RPS-BLAST 2.2.22 [Sep-27-2009]

Database: CddA 
           21,609 sequences; 6,263,737 total letters

Searching..................................................done

Query= gi|254780598|ref|YP_003065011.1| outer membrane protein
[Candidatus Liberibacter asiaticus str. psy62]
         (205 letters)



>gnl|CDD|33435 COG3637, COG3637, Opacity protein and related surface antigens
           [Cell envelope biogenesis, outer membrane].
          Length = 199

 Score = 45.4 bits (107), Expect = 1e-05
 Identities = 44/176 (25%), Positives = 67/176 (38%), Gaps = 22/176 (12%)

Query: 51  HDFNGPYAGLSALYN--GSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLAD 108
             + G Y+G  A  +  GS    +    GG   AGYN++    + GVEG   YT      
Sbjct: 25  AGWYGTYSGGYAGSDWSGSDSSPSIGFGGGLKLAGYNLKYRYSVLGVEGSFTYTGQSGRY 84

Query: 109 ------NIHSLHGIGGSLRIRGGYEVSDSLLLYATVGPDVAQ----KYETGKAGEITPIA 158
                 N        GSLR    Y ++D    Y   G    +      E G + + +   
Sbjct: 85  SGGSGKNQVDNKAWYGSLRAGPDYRINDRFSPYGGAGVAYGKVKTSTDEVGGSADESKTK 144

Query: 159 IGGTAGVGVEVGGLSESLVARLEYRASKYSKVEGFY---------NTISLGVGMKF 205
            G   G GV+    ++++   L Y  S + K +G           +T+ +GVG KF
Sbjct: 145 TGYAYGAGVQY-NPTDNVAIDLGYEYSDFGKKDGVDGGYSGDVKTHTVKVGVGYKF 199


>gnl|CDD|110393 pfam01389, OmpA_membrane, OmpA-like transmembrane domain.  The
           structure of OmpA transmembrane domain shows that it
           consists of an eight stranded beta barrel. This family
           includes some other distantly related outer membrane
           proteins with low scores.
          Length = 175

 Score = 26.6 bits (59), Expect = 4.8
 Identities = 35/171 (20%), Positives = 59/171 (34%), Gaps = 26/171 (15%)

Query: 55  GPYAGLSALYNGSFGEE---AHHNA-GGSIFAGYNVEDSCIMYGVEGDVRYTVPVLAD-- 108
           G  AG ++ ++    E     H N+     F GY + +       E    Y   +     
Sbjct: 10  GAKAGWASFHDTGLIEGNGPTHRNSLTAGAFGGYQINNY---LAAELGYDYLGRMPYKGK 66

Query: 109 ---NIHSLHGIGGSLRIRGGYEVSDSLLLYATVG-----PDVAQKYETGKAGEITPIAIG 160
              N H   G+  +L ++  Y ++D L +Y  VG      D     +           + 
Sbjct: 67  GKNNAHKAQGV--TLSLKLSYPLTDDLDVYGKVGGALVRADYKFYEDANGKTGNHDTGVS 124

Query: 161 GTAGVGVEVGGLSESLVARLEYR----ASKYSK--VEGFYNTISLGVGMKF 205
               +GVE   ++  L  RLEY+         K        + SLG+  +F
Sbjct: 125 PLFALGVEY-AVTPELAVRLEYQYLNNIGDLHKQGKRPDNGSASLGISYRF 174


>gnl|CDD|34915 COG5338, COG5338, Uncharacterized protein conserved in bacteria
           [Function unknown].
          Length = 468

 Score = 26.1 bits (57), Expect = 6.1
 Identities = 9/22 (40%), Positives = 13/22 (59%)

Query: 117 GGSLRIRGGYEVSDSLLLYATV 138
             SL  R GYE+S +L+ +A  
Sbjct: 264 LASLTGRIGYELSPALIPFAEA 285


  Database: CddA
    Posted date:  Feb 4, 2011  9:38 PM
  Number of letters in database: 6,263,737
  Number of sequences in database:  21,609
  
Lambda     K      H
   0.318    0.138    0.403 

Gapped
Lambda     K      H
   0.267   0.0754    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 21609
Number of Hits to DB: 2,408,038
Number of extensions: 125529
Number of successful extensions: 276
Number of sequences better than 10.0: 1
Number of HSP's gapped: 275
Number of HSP's successfully gapped: 11
Length of query: 205
Length of database: 6,263,737
Length adjustment: 89
Effective length of query: 116
Effective length of database: 4,340,536
Effective search space: 503502176
Effective search space used: 503502176
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 55 (24.9 bits)