RPSBLAST alignment for GI: 254780598 and conserved domain: COG3637

>gnl|CDD|33435 COG3637, COG3637, Opacity protein and related surface antigens [Cell envelope biogenesis, outer membrane]. Length = 199
 Score = 45.4 bits (107), Expect = 1e-05
 Identities = 44/176 (25%), Positives = 67/176 (38%), Gaps = 22/176 (12%)

Query: 51  HDFNGPYAGLSALYN--GSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLAD 108
             + G Y+G  A  +  GS    +    GG   AGYN++    + GVEG   YT      
Sbjct: 25  AGWYGTYSGGYAGSDWSGSDSSPSIGFGGGLKLAGYNLKYRYSVLGVEGSFTYTGQSGRY 84

Query: 109 ------NIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQ----KYETGKAGEITPIA 158
                 N        GSLR    Y ++D    Y   G    +      E G + + +   
Sbjct: 85  SGGSGKNQVDNKAWYGSLRAGPDYRINDRFSPYGGAGVAYGKVKTSTDEVGGSADESKTK 144

Query: 159 IGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFY---------NTISLGVGMKF 205
            G   G GV+    ++++   L Y  S + K +G           +T+ +GVG KF
Sbjct: 145 TGYAYGAGVQY-NPTDNVAIDLGYEYSDFGKKDGVDGGYSGDVKTHTVKVGVGYKF 199