella quintana str. Toulouse]
          Length = 453

 Score = 68.7 bits (166), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 26/137 (18%), Positives = 43/137 (31%), Gaps = 26/137 (18%)

Query: 93  YGVEGDVRYTVPVLADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDV---------- 142
                 V                  G+ R+R G+  +D ++ Y   G             
Sbjct: 319 VAASLGVDQGGRAETLTHTLKQNWAGATRLRIGFA-ADRIMPYVAGGIAYTQLQDIVSIS 377

Query: 143 -----AQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSK-------- 189
                 +          T   IG T G G++   ++++++ R EYR S + K        
Sbjct: 378 LKEQDGEAVSRKNLTNETKTMIGYTLGGGIDF-AMTDNVLLRAEYRYSGFGKKKFAKEKL 436

Query: 190 -VEGFYNTISLGVGMKF 205
            V    N   +GV  KF
Sbjct: 437 EVNYKTNDFRIGVAYKF 453



 Score = 53.3 bits (126), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 23/138 (16%), Positives = 42/138 (30%), Gaps = 25/138 (18%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M    L + VS  AL S  +AQAAD           +               + G YAG+
Sbjct: 1   MNTKRL-ITVSIFALVSASAAQAADVGIPHQSAPTSL------PVIAAPAFTWTGFYAGI 53

Query: 61  SALYNGSFGEEA-----------------HHNAGGSIFAGYNVEDS-CIMYGVEGDVRYT 102
                 S  + +                        ++AG N++     ++ ++ D+ ++
Sbjct: 54  QIGGFSSKTDMSIVGKGKSVLLSKDLLPKLSGFESGLYAGSNIDLGDNFIFNIDTDLIWS 113

Query: 103 VPVLADNIHSLHGIGGSL 120
                  I        S+
Sbjct: 114 GQKYTKTIALGASDNVSV 131


>gi|254561199|ref|YP_003068294.1| outer membrane porin [Methylobacterium extorquens DM4]
 gi|254268477|emb|CAX24434.1| Putative outer membrane porin (OMPA-like) [Methylobacterium
           extorquens DM4]
          Length = 703

 Score = 68.3 bits (165), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 40/229 (17%), Positives = 68/229 (29%), Gaps = 41/229 (17%)

Query: 2   QKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLS 61
           ++  ++ G++++      +  AAD   RA           A  +        N  +   +
Sbjct: 11  KQGAVSAGLAAILGFHAGAGMAADLAERAGPRFIDWSGFYAGVQGSAGASFGNYDFGPTT 70

Query: 62  ALY------------NGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADN 109
                                     A G  FAG+N +D   +YGVE D+          
Sbjct: 71  IGSRRVRSISTGDATGSRDLGGDATTAVGGAFAGWNWQDGAFVYGVEADLVGANLKRGAR 130

Query: 110 IHS-----------------LHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYE----- 147
             +                    + G+ R R GY   ++ L+YAT G   A         
Sbjct: 131 SDATGFGYEGIDPPFALIREKTEVFGAARARLGYAFGNN-LIYATAGLTGANGRVLATYP 189

Query: 148 -----TGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVE 191
                           +G T G GV+   +   L   ++YR S   +  
Sbjct: 190 DLAGGPTVTATRNVSYLGFTLGAGVQF-AVDPHLSLGIDYRYSDLGESG 237


>gi|188584272|ref|YP_001927717.1| porin [Methylobacterium populi BJ001]
 gi|179347770|gb|ACB83182.1| porin [Methylobacterium populi BJ001]
          Length = 274

 Score = 68.3 bits (165), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 38/240 (15%), Positives = 69/240 (28%), Gaps = 54/240 (22%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYV---PIRHDFNGPY 57
           M+   + +G++   L+   +A AAD  RRA       +P  A           + +    
Sbjct: 1   MRNSLILIGLTGALLS--STALAADLPRRAEPPVFTPIPVFAWTGAYLGINAGYAYTESD 58

Query: 58  AGLSALYNGSFGEEAHH-----------NAGGSIFAGYNVEDS---CIMYGVEGDVRYTV 103
              +A          +                    GYN + +     ++G+E D +Y  
Sbjct: 59  TLRTAGIGALQANVTNDLRRAAVGLPQDGFTVGGQGGYNFQLTPGTGFVFGLEVDAQYMD 118

Query: 104 PVLADNIHS----------------LHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYE 147
              +                          G++R R GY   D +L+Y T G       +
Sbjct: 119 LQRSRTETIFRPAFNPNVLTNVYAADLDFLGTVRGRIGYAF-DRVLVYGTGGFAYGTVSQ 177

Query: 148 TGKA---------GEITPIAIGGTAGVGVEVGGLSES---------LVARLEYRASKYSK 189
                        G  + +  G   G G+E    ++S         +  + EY       
Sbjct: 178 GVTFQTGAPVTYAGARSGVETGYAYGGGIEYALPTDSFLNVFRSEAVTLKGEYLRYDLGS 237


>gi|75677151|ref|YP_319572.1| hypothetical protein Nwi_2970 [Nitrobacter winogradskyi Nb-255]
 gi|74422021|gb|ABA06220.1| conserved hypothetical protein [Nitrobacter winogradskyi Nb-255]
          Length = 276

 Score = 68.3 bits (165), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 53/287 (18%), Positives = 92/287 (32%), Gaps = 93/287 (32%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M++L LA    ++   +   A AAD             P+++T R V     + G Y G 
Sbjct: 1   MRRLLLA----AVICGAAHGAYAADMPDDFPFLRGSQPPSLSTVRTV-----WQGFYIGG 51

Query: 61  SALYNGSFGEEAHHN--------------------------------AGGSIFAGYNVED 88
            A Y  +  +  +                                  +G   F GYN++ 
Sbjct: 52  QASYGSADMDFKNSGKDLLERLLNHVDVESQFNLSSWPLGGTSSNRNSGFGGFLGYNLQM 111

Query: 89  SCIMYGVEGDVRYTVPVLA----------------------DNIHSLHGIGGSLRIRGGY 126
             +++GVE +  ++  + A                       N        GSLR+R GY
Sbjct: 112 EDVVFGVEANYTHSKFLGASSGSQGRSFSYPADYRTSAFVQSNASMQIMDFGSLRVRAGY 171

Query: 127 EVSDSLLLYATVGPDVAQKYE---------------------------TGKAGEITPIAI 159
            +  S L YA  G  + Q                              +           
Sbjct: 172 SLG-SFLPYAFGGVAMGQANIRRNASYNLHYQYVGTQIPPLPNLAGGGSLSDNANAHFIY 230

Query: 160 GGTAGVGVEVGGLSESLVARLEYRASKYS-KVEGFYNTISLGVGMKF 205
           G  AG+G+++  + + L  R E+   +++  V+   NT+  G G +F
Sbjct: 231 GYAAGLGIDM-MIVDGLFLRAEWEFLRFTAPVDTIVNTVRAGAGYRF 276


>gi|159185257|ref|NP_355480.2| outer membrane protein [Agrobacterium tumefaciens str. C58]
 gi|159140518|gb|AAK88265.2| outer membrane protein [Agrobacterium tumefaciens str. C58]
          Length = 209

 Score = 68.3 bits (165), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 33/171 (19%), Positives = 52/171 (30%), Gaps = 16/171 (9%)

Query: 49  IRHDFNGPYAGLSALYNGSFGE--EAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPV- 105
               ++G Y G              +     G + AGYN +    + G E +  Y     
Sbjct: 41  PAFSWSGAYVGAHGGVASPKFSPLASGRGLTGGVQAGYNFQFGSGVVGAEVEGSYLGNDA 100

Query: 106 LADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGV 165
              N        G+ +++ G  + D  LLY T G    +  +            G   G 
Sbjct: 101 RVPNGRLRERFRGAAKLKAGVAL-DHTLLYGTAGLTTTKFKDGNGVTGPDGWKQGYLVGA 159

Query: 166 GVEVGGLSESLVARLEYRASKYSKV-----------EGFYNTISLGVGMKF 205
           GVE       L A+ EY       V           +   + I  G+  +F
Sbjct: 160 GVEQSF-GGGLSAKFEYNYVSTGNVATTTSSGRSKTDVSDHVIKAGLNYRF 209


>gi|300025034|ref|YP_003757645.1| porin [Hyphomicrobium denitrificans ATCC 51888]
 gi|299526855|gb|ADJ25324.1| porin [Hyphomicrobium denitrificans ATCC 51888]
          Length = 231

 Score = 68.3 bits (165), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 44/225 (19%), Positives = 68/225 (30%), Gaps = 47/225 (20%)

Query: 26  PVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSFGEEAHHNA--------- 76
               A   G                 D+ G YAGL A Y+ S    +             
Sbjct: 9   LAFVAIAAGSASAVRAGEPHGPYGTFDWTGAYAGLQAGYSWSSARYSDDTYLSEANPEGF 68

Query: 77  GGSIFAGYNVEDS-CIMYGVEGDVRYTVPVLADNIHSLHG---------------IGGSL 120
            G  + GYN +    ++ G+E D+  +    +D    L                    ++
Sbjct: 69  IGGGYIGYNYQLPSRLVLGIEADIVGSGMDGSDGQRYLDDPSVSIAGVELEMETRWSAAV 128

Query: 121 RIRGGYEVSDSLLLYATVGPDVAQKYE-------TGKAGEITPIAIGGTAGVGVEVGGLS 173
           R R GY      L Y   G                    +      G   G GVE    +
Sbjct: 129 RGRIGYAYG-RYLPYIAGGVSFTDYEFRWIDHVNATVPFKREQSRTGWNIGTGVEYAA-N 186

Query: 174 ESLVARLEYRASKYS-------------KVEGFYNTISLGVGMKF 205
           + ++ R EYR + +              K+E   + + LGVG+KF
Sbjct: 187 DWVIVRAEYRYTDFGTDHFPNDFAGPYSKMELQTHDLRLGVGVKF 231


>gi|294011267|ref|YP_003544727.1| putative outer membrane protein [Sphingobium japonicum UT26S]
 gi|292674597|dbj|BAI96115.1| putative outer membrane protein [Sphingobium japonicum UT26S]
          Length = 217

 Score = 68.3 bits (165), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 44/232 (18%), Positives = 78/232 (33%), Gaps = 42/232 (18%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M K+  A  ++  A++S   AQ  +P                    V     ++   AG 
Sbjct: 1   MHKILAATLLTGAAVSSPALAQDVNPTFTGPR--------------VEAILGYDHTGAGS 46

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGSL 120
           S   +    +++       + AGY+V     + GVEG+   +      +  +     G +
Sbjct: 47  SVDNDNDRDDQSIDGLLYGVGAGYDVNLGSAVVGVEGEFTDSTAKSGRSDPTDQFGFGRV 106

Query: 121 R--------IRGGYEVSDSLLLYATVGPDVAQKYE----TGKAGEITPIAIGGTAGVGVE 168
           +         R G   S + L+Y   G    +       T    +      G   G GVE
Sbjct: 107 KQGRDLYVGARAGILASPNTLVYVKGGYTNTKLDVLAGNTNVETDTNFKLDGWRIGAGVE 166

Query: 169 VGGLSESLVARLEYRASKYSK---------------VEGFYNTISLGVGMKF 205
              ++ +  A+LEYR SKY                 ++   + I   +G +F
Sbjct: 167 -RAINANTFAKLEYRYSKYEDAHIDFADGTTTDEFGIDTDRHQIVASLGWRF 217


>gi|149190763|ref|ZP_01869029.1| outer membrane protein OmpA [Vibrio shilonii AK1]
 gi|148835419|gb|EDL52390.1| outer membrane protein OmpA [Vibrio shilonii AK1]
          Length = 338

 Score = 68.3 bits (165), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 28/184 (15%), Positives = 50/184 (27%), Gaps = 22/184 (11%)

Query: 35  RGVVPTIATNRYVPIRHDFNGPYAGLSALYNG-------SFGEEAHHNAGGSIFAGYNVE 87
             V  +I            +G Y G     +        S            ++ GY+  
Sbjct: 4   TVVAASIIGTMMALPVVADDGFYLGGRLGGSQLSDACNVSAAPCTDSGFSAGVYTGYDWN 63

Query: 88  DSCIMYGVEGDVRYTVPVLADNIHSLHGIG---GSLRIRGGYEVSDSLLLYATVGPDVAQ 144
           D   +      +        D             +L  +  Y  +D   ++  VG     
Sbjct: 64  DYIALEFAYDWLGSYETSFVDGAEYRRDANLSALTLAPKFSYPFNDEWAIFGKVGAAYT- 122

Query: 145 KYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVE---GFYNTISLGV 201
                        +     GVG+E    + +   RLEY+    +K +      +T  LG+
Sbjct: 123 -------MYDDRKSTALMGGVGLEYDFAT-AWSGRLEYQRINDAKDDWFNTDVDTFWLGI 174

Query: 202 GMKF 205
              F
Sbjct: 175 SYSF 178


>gi|146278175|ref|YP_001168334.1| hypothetical protein Rsph17025_2139 [Rhodobacter sphaeroides ATCC
           17025]
 gi|145556416|gb|ABP71029.1| hypothetical protein Rsph17025_2139 [Rhodobacter sphaeroides ATCC
           17025]
          Length = 197

 Score = 68.3 bits (165), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 38/194 (19%), Positives = 64/194 (32%), Gaps = 20/194 (10%)

Query: 20  SAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSFGEEAH---HNA 76
            A A  P+  A      +V  +     V    D++G Y G    Y     E +    + A
Sbjct: 16  PAFAGGPITVAPEP---IVEPMPAPVVVAPVTDWSGFYVGGQLGYGDVGTEISGLDGNGA 72

Query: 77  GGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGSLRIRGGYEVSDSLLLYA 136
            G + AGY  +    + G E     T         +      +L++  G ++   LL YA
Sbjct: 73  IGGVHAGYRYDFGRAVVGAEIAYDMTNI--DIGDSAELDNVATLKLMAGGKIGRGLL-YA 129

Query: 137 TVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSK-----VE 191
           T G   A         +      G   G+G +   L++      E    ++        +
Sbjct: 130 TAGGTWADVTSDAGDPDD-----GYVYGIGYDY-MLNDRWSVGAELLRHEWDTFDDAGTD 183

Query: 192 GFYNTISLGVGMKF 205
               T+   VG +F
Sbjct: 184 ADATTLQAKVGFRF 197


>gi|156739524|gb|ABU93422.1| Omp25 [Brucella neotomae]
          Length = 128

 Score = 67.9 bits (164), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 38/129 (29%), Positives = 60/129 (46%), Gaps = 9/129 (6%)

Query: 55  GPYAGLSALYNGSF------GEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLA- 107
           G Y GL   Y  +       G     +     FAG+N +   I+YGVEGD  Y+    + 
Sbjct: 1   GGYTGLYLGYGWNKAKTSTVGSIKPDDWKAGAFAGWNFQQDQIVYGVEGDAGYSWAKKSK 60

Query: 108 DNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGV 167
           D +    G  GSLR R GY+++  ++ Y T G   +Q        + +   +G TAG G+
Sbjct: 61  DGLEVKQGFEGSLRARVGYDLN-LVMPYLTAGIAGSQIKLNNGLDDESKFRVGWTAGAGL 119

Query: 168 EVGGLSESL 176
           E   L++++
Sbjct: 120 E-AKLTDNI 127


>gi|148253080|ref|YP_001237665.1| putative outer-membrane protein [Bradyrhizobium sp. BTAi1]
 gi|146405253|gb|ABQ33759.1| putative outer-membrane protein [Bradyrhizobium sp. BTAi1]
          Length = 258

 Score = 67.9 bits (164), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 33/219 (15%), Positives = 64/219 (29%), Gaps = 42/219 (19%)

Query: 18  FCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNG----------- 66
              +  AD   R ++      P           +D++G Y G++                
Sbjct: 14  ASPSFGADQTERVYYNYSRPKPVF------EPNYDWSGFYVGVNVGGGKAHACWDDAFSF 67

Query: 67  --------SFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLAD--------NI 110
                   S G  +   A     AGY  + +  + GVE    +     ++          
Sbjct: 68  GVLNSPAISEGCHSTSGAIAGGQAGYRWQSAFAVLGVEAQGDWANLRGSNISQLDPTLTN 127

Query: 111 HSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETG-------KAGEITPIAIGGTA 163
            ++    G    + G    + +L Y   G  +      G            +    GGT 
Sbjct: 128 RTITDAIGLFTGQAGAAWQN-VLWYIKGGAAITNDKYDGLITGTSVLNDRASGTRWGGTI 186

Query: 164 GVGVEVGGLSESLVARLEYRASKYSKVEGFYNTISLGVG 202
           G G+E+G  + +    +EY           + +++  V 
Sbjct: 187 GTGIEIGF-APNWSVGIEYDHLFIPSRSISFTSLNAAVA 224


>gi|323136250|ref|ZP_08071332.1| outer membrane protein Omp31 precursor [Methylocystis sp. ATCC
           49242]
 gi|322398324|gb|EFY00844.1| outer membrane protein Omp31 precursor [Methylocystis sp. ATCC
           49242]
          Length = 226

 Score = 67.9 bits (164), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 44/223 (19%), Positives = 71/223 (31%), Gaps = 27/223 (12%)

Query: 8   VGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGS 67
             + +  + +   + +AD  R A       V       +       +G YA  S   + +
Sbjct: 6   AALLAPFVLAAGPSLSADLPRGAAPPPGDYVAPPPAFVWSGFYVGVHGGYAFSSFEDDAN 65

Query: 68  FGEEAHHNAGGSIFAGYNVED-SCIMYGVEGDVRYTVPVLADN------IHSLHGIGGSL 120
                       +  GYN       + GVE D  +T    ++                +L
Sbjct: 66  TLIGGADGGLIGVTGGYNYMVTPQFLLGVEADFAFTGVSKSNAPFFGVIARGEVDDMFTL 125

Query: 121 RIRGGYEVSDSLLLYATVGPDVAQKYE------TGKAGEITPIAIGGTAGVGVEVGGLSE 174
           R R GY + D  LLY T G   ++         TG  G       G   G GVE   ++ 
Sbjct: 126 RGRAGYSI-DRALLYVTGGFAASKNAIGLTTPFTGFYGYQATFQPGWALGAGVEY-MITS 183

Query: 175 SLVARLEYRASKYSKVEGFY------------NTISLGVGMKF 205
           +L A+ EY  +       F             ++I  G+   F
Sbjct: 184 NLSAKGEYIFTSTGSDSYFDFSPNALTSAVNTSSIKGGLNFHF 226


>gi|149914031|ref|ZP_01902563.1| hypothetical protein RAZWK3B_18548 [Roseobacter sp. AzwK-3b]
 gi|149812315|gb|EDM72146.1| hypothetical protein RAZWK3B_18548 [Roseobacter sp. AzwK-3b]
          Length = 189

 Score = 67.9 bits (164), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 33/181 (18%), Positives = 58/181 (32%), Gaps = 13/181 (7%)

Query: 15  LASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSFGE---E 71
           +A+   A        A       V +       P   D+ GPY G    +          
Sbjct: 1   MAALALATGPALAGSATPPEPDPVISTPAPPPAPSSPDWTGPYVGGQIGWGNVDTNLPGV 60

Query: 72  AHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGSLRIRGGYEVSDS 131
           +  +  G + AGY+ +    + G   D  +    L     +L  +   ++ RGGY++ + 
Sbjct: 61  SGDDVIGGLIAGYDYDFGQWVVGGGLDYDWADIGLGAGNPTLENVF-RVKARGGYKIGNG 119

Query: 132 LLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVE 191
           LL Y T G   A                G   G G E   ++ ++    E    ++    
Sbjct: 120 LL-YGTGGWAQADTST-------LGDDDGYFIGAGYE-HMVTPNVSLGGEVLYHEFDNFN 170

Query: 192 G 192
            
Sbjct: 171 S 171


>gi|323139111|ref|ZP_08074169.1| hypothetical protein Met49242DRAFT_3557 [Methylocystis sp. ATCC
           49242]
 gi|322395675|gb|EFX98218.1| hypothetical protein Met49242DRAFT_3557 [Methylocystis sp. ATCC
           49242]
          Length = 837

 Score = 67.9 bits (164), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 26/192 (13%), Positives = 52/192 (27%), Gaps = 16/192 (8%)

Query: 16  ASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSFGEEAHHN 75
               S+ A++            +P   +   +   +   G   GL    N +F       
Sbjct: 603 GGAWSSPASNVQVVGVGPAPASLPVAFSAAPIDTGNHLAGFIGGLQLGANWNFSGNFLAG 662

Query: 76  AGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGSLRIRGGYEVSDSLLLY 135
               +  G +            +      +  +   +     G++R R GY  + +L++Y
Sbjct: 663 VETDLH-GVSGNTDTKWQLTSANGGGDTFLTYEQRTATLNYLGTVRGRLGYLATPTLVVY 721

Query: 136 ATVGPDVAQKYETGKAGE--------------ITPIAIGGTAGVGVEVGGLSESLVARLE 181
            T G                                 +G +AG GVE      +  A+++
Sbjct: 722 GTGGMAYGGVVSNTAIFTRRIGGTSQTQVNPVFQDTLVGWSAGGGVE-WMFLPNWSAKVD 780

Query: 182 YRASKYSKVEGF 193
           Y           
Sbjct: 781 YLHYDLGNARAS 792


>gi|92117214|ref|YP_576943.1| OmpA-like transmembrane region [Nitrobacter hamburgensis X14]
 gi|91800108|gb|ABE62483.1| OmpA-like transmembrane region [Nitrobacter hamburgensis X14]
          Length = 238

 Score = 67.9 bits (164), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 30/204 (14%), Positives = 55/204 (26%), Gaps = 36/204 (17%)

Query: 36  GVVPTIATNRYVPIRHDFNGPYAGLSALYNG---SFGEEAHHNAGGSIFAGYNVED-SCI 91
                          +++ G Y G          S    +     G +  G + +  +  
Sbjct: 27  PYTKAPPPYTPPQAVYNWTGFYIGGHLGGAFGGDSSLSGSDGRFLGGVQGGADYQFANNW 86

Query: 92  MYGVEGDVRYTVPV-------LADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQ 144
           + G E    +             + +       GS+  R GY    +LL YA  G     
Sbjct: 87  VLGAEAQYSWLTNNNGGAVFPGGNIVTGNDRGLGSVTGRLGYAWGPTLL-YAKGGYAFRD 145

Query: 145 KYETGK--------AGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKV------ 190
                                  G T G G+E    + +  A++EY+   + K       
Sbjct: 146 SRLGVTDAAGVPLAFATTGNRDNGYTVGAGLEY-MFAPNWSAKVEYQYYNFGKTTFAAGS 204

Query: 191 ---------EGFYNTISLGVGMKF 205
                        +T+  G+  +F
Sbjct: 205 PTDIVGTSFRNDDHTVKAGLNYRF 228


>gi|148255738|ref|YP_001240323.1| putative outer-membrane protein [Bradyrhizobium sp. BTAi1]
 gi|146407911|gb|ABQ36417.1| putative outer-membrane protein [Bradyrhizobium sp. BTAi1]
          Length = 260

 Score = 67.9 bits (164), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 39/233 (16%), Positives = 60/233 (25%), Gaps = 51/233 (21%)

Query: 3   KLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSA 62
           K  L V     AL              A               YV     + G Y G + 
Sbjct: 2   KSTLFVTAGVAALGLA--------PASAADFAARPYGKAPPPAYVTPLPSWAGFYLGANG 53

Query: 63  LYNGSFGEEAHHNAGG-------------------SIFAGYNVEDSCIMYGVEGDVRYTV 103
             + S      +   G                       GY  + +  ++G+E    +T 
Sbjct: 54  GADWSRNCWTLNRVNGVPVVPTQSEGCHNATSGLIGGQIGYRWQAASWVFGLEAQGNWTD 113

Query: 104 PV----------LADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKA-- 151
                            ++     G    + GY   + +L Y   G  VA    TG A  
Sbjct: 114 LKSSNASSAAFAAGITNNTKTDAIGLFTGQIGYAWGN-VLWYVKGGAAVAHNKYTGTANA 172

Query: 152 ----------GEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFY 194
                        +    GGT G GVE G  + +    +EY        +  +
Sbjct: 173 AAPVAVGTLLDSASETRWGGTVGTGVEFGF-APNWSVAVEYDHLFMGSRDITF 224


>gi|85374383|ref|YP_458445.1| outer membrane protein-like [Erythrobacter litoralis HTCC2594]
 gi|84787466|gb|ABC63648.1| outer membrane protein-like [Erythrobacter litoralis HTCC2594]
          Length = 223

 Score = 67.9 bits (164), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 38/234 (16%), Positives = 75/234 (32%), Gaps = 40/234 (17%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M K  +A+ ++  A+A+   A A      +   G  V      +         +      
Sbjct: 1   MNK-AVALILAGTAMATASPALAQTVQNDSPFTGARVQAVTGYDNIKAGSSVDDDGNPNN 59

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNI---------H 111
                    +++          GY+V+   ++ G E +  ++      +          +
Sbjct: 60  ---------DQSAEGVIYGAAVGYDVDLGPVVIGPEAEFAWSTADTDFDNGDFEGFGFGN 110

Query: 112 SLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAG----EITPIAIGGTAGVGV 167
                   L  R G ++ D  L Y   G   A+       G    +      G   G G+
Sbjct: 111 VSADRDLYLGARVGAKIGDQALAYVKGGYTNAKLNIRSNDGTTKFDTDYDLDGYRVGGGL 170

Query: 168 EVGGLSESLVARLEYRASKYS----------------KVEGFYNTISLGVGMKF 205
           E   ++ ++    EYR S YS                 V+   + +S+G+G++F
Sbjct: 171 EY-AINRNMFVNAEYRYSNYSRAEVDFDGTLPDSDRFDVDLDRHQVSVGLGVRF 223


>gi|107027296|ref|YP_624807.1| porin, opacity type [Burkholderia cenocepacia AU 1054]
 gi|116691307|ref|YP_836840.1| porin, opacity type [Burkholderia cenocepacia HI2424]
 gi|105896670|gb|ABF79834.1| porin, opacity type [Burkholderia cenocepacia AU 1054]
 gi|116649307|gb|ABK09947.1| porin, opacity type [Burkholderia cenocepacia HI2424]
          Length = 236

 Score = 67.9 bits (164), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 37/211 (17%), Positives = 62/211 (29%), Gaps = 15/211 (7%)

Query: 8   VGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGS 67
               SLAL    +A A                  AT R +    +          + +  
Sbjct: 6   ALPLSLALLFSGAAFADTVAPETKKQDPSDAGYYATARVIGAFDNAVNMELTSPRVTSRI 65

Query: 68  FGEEAHHNAGGSIFAGYNVEDSC-----IMYGVEGDVRYTVPVLADNIHSLHGIGGSLR- 121
            G +      GS+  GY   +        ++   G+          N +  H     L  
Sbjct: 66  GGPDGQDRVTGSVAGGYQFGNGWRAEGEYVFKRSGNFVSYWAPFDANANEFHVSSQRLML 125

Query: 122 -IRGGYEVSDSLLLYATVGPDVAQKYETGKAGEI-------TPIAIGGTAGVGVEVGGLS 173
                +++     +Y T+G  VA     G  G         T   +  +AG GV    ++
Sbjct: 126 NGYRDFDLGRGFSVYGTLGVGVAIVSAEGWQGNDTRRFASKTQTNLAYSAGAGVSY-AIN 184

Query: 174 ESLVARLEYRASKYSKVEGFYNTISLGVGMK 204
           +     + YR      VE  +NT    V  +
Sbjct: 185 KRFTIDVGYRYVDMGNVETGFNTFVNRVSAR 215


>gi|27379465|ref|NP_770994.1| hypothetical protein bll4354 [Bradyrhizobium japonicum USDA 110]
 gi|27352617|dbj|BAC49619.1| bll4354 [Bradyrhizobium japonicum USDA 110]
          Length = 279

 Score = 67.9 bits (164), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 40/217 (18%), Positives = 71/217 (32%), Gaps = 32/217 (14%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K+ LA+   +   A   SA AAD   R +       P      +        G     
Sbjct: 20  MKKILLALTAVA---AMTGSASAADLAARPYVKAPMAAPVANWTGFYIFGGGGGGLSNAD 76

Query: 61  SALYNGSFG-------EEAHHNAGGSIFAGYNVED-SCIMYGVEGDVRYT-------VPV 105
            ++ +   G        +      G++  GY+ +     + GV  D ++         P+
Sbjct: 77  QSVVDTVTGTPLTITQRQGGSGWFGTVGLGYDWQFSGTWVAGVFADGQFGSIRATIQDPI 136

Query: 106 LADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAG---------EITP 156
                +       +  +R G+ V+ ++L Y   G   A   +T               + 
Sbjct: 137 FGITGNQKLEDSWAAGVRLGWLVAPNVLSYVNGGYSGAHFGQTNFTDLAGVPVGAHLASY 196

Query: 157 IAIGGTAGVGVE-----VGGLSESLVARLEYRASKYS 188
              G   G GVE      G  S     + EYR++ Y+
Sbjct: 197 NRNGWFIGGGVENSLNIFGITSPGWFMKTEYRSAFYN 233


>gi|296447763|ref|ZP_06889678.1| Carbohydrate-selective porin OprB [Methylosinus trichosporium OB3b]
 gi|296254740|gb|EFH01852.1| Carbohydrate-selective porin OprB [Methylosinus trichosporium OB3b]
          Length = 723

 Score = 67.9 bits (164), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 37/254 (14%), Positives = 61/254 (24%), Gaps = 56/254 (22%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+    A     LA ++   A        A                       +G     
Sbjct: 1   MRLHLFATLPPLLAASAGACA------EPAPPPIFSWAGLHLGVDAGVGLPVASGGRVEA 54

Query: 61  SAL-----YNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLAD------- 108
           +A      +                  GY+ +    +YG+E ++ +      D       
Sbjct: 55  AAGLSPTAHALIAPGRDRAGVSFGARIGYDWQKGPWVYGLESELNFLDLRRGDDGVFAGF 114

Query: 109 ----------NIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYET---------- 148
                               S+R R GY    +L+  A        +  +          
Sbjct: 115 GALGAATRRLTTQENGQYVASVRGRLGYAFGRTLVYAAAGVAAGGWRGASLLTVTPGVAG 174

Query: 149 -GKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRAS----------KYSKVEGFY--- 194
              A       +    G GVE   L +   ARLEY              YS         
Sbjct: 175 PFFAPVSDSSRMKFVIGAGVEQ-ALFDRWSARLEYTYVNQQLQIRHFDDYSSSAFDVRQR 233

Query: 195 ---NTISLGVGMKF 205
              + + LG+  +F
Sbjct: 234 SEAHLLRLGLDYRF 247


>gi|240138602|ref|YP_002963074.1| putative outer membrane porin (OMPA-like) [Methylobacterium
           extorquens AM1]
 gi|240008571|gb|ACS39797.1| Putative outer membrane porin (OMPA-like) [Methylobacterium
           extorquens AM1]
          Length = 703

 Score = 67.9 bits (164), Expect = 9e-10,   Method: Composition-based stats.
 Identities = 40/229 (17%), Positives = 67/229 (29%), Gaps = 41/229 (17%)

Query: 2   QKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLS 61
           ++  ++ G++ +      S  AAD   RA           A  +        N      +
Sbjct: 11  KQRAVSAGLAVILGVHAGSVIAADLGERARPRFIDWSGFYAGVQGSAGASFGNYDLGPTT 70

Query: 62  ALY------------NGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADN 109
                                     A G  FAG+N +D  ++YG+E D+          
Sbjct: 71  IGPRRVRSISTGDATGSRDLGGDATTAVGGAFAGWNWQDGALVYGIEADLVGANLKRGAR 130

Query: 110 IHS-----------------LHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYE----- 147
             +                    + G+ R R GY   ++ L+YAT G   A         
Sbjct: 131 SDAMGFGYEGIDPPFALIREKTDVFGAARARLGYAFGNN-LIYATAGLTGANGRVLATYP 189

Query: 148 -----TGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVE 191
                           +G T G GV+   +   L   ++YR S   +  
Sbjct: 190 DLAGGPTVTATRNVSYLGFTLGAGVQF-AVDPHLSLGIDYRYSDLGESG 237


>gi|290473839|ref|YP_003466713.1| outer membrane protein 3a (II*;G;d) [Xenorhabdus bovienii SS-2004]
 gi|289173146|emb|CBJ79919.1| outer membrane protein 3a (II*;G;d) [Xenorhabdus bovienii SS-2004]
          Length = 373

 Score = 67.5 bits (163), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 29/191 (15%), Positives = 55/191 (28%), Gaps = 26/191 (13%)

Query: 40  TIATNRYVPIRHDFNGPYAGLSALYNG----SFGEEAHHNAGGSIFAGYNVEDSCIMYGV 95
                 Y   +  ++  +               G    +  G   + GY           
Sbjct: 23  PKDNTWYTGAKLGWSQYHDVNFYGNGYDNQIGNGPTRKNQLGAGAYVGYQANPYLGFELG 82

Query: 96  EGDVRYTVPVLADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAG--- 152
              +       + N  +    G  L  +  Y V D+L +Y  +G  V +   +       
Sbjct: 83  YDWLGRMAYKGSVNNGAFRAQGVQLAAKLSYPVMDNLDVYTRLGGMVWRADSSATYNANA 142

Query: 153 ------------EITPIAIGGTAGVGVEVGGLSESLVARLEYRAS----KYSKVEGFYNT 196
                       +     +   A +GVE   L++ L  RL+Y+          V    + 
Sbjct: 143 LGGAGDKDQRRLKNNDTGVSPLAAIGVEY-ALTKDLATRLDYQWVNNIGDAGSVGARPDN 201

Query: 197 --ISLGVGMKF 205
             +S+GV  +F
Sbjct: 202 GMLSVGVSYRF 212


>gi|90414007|ref|ZP_01221991.1| hypothetical outer membrane protein OmpA [Photobacterium profundum
           3TCK]
 gi|90324929|gb|EAS41450.1| hypothetical outer membrane protein OmpA [Photobacterium profundum
           3TCK]
          Length = 327

 Score = 67.5 bits (163), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 32/155 (20%), Positives = 51/155 (32%), Gaps = 9/155 (5%)

Query: 43  TNRYVPIRHDFNGPYAGLSALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYT 102
              Y   R                        + GG +F GYN+     + G    +   
Sbjct: 24  NPWYAGARVGGTSYSDFSGLGPAQ----IDKEDWGGGVFLGYNIVPWFAVEGGYTYLGEA 79

Query: 103 VPVLADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGT 162
                +      GI   L  +  + V++S+ L+A  G        +G         IG T
Sbjct: 80  DIKGTNTSIEQQGID--LVGKFTWNVTNSIDLFAKAGGFYYFADSSGPIDVSDDGIIG-T 136

Query: 163 AGVGVEVGGLSESLVARLEYR-ASKYSKVEGFYNT 196
           AGVG E    +++L ARLEY+        +   + 
Sbjct: 137 AGVGAEY-FFNKNLSARLEYQYYHDVELKDSGIDA 170


>gi|154246409|ref|YP_001417367.1| porin [Xanthobacter autotrophicus Py2]
 gi|154160494|gb|ABS67710.1| porin [Xanthobacter autotrophicus Py2]
          Length = 248

 Score = 67.5 bits (163), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 45/253 (17%), Positives = 76/253 (30%), Gaps = 53/253 (20%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M++L LA   +    A    A AAD   +       VVP  +   +    +   G     
Sbjct: 1   MKRLLLA---TVAFAALSAPAMAADLATKYPVKAVAVVPVFSWTGFYIGANVGYGGDKFT 57

Query: 61  --------SALYNGSFGEEAHHNAGGSIFAGYNVED-SCIMYGVEGDVRYTVPVL----- 106
                      Y  +               GYN +  + ++ GVE D++++         
Sbjct: 58  FDEVESYYGYPYYANSTSLNSSGFFAGGQIGYNYQFANNVVLGVETDLQWSGIEGKEDYS 117

Query: 107 ----------ADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEI-- 154
                       +  +     G++R R GY   D  L Y T G    +   +        
Sbjct: 118 SVYVYGGYPYTSSYGASVDYFGTIRARIGYAF-DRFLPYITGGAAYGKTKISSSYAGDGF 176

Query: 155 -----TPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSK-----------------VEG 192
                +    G T G GVE   ++ +   + EY                        V+ 
Sbjct: 177 GSLSASATNWGWTVGGGVEY-AITNNWTFKTEYLYVDLGSTDYAYADGYGYYSYAGTVDT 235

Query: 193 FYNTISLGVGMKF 205
            ++T+  GV  KF
Sbjct: 236 KFHTLKAGVNYKF 248


>gi|312115943|ref|YP_004013539.1| porin [Rhodomicrobium vannielii ATCC 17100]
 gi|311221072|gb|ADP72440.1| porin [Rhodomicrobium vannielii ATCC 17100]
          Length = 291

 Score = 67.5 bits (163), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 49/285 (17%), Positives = 73/285 (25%), Gaps = 90/285 (31%)

Query: 3   KLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSA 62
           ++  A  +++   A   SA AAD      +GG    P I           + G Y G   
Sbjct: 4   RVVRASALAAGVFAIIGSASAADIYGGGGYGGYKDAPIIVAAPA------WTGFYVGGHL 57

Query: 63  LYNG------------------------------SFGEEAHHNAGGSIFAGYNVEDS-CI 91
                                                      A G    GYN +     
Sbjct: 58  GAAWTNLETRRNTYWDRDPLPTGVAAAPYDYSTFGGNGLGTTGAFGGGQFGYNWQTGGNF 117

Query: 92  MYGVEGDVRYTVPVLAD---------------------NIHSLHGIGGSLRIRGGYEVSD 130
           + G+E DV                              N+ S  GI G +  R GY   +
Sbjct: 118 VLGIEVDVGGLQGDNERTFAAATYDGPALDAIDHIAVVNVKSQGGIYGDVTGRLGYAWGN 177

Query: 131 SLLLYATVGPDVA-------------QKYETGKAGEITPIAIGGTAGVGVEVGGLSESLV 177
           +LL Y   G                                 G TAG G+E    + +  
Sbjct: 178 TLL-YLKGGFAWLATDLKVRAAITDIDGETDYYNRSFDNTLTGWTAGGGLEY-QFNPNWT 235

Query: 178 ARLEYRASKYS-----------------KVEGFYNTISLGVGMKF 205
            ++EY    +S                 K +   +T+ LG   +F
Sbjct: 236 MKVEYLHFDFSLDDNNWRWDEGNNWKIFKNDVTADTVKLGFNYRF 280


>gi|85715495|ref|ZP_01046476.1| putative outer-membrane protein precursor [Nitrobacter sp. Nb-311A]
 gi|85697690|gb|EAQ35566.1| putative outer-membrane protein precursor [Nitrobacter sp. Nb-311A]
          Length = 257

 Score = 67.5 bits (163), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 35/215 (16%), Positives = 55/215 (25%), Gaps = 36/215 (16%)

Query: 14  ALASFCSAQAADP--VRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSF--- 68
            L     A A                  T A    +   +D++G Y G +  +  S    
Sbjct: 4   LLIGAVGALAIGLGAAPATAADLAPRTYTKAPPPMMAAIYDWSGFYIGANGGWGSSRNCW 63

Query: 69  -------------GEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLAD------- 108
                        G             GY  + +  ++G+E    +              
Sbjct: 64  NFTTPAGAFVANEGCHDATGGTAGGQIGYRWQSTNWVFGLEAQGNWADLSGRRASLAFPA 123

Query: 109 -NIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETG--------KAGEITPIAI 159
               S  G  G    + GY   D+ LLY   G  V                  ++     
Sbjct: 124 FTNDSHLGAFGLFTGQIGYAW-DATLLYVKGGAAVTSNRYRSLATLTGAQVTNDVNNSRW 182

Query: 160 GGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFY 194
           G T GVG+E G  + +     EY           +
Sbjct: 183 GATVGVGLEYGF-APNWSLAFEYDHIFMGNSRTTF 216


>gi|254249287|ref|ZP_04942607.1| Opacity protein [Burkholderia cenocepacia PC184]
 gi|124875788|gb|EAY65778.1| Opacity protein [Burkholderia cenocepacia PC184]
          Length = 254

 Score = 67.5 bits (163), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 37/218 (16%), Positives = 63/218 (28%), Gaps = 15/218 (6%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M K F      +L  +    A              G     AT R +    +        
Sbjct: 17  MIKRFALPSTLALLFSGAAFADTVAVPETKKTAELGDAGYYATGRIIGAFDNAVNMELTS 76

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSC-----IMYGVEGDVRYTVPVLADNIHSLH- 114
             + +   G +   N  GS+  GY   +        ++    +          N +  H 
Sbjct: 77  PRVASRVGGPDTGSNVTGSLGLGYQFGNGWRAEGEYVFKRTNNFTSYWAPFDANANEFHV 136

Query: 115 -GIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEIT-------PIAIGGTAGVG 166
                 L     +++     +Y T+G  VA     G     T          +  +AG G
Sbjct: 137 SAQRLMLNGYKDFDLGRGFSVYGTLGIGVAIVSADGWQTNDTRRFASKTQTNLAYSAGAG 196

Query: 167 VEVGGLSESLVARLEYRASKYSKVEGFYNTISLGVGMK 204
           V    +++     L YR      VE  +NT +  V  +
Sbjct: 197 VSY-AINKRFSIDLGYRYVDMGNVETGFNTFANRVNAR 233


>gi|212709831|ref|ZP_03317959.1| hypothetical protein PROVALCAL_00879 [Providencia alcalifaciens DSM
           30120]
 gi|212687642|gb|EEB47170.1| hypothetical protein PROVALCAL_00879 [Providencia alcalifaciens DSM
           30120]
          Length = 357

 Score = 67.5 bits (163), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 28/182 (15%), Positives = 59/182 (32%), Gaps = 20/182 (10%)

Query: 40  TIATNRYVPIRHDFN-------GPYAGLSALYNGSFGEEAHHNAGGSIFAGYNVEDSCIM 92
                 Y   +  ++                 +   G++     G  ++AGY        
Sbjct: 23  PKDNTWYTGGKLGWSHYEHAKFTFEDAAGDETSVGTGKKTRDQLGAGLYAGYQY---NQY 79

Query: 93  YGVEGDVRYTVPVLADNIHSLHGIGG--SLRIRGGYEVSDSLLLYATVGPDVAQKYET-G 149
            G E    +   +     ++        SL  +  Y V + L +Y  +G  V +      
Sbjct: 80  MGFEMGYDWFGKMKYKGDNAGSVSSMGVSLTTKLSYPVMEDLDVYTRLGGMVYRTEAKVN 139

Query: 150 KAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRA-SKYSKVEG-----FYNTISLGVGM 203
             G+ T   +     +G+E   ++  L  RL+Y+  S+    +          +S+G+  
Sbjct: 140 GVGKETDTGVSPVYALGLEY-AITPELATRLDYQWVSRMGDKDNIGVSPDNGMLSVGLAY 198

Query: 204 KF 205
           +F
Sbjct: 199 RF 200


>gi|149190419|ref|ZP_01868691.1| outer membrane protein A [Vibrio shilonii AK1]
 gi|148835798|gb|EDL52763.1| outer membrane protein A [Vibrio shilonii AK1]
          Length = 343

 Score = 67.5 bits (163), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 31/146 (21%), Positives = 50/146 (34%), Gaps = 13/146 (8%)

Query: 70  EEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYT------VPVLADNIHSLHGIGGSLRIR 123
           +    +     F GY V     +     D             +     S+ GI  S+  R
Sbjct: 57  DCDGTDVALGGFIGYQVWQHWGLELGYLDFGEAKALYPEGGRVNQYSGSMSGIEMSVVGR 116

Query: 124 GGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYR 183
               V+D+L  +A  G    Q   +G    +T      TAGVG+E    S     R+EY+
Sbjct: 117 I--SVTDNLDAFAKAGTLYWQGKNSGPTRSLTDDGWAPTAGVGLEYHF-SNHWAGRVEYQ 173

Query: 184 ASKYSKVE----GFYNTISLGVGMKF 205
                  +       +  +LG+  +F
Sbjct: 174 YVNALGSDKLGGSNGHLATLGIVYRF 199


>gi|254470977|ref|ZP_05084380.1| outer membrane protein, hypothetical [Pseudovibrio sp. JE062]
 gi|211960119|gb|EEA95316.1| outer membrane protein, hypothetical [Pseudovibrio sp. JE062]
          Length = 228

 Score = 67.1 bits (162), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 43/230 (18%), Positives = 77/230 (33%), Gaps = 27/230 (11%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAA--DPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYA 58
           M +L +        L     + A    P              +      P  +D++G Y 
Sbjct: 1   MSRLRVFAFAVLGLLGFSSHSYAVEYPPGVEVEEPYEVYEEEVVDGLITPPEYDWDGFYL 60

Query: 59  GLSALYN-------GSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRY--TVPVLADN 109
           G+   +         +     ++     ++ GYN     I+ GVEG+  Y          
Sbjct: 61  GVQGGWARLHGTNRFNNSGSQYNGGTVGLYGGYNYTYQNILIGVEGEGAYWAFGERSRGE 120

Query: 110 IHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGK---AGEITPIAIGGTAGVG 166
           +        + +IR G    D  + Y T G  V+    +      G  +   +G   G G
Sbjct: 121 MSLRSDYFAAAKIRAGLTY-DWFMAYVTGGAAVSTFRASNPNFGPGTDSNTMLGWVGGAG 179

Query: 167 VEVGGLSESLVARLEYRASKYS-----------KVEGFYNTISLGVGMKF 205
           +E+  ++E ++ RL+Y    +            K +   + I LGV  KF
Sbjct: 180 LEM-FVTERIIVRLDYERIVFPGRSFTVGGTRFKEDIDSDAIRLGVSYKF 228


>gi|145297230|ref|YP_001140071.1| outer membrane protein A [Aeromonas salmonicida subsp. salmonicida
           A449]
 gi|142850002|gb|ABO88323.1| outer membrane protein A [Aeromonas salmonicida subsp. salmonicida
           A449]
          Length = 368

 Score = 67.1 bits (162), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 40/234 (17%), Positives = 67/234 (28%), Gaps = 50/234 (21%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M K  LA  VS L       A A D                    Y   +  ++  +   
Sbjct: 1   MNKSILAALVSGLLATGAVQAAAQD-----------------NTWYAGGKAGWSKYFDVD 43

Query: 61  S------ALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLH 114
                   L        +    G   FAGY +  +    G E    +     +    S  
Sbjct: 44  QKQVVSDTLGALQNTGTSKDALGLGAFAGYQLNPN---LGFEFGYDWLGKYTSSGELSGV 100

Query: 115 GIGGSLR-------IRGGYEVSDSLLLYAT--VGPDVAQKYETGKAGEI------TPIAI 159
            + G  +       ++ G+ V+D+L LY     G        + +               
Sbjct: 101 RVEGEAKSQMIQATMKIGFPVNDALDLYGRIGGGYAWTDSELSARTATDFIKETGDKHGA 160

Query: 160 GGTAGVGVEVGGLSESLVARLEYRAS--------KYSKVEGFYNTISLGVGMKF 205
                +G E   +     ARLEY+ +          S +E     +S+G+  +F
Sbjct: 161 VFVGALGAEY-AIDRDWAARLEYQYTTPLGDASLDRSGIEMDNGLLSVGMLYRF 213


>gi|319783284|ref|YP_004142760.1| OmpA-like transmembrane domain-containing protein [Mesorhizobium
           ciceri biovar biserrulae WSM1271]
 gi|317169172|gb|ADV12710.1| OmpA-like transmembrane domain-containing protein [Mesorhizobium
           ciceri biovar biserrulae WSM1271]
          Length = 217

 Score = 67.1 bits (162), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 47/221 (21%), Positives = 79/221 (35%), Gaps = 28/221 (12%)

Query: 7   AVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNG 66
           A  ++S    S   A AAD                    +     +    Y         
Sbjct: 3   AFLLASFVALSAAPAMAADMTIAPVDTPEWTWQGPYAGVFGAGTLEHYKIYGPG----AQ 58

Query: 67  SFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRY-------TVPVLADNIHSLHGIGGS 119
           +       +A    FAGYN++   I+YGVEG++ Y               + +  G+ GS
Sbjct: 59  AGATHNVGSATVGGFAGYNLQSGKIVYGVEGELGYRFKKNTFDDIPGPGVLDASTGLFGS 118

Query: 120 LRIRGGYEVSDSLLLYATVGPDVAQKYE--TGKAGEITPIAIGGTAGVGVEVGGLSESLV 177
           ++ R G ++  + + + T G   A+      G   E     +GG  G G++V  L+ ++ 
Sbjct: 119 VKGRVGMDMG-AYMPFVTAGVTAAKLKTFYPGGNAERDATLVGGVVGAGIDV-ALTHNVF 176

Query: 178 ARLEYRASKYSKVEGFY-------------NTISLGVGMKF 205
            R EY  S + K    Y             +   +G+ MKF
Sbjct: 177 LRGEYDFSFFGKKSLEYCGGGCTLEHTLQTHDFRVGIAMKF 217


>gi|255264610|ref|ZP_05343952.1| putative outer membrane protein [Thalassiobium sp. R2A62]
 gi|255106945|gb|EET49619.1| putative outer membrane protein [Thalassiobium sp. R2A62]
          Length = 207

 Score = 67.1 bits (162), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 47/212 (22%), Positives = 80/212 (37%), Gaps = 13/212 (6%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M++  ++  + ++       A A +           + PT     +       +   AG 
Sbjct: 1   MKQTLISASIVAML---SSGAIAGNIDLAIADPVIAIPPTSNVTDWSGSYCGLSYSSAGG 57

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLAD-NIHSLHGIGGS 119
           +  Y+     +         F G N + S ++YG E +V        D N+    G    
Sbjct: 58  TLSYSFGSPYDYVDETAIGGFCGNNWQRSNLVYGGELNVTGGSLGHDDINVVGELGTRIE 117

Query: 120 LRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVAR 179
           LR R GY + D  L+Y  +G   ++    G A     +A G T G+GV+   +++S+ A 
Sbjct: 118 LRTRVGYALGD-ALVYGFLGYGRSEITWGGNAPGEYGVAGG-TYGLGVDY-MVTDSMFAS 174

Query: 180 LEYRASKY------SKVEGFYNTISLGVGMKF 205
            E    +         V    N ISL +G KF
Sbjct: 175 FEVSNLELKETVTTGIVTHDINVISLRIGWKF 206


>gi|146341078|ref|YP_001206126.1| putative outer-membrane protein [Bradyrhizobium sp. ORS278]
 gi|146193884|emb|CAL77901.1| putative outer-membrane protein [Bradyrhizobium sp. ORS278]
          Length = 259

 Score = 67.1 bits (162), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 40/229 (17%), Positives = 64/229 (27%), Gaps = 43/229 (18%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M K          A+A+  S  AAD   +          T A    +   +D+ G Y G 
Sbjct: 1   MMKTLFGAAAGLGAMAAATSTFAADLPVKKGP------YTKAPPAVMATVYDWGGFYVGF 54

Query: 61  SALYNGSFGEEAHHNAGG--------------------SIFAGYNVEDSCIMYGVEGDVR 100
           +A    S       +  G                        GY  + +  ++GVE    
Sbjct: 55  NAGGGSSRDCWNLVSNAGVAVNPAANREGCSGGGGAAVGGQIGYRYQMANWVFGVEAQGD 114

Query: 101 YTVPVLAD--------NIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKA- 151
           +      +        +  S     G    + GY   D++L+Y   G  V          
Sbjct: 115 WANFKGTNRNLILPNVSDRSRTNGFGLFTGQVGYAF-DNILVYFKGGAAVVGDRYDTFTT 173

Query: 152 ------GEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFY 194
                         GGT G G+E G  + +    +EY           +
Sbjct: 174 GTNVMLDRANTTRWGGTVGAGLEYGF-APNWSVGIEYDHIFLGNKNLNF 221


>gi|94497477|ref|ZP_01304047.1| outer membrane protein-like [Sphingomonas sp. SKA58]
 gi|94423108|gb|EAT08139.1| outer membrane protein-like [Sphingomonas sp. SKA58]
          Length = 217

 Score = 67.1 bits (162), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 45/232 (19%), Positives = 79/232 (34%), Gaps = 42/232 (18%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+KL +A  ++ + +A+   AQ               V +  T   V     ++   AG 
Sbjct: 1   MRKLMVATLLAGVGVATPALAQ--------------DVGSTFTGPRVEAILGYDHVGAGS 46

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGSL 120
               N    +++       I AGY+V     + GVEG+   +         +     G +
Sbjct: 47  DVDNNNGRDDQSIDGLLYGIGAGYDVNLGSAVVGVEGEWTDSTAKSDRYDLTDQFGFGRV 106

Query: 121 R--------IRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIA----IGGTAGVGVE 168
                     R G   + + L+Y   G   ++        + T        G   G GVE
Sbjct: 107 SQGRDLYIGARAGILANPATLVYVKGGYTNSKLNILAGNTDETTDRSFKLDGWRIGAGVE 166

Query: 169 VGGLSESLVARLEYRASKYS---------------KVEGFYNTISLGVGMKF 205
              ++ +  A+LEYR S Y+                V+   + +   VG +F
Sbjct: 167 -RAINTNTFAKLEYRYSNYTDAHIDYMDGATSADFDVDTDRHQVVASVGWRF 217


>gi|209966188|ref|YP_002299103.1| outer membrane protein [Rhodospirillum centenum SW]
 gi|209959654|gb|ACJ00291.1| outer membrane protein [Rhodospirillum centenum SW]
          Length = 231

 Score = 67.1 bits (162), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 37/215 (17%), Positives = 71/215 (33%), Gaps = 34/215 (15%)

Query: 24  ADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNGSFG-------EEAHHNA 76
           A              P +A + +          YA +      +F        +  +   
Sbjct: 18  AALFGATALVALSSAPALAQSPFDGGYVGAALGYAWMKPNGTTTFSNATTQKVDRTNDGV 77

Query: 77  GGSIFAGYNVEDSCIMYGVEGDVRYTVPVLA-----DNIHSLHGIGGSLRIRGGYEVSDS 131
            G++F GY      +  G+EG++  +          +  +   G    + +R G   +  
Sbjct: 78  TGAVFLGYGKTIDTLYLGIEGEIGISDQEKNSTLAGNTYNFDAGTSLGIALRAGLLATPD 137

Query: 132 LLLYATVGPDVAQKYETGKAGEITPI--------AIGGTAGVGVEVGGLSESLVARLEYR 183
            L+Y  +G        +G+ G +             G   G GVE   L+E+++ARLEY 
Sbjct: 138 TLVYGRIGWQRTDLDVSGRLGSVAGTPTMDENEHLNGWRIGGGVE-HALTENVLARLEYN 196

Query: 184 ASKYSKVEGFY-------------NTISLGVGMKF 205
            + Y   +  Y             + +  G+  +F
Sbjct: 197 YTDYESYKVSYGQGGARTNAEPHESAVRAGIAYRF 231


>gi|91975493|ref|YP_568152.1| Outer membrane autotransporter barrel [Rhodopseudomonas palustris
           BisB5]
 gi|91681949|gb|ABE38251.1| Outer membrane autotransporter barrel [Rhodopseudomonas palustris
           BisB5]
          Length = 645

 Score = 67.1 bits (162), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 35/221 (15%), Positives = 57/221 (25%), Gaps = 39/221 (17%)

Query: 23  AADPVRRAHHGGRGVVPTIATNRY-VPIRHDFNGPYAGLSALYNGSFGEEAHHNAGGSIF 81
           AA    +A      V        + +             +    G+  +     A G   
Sbjct: 417 AAPLYTKAAKAPVLVRSAYNWTGFFIGGSFGALNGRTDWTFQPVGTRTDPRFAGAIGGGQ 476

Query: 82  AGYNVEDSCIMYGVEGDVRYTVPVLAD--------NIHSLHGIGGSLRIRGGYEVSDSLL 133
            GY+ +    + GVEG++  T    A            +     G+   + GY   D  L
Sbjct: 477 IGYDHQFGKWVVGVEGNLFATNANGARPCPNGVFFTCENNVSWMGTATAKLGYAFWDRSL 536

Query: 134 LYATVGPDVAQKYETGK------------------AGEITPIAIGGTAGVGVEVGGLSES 175
            Y   G        T                        +    G T G G E   LS++
Sbjct: 537 WYVRGGGAFGDLKVTTNCNTGPVVPNPAFLVVAGCGESASRNRAGWTIGFGSEF-ALSKN 595

Query: 176 LVARLEYRASKYSKVEGFYNT-----------ISLGVGMKF 205
              R E       +      T            ++G+  +F
Sbjct: 596 WTVRAETNYFDMGRERYTLPTSTIDVKENGFISTVGLNYRF 636


>gi|90577941|ref|ZP_01233752.1| hypothetical outer membrane protein OmpA [Vibrio angustum S14]
 gi|90441027|gb|EAS66207.1| hypothetical outer membrane protein OmpA [Vibrio angustum S14]
          Length = 347

 Score = 67.1 bits (162), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 37/206 (17%), Positives = 62/206 (30%), Gaps = 29/206 (14%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M K ++A+   +L +++  SA               V P     R     +         
Sbjct: 1   MSKKYIALLPLALVVSTVVSA-------------ATVNPFYVGARLGGAHYSNFQQNYQD 47

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGSL 120
                         +    +FAGYN       + VE    +      +N          L
Sbjct: 48  ITG-----INLNKDDVAAGVFAGYNFTP---WFAVETGYTWLGEAKFENNKIKQNA-IDL 98

Query: 121 RIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARL 180
             +  + ++D   ++  +G         G   +     + GTAGVGVE   L+  L  RL
Sbjct: 99  AAKMTWNLNDQWGVFGKLGGSYMLADFHGYGIKDLDDHLLGTAGVGVEY-KLTNHLSTRL 157

Query: 181 EYR-ASKYSKVEGFYNTISLGVGMKF 205
           EY+            N     +   F
Sbjct: 158 EYQLYHDIRSKPRDTN-----LAYNF 178


>gi|297521813|ref|ZP_06940199.1| outer membrane protein A [Escherichia coli OP50]
          Length = 181

 Score = 66.7 bits (161), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 32/187 (17%), Positives = 60/187 (32%), Gaps = 22/187 (11%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K  +A+ V+         AQAA                     Y   +  ++  +   
Sbjct: 1   MKKTAIAIAVALA--GFATVAQAA---------------PKDNTWYTGAKLGWSQYHDT- 42

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGSL 120
              +  + G    +  G   F GY V            +       +    +    G  L
Sbjct: 43  --GFINNNGPTHENQLGAGAFGGYQVNPYVGFEMGYDWLGRMPYKGSVENGAYKAQGVQL 100

Query: 121 RIRGGYEVSDSLLLYATVGPDVAQKYE-TGKAGEITPIAIGGTAGVGVEVGGLSESLVAR 179
             + GY ++D L +Y  +G  V +    +   G+     +      GVE   ++  +  R
Sbjct: 101 TAKLGYPITDDLDIYTRLGGMVWRADTKSNVYGKNHDTGVSPVFAGGVEY-AITPEIATR 159

Query: 180 LEYRASK 186
           LEY+ + 
Sbjct: 160 LEYQWTN 166


>gi|154244432|ref|YP_001415390.1| porin [Xanthobacter autotrophicus Py2]
 gi|154158517|gb|ABS65733.1| porin [Xanthobacter autotrophicus Py2]
          Length = 283

 Score = 66.7 bits (161), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 44/284 (15%), Positives = 75/284 (26%), Gaps = 80/284 (28%)

Query: 1   MQKLFLAV-GVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHD------- 52
           M+  F+AV   S ++ A+  +  A    +                       +       
Sbjct: 1   MRSYFVAVFAASVMSGAACAADLAVAVTKAPPAPASFSWTGFYIGGNAGYAWNSGTLDGV 60

Query: 53  ---FNGPYAGLSALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADN 109
              +   Y   S  +         ++  G   AGYN +    + G E D+ Y        
Sbjct: 61  GYIYGSDYGSYSNGWFNGQRSSESNSFTGGAQAGYNYQIGRAVLGFEADINYADASKTYA 120

Query: 110 IHSLHG--------------------------IGGSLRIRGGYEVSDSLLLYATVGPDVA 143
             S +                             G++R R G    D LL+YAT G    
Sbjct: 121 ASSTYDLYPYPVDRPDYNYHLREQLDASASVEWFGTIRARLGVTALDRLLVYATGGAAYG 180

Query: 144 QKYETGKAGE------------------------ITPIAIGGTAGVGVEVGGLSESLVAR 179
           +   +G                             + +  G T G G+E   +++++  +
Sbjct: 181 KVSGSGSYSWREYGFWWGGPGDHAFDRSGGFGGTDSSVRWGWTVGGGLEY-AITDNITVK 239

Query: 180 LEYRASKYSKVE------------------GFYNTISLGVGMKF 205
            EY        +                     N   LGV  KF
Sbjct: 240 GEYLYVDLGSNDYRIPEAIGGDEFVTWTSSTKLNVARLGVNYKF 283


>gi|296447726|ref|ZP_06889642.1| hypothetical protein MettrDRAFT_3358 [Methylosinus trichosporium
           OB3b]
 gi|296254758|gb|EFH01869.1| hypothetical protein MettrDRAFT_3358 [Methylosinus trichosporium
           OB3b]
          Length = 840

 Score = 66.7 bits (161), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 25/147 (17%), Positives = 45/147 (30%), Gaps = 29/147 (19%)

Query: 75  NAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLA--------------DNIHSLHGIGGSL 120
              G + AG N + + ++ G+E D+                       +  +     G++
Sbjct: 652 GFIGGLQAGINQQAAGVLMGLEADLHGVSGNTDTRWRMGIKDAISTYASRTTTLNYLGTI 711

Query: 121 RIRGGYEVSDSLLLYATVGPDVAQK--------------YETGKAGEITPIAIGGTAGVG 166
           R R GY  + +L +Y T G                      +          +G T G G
Sbjct: 712 RGRLGYLATPTLAIYGTGGLAYGGVISAGIISSQRVNGGALSFNFPAFQDSLLGWTVGAG 771

Query: 167 VEVGGLSESLVARLEYRASKYSKVEGF 193
           VE   LS     +++Y      +    
Sbjct: 772 VE-WALSPDWSVKIDYLRYDLGRATSS 797


>gi|83953797|ref|ZP_00962518.1| outer membrane protein, putative [Sulfitobacter sp. NAS-14.1]
 gi|83841742|gb|EAP80911.1| outer membrane protein, putative [Sulfitobacter sp. NAS-14.1]
          Length = 198

 Score = 66.7 bits (161), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 45/210 (21%), Positives = 70/210 (33%), Gaps = 25/210 (11%)

Query: 7   AVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGLSALYNG 66
               + LA  +F  A  A  +           P  A +       D+ G Y GL   Y+ 
Sbjct: 3   LASAAVLASTAFAGATYAGSLAEPVVEPVMTAPVPAPDLGG----DWTGFYTGLQLGYSD 58

Query: 67  SFGEEA--HHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADN---IHSLHGIGGSLR 121
           +  +      N      AGYN +    + G E D   T   L D               +
Sbjct: 59  AEVDNGLEGDNGSYGFHAGYNYDFGRFVLGGELDYDKTDIDLNDAAGVTQGSIDSVARAK 118

Query: 122 IRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARLE 181
           I+GGY++  S L+YAT G   A                G   GVG++   ++E      E
Sbjct: 119 IKGGYDLG-STLIYATGGYARADTTM--------GDEDGAFYGVGMDY-KITEQYSVGAE 168

Query: 182 YRASKYSKV------EGFYNTISLGVGMKF 205
               K++ V      +    T ++    +F
Sbjct: 169 LLEHKFNDVSGVSGNDADVTTFNIRGSYRF 198


>gi|261868250|ref|YP_003256172.1| outer membrane protein A [Aggregatibacter actinomycetemcomitans
           D11S-1]
 gi|261413582|gb|ACX82953.1| outer membrane protein A [Aggregatibacter actinomycetemcomitans
           D11S-1]
          Length = 356

 Score = 66.7 bits (161), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 35/196 (17%), Positives = 61/196 (31%), Gaps = 29/196 (14%)

Query: 38  VPTIATNRYVPIRHDFNGP-YAGLSALY---NGSFGEEAHHNAGGSIFAGYNVEDSCIMY 93
               A   Y   +  +    +      Y       G+   ++    IFAGY + D+  + 
Sbjct: 24  AAPQANTFYAGAKAGWASVRHGLNQYQYEQDGTVVGKAKKNSESYGIFAGYQITDNFAVE 83

Query: 94  GVEGDVRYTVPVLADNIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGKAGE 153
                        A     +   G SL ++  Y V  +L LYA  G  + +         
Sbjct: 84  AGYEFFGRGKVKEATGEKRITAHGSSLSLKASYPVLHNLDLYARAGAALIRVDYKDNTFG 143

Query: 154 IT----PIAIGGTAGVGVEVGGLSESLVARLEYRAS----KYSKVEGFYN---------- 195
            T     + +      G+E   +   L  RLEY+       + K E   N          
Sbjct: 144 ETHKFHDLKVSPVFAGGLEY-AILPELALRLEYQWVSRVGNFGKAERKANYYENNESDVR 202

Query: 196 ------TISLGVGMKF 205
                 +++LG+  +F
Sbjct: 203 YSPDIGSVALGLSYRF 218


>gi|319408066|emb|CBI81720.1| Hemin-binding protein C [Bartonella schoenbuchensis R1]
          Length = 287

 Score = 66.7 bits (161), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 45/296 (15%), Positives = 76/296 (25%), Gaps = 102/296 (34%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+ L   + VS+  L +  + QA       +        ++  +  V     + G Y G 
Sbjct: 3   MKYL---ITVSAFVLLAISTVQA------ENGTIPQESISVTPSVIVTPSFSWTGFYLGG 53

Query: 61  SALYNGSFGEEAH----------------------HNAGGSIFAGYNVEDSC-IMYGVEG 97
                 +  + +                           G  +AG NV      + GV+ 
Sbjct: 54  QIGIFSNKIDLSSGYLKNDDVEKWALIRKDFMPKLSGVVGGFYAGANVSLGNSFIIGVDT 113

Query: 98  DVRYTVPVLADNIHS--------------------------------------------- 112
           D+  +       +                                               
Sbjct: 114 DMVLSDKKDIKTVKINDYGQNEELRNENTARDSEGMVAASDCGIYNENIVSKIKFATYNH 173

Query: 113 --LHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQ------------KYETGKAGEITPIA 158
                  G+ R+R G+  +D ++ Y   G    Q                      T   
Sbjct: 174 ILKQKWAGATRVRVGFA-ADHVMPYVAGGISYTQLQDVLLRSSQEQGQIVDNTVGGTGTM 232

Query: 159 IGGTAGVGVEVGGLSESLVARLEYRASKYSK---------VEGFYNTISLGVGMKF 205
           IG T G GV+   +  + + R EYR S + K              N   +GV  KF
Sbjct: 233 IGYTLGAGVDFVMIG-NTILRTEYRYSDFGKKQFAKSGVEHSYKTNDFRVGVAYKF 287


>gi|312115901|ref|YP_004013497.1| porin [Rhodomicrobium vannielii ATCC 17100]
 gi|311221030|gb|ADP72398.1| porin [Rhodomicrobium vannielii ATCC 17100]
          Length = 266

 Score = 66.7 bits (161), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 38/233 (16%), Positives = 56/233 (24%), Gaps = 44/233 (18%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M+K+ L V      +A   SA AAD  + +                    H      +  
Sbjct: 1   MKKILLGVAS---FVALSSSAFAADLYKGSLKDAPVYEAPAIWTGLYVGAHGGYAWDSID 57

Query: 61  SAL----YNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLAD------NI 110
                   NG                GYN +   I+ GV  D+        +      N 
Sbjct: 58  FPGTPSHANGGAPRPDLEGGFVGGQIGYNYQFDKIVVGVVADISAANLEKTERDGNYLNE 117

Query: 111 HSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQKYETGK-------------------- 150
            +     G++R   GY     +L YATVG                               
Sbjct: 118 TTSIDKFGTVRAILGYSFG-KVLPYATVGYGWTSLSYKFGCPDALITGGYGGCNTKPSWS 176

Query: 151 ---------AGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFY 194
                             G   G GV+   +       +EY     +     Y
Sbjct: 177 PVTTPSANRTSGFDATTGGLVYGGGVKY-AIDNRFSIGVEYLRFDKADETADY 228


>gi|169825359|ref|YP_001691252.1| hypothetical protein M446_7000 [Methylobacterium sp. 4-46]
 gi|168199281|gb|ACA21227.1| hypothetical protein M446_7000 [Methylobacterium sp. 4-46]
          Length = 583

 Score = 66.4 bits (160), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 39/248 (15%), Positives = 65/248 (26%), Gaps = 61/248 (24%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           M++      +    +    +A AAD  +          P +A    V     + GPYAG+
Sbjct: 1   MRRSGAYYLLYLPIVGLGFAASAADLPQLTP-------PMMAFAPLVTPSFTWTGPYAGV 53

Query: 61  SALYNGSFGEEAHH-------------------NAGGSIFAGYNVED---SCIMYGVEGD 98
              Y                             +       GYN++    S ++ G   D
Sbjct: 54  FFGYGSLDESGTGRCIGPRCVRLPALSPGARAADLSAGSEVGYNLQASPGSGLVIGAAVD 113

Query: 99  VRYTVPVLAD------------------NIHSLHGIGGSLRIRGGYEVSDSLLLYATVGP 140
            + T                        ++       G++R + GY   D L +Y T G 
Sbjct: 114 YQTTRLRGYGESILVREVDENSDFAAFYHLGQRLDTFGAVRGKAGYAF-DRLFVYGTGGL 172

Query: 141 DVAQKYET------------GKAGEITPIAIGGTAGVGVEVGGLSESLVARLEYRASKYS 188
                                  G  +   +G  AG G E   +S  L  + E       
Sbjct: 173 AYGYVRIDVGTALTVGDRQFAAQGLTSGFRLGYAAGGGAEY-AISPHLSVKAEGLYYDLG 231

Query: 189 KVEGFYNT 196
           +       
Sbjct: 232 QRTVSIQA 239


>gi|156739534|gb|ABU93427.1| Omp25 [Brucella suis]
 gi|1