RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780598|ref|YP_003065011.1| outer membrane protein [Candidatus Liberibacter asiaticus str. psy62] (205 letters) >gnl|CDD|183452 PRK12337, PRK12337, 2-phosphoglycerate kinase; Provisional. Length = 475 Score = 29.4 bits (66), Expect = 0.67 Identities = 18/55 (32%), Positives = 26/55 (47%), Gaps = 10/55 (18%) Query: 133 LLYATVGPDVAQKYETGKAGEITP----IAIGGTAGVGVEVGGLSESLVARLEYR 183 LL G +VA++Y ++ P + IGG +GVG V L + L YR Sbjct: 230 LLLEEAGEEVARRYRLLRSIRRPPRPLHVLIGGVSGVGKSV------LASALAYR 278 >gnl|CDD|184632 PRK14336, PRK14336, (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional. Length = 418 Score = 29.1 bits (65), Expect = 0.75 Identities = 12/20 (60%), Positives = 14/20 (70%) Query: 104 PVLADNIHSLHGIGGSLRIR 123 P LAD + +LH I G LRIR Sbjct: 191 PCLADLLSALHDIPGLLRIR 210 >gnl|CDD|182724 PRK10780, PRK10780, periplasmic chaperone; Provisional. Length = 165 Score = 27.9 bits (62), Expect = 1.9 Identities = 14/27 (51%), Positives = 18/27 (66%), Gaps = 1/27 (3%) Query: 1 MQKLFLAVGVSSLALASFCSAQAADPV 27 M+K LA G+ LALA+ AQAAD + Sbjct: 1 MKKWLLAAGLG-LALATSAGAQAADKI 26 >gnl|CDD|173557 PTZ00364, PTZ00364, dipeptidyl-peptidase I precursor; Provisional. Length = 548 Score = 26.8 bits (59), Expect = 4.3 Identities = 12/44 (27%), Positives = 19/44 (43%), Gaps = 3/44 (6%) Query: 129 SDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGL 172 S L T+ P+ A + + G G TP+ G + + GL Sbjct: 52 SRVTKLIVTLMPNGAAQEQGGATGRWTPV---YNHGFEIRIAGL 92 >gnl|CDD|147879 pfam05963, Cytomega_US3, Cytomegalovirus US3 protein. US3 of human cytomegalovirus is an endoplasmic reticulum resident transmembrane glycoprotein that binds to major histocompatibility complex class I molecules and prevents their departure. The endoplasmic reticulum retention signal of the US3 protein is contained in the luminal domain of the protein. Length = 187 Score = 25.8 bits (56), Expect = 7.5 Identities = 10/33 (30%), Positives = 16/33 (48%) Query: 162 TAGVGVEVGGLSESLVARLEYRASKYSKVEGFY 194 T V+ G +S+S + L RA + + G Y Sbjct: 64 TTFHFVDYGIVSQSYMDNLAVRAEQVEFIAGEY 96 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.318 0.138 0.403 Gapped Lambda K H 0.267 0.0685 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 3,411,292 Number of extensions: 218251 Number of successful extensions: 404 Number of sequences better than 10.0: 1 Number of HSP's gapped: 404 Number of HSP's successfully gapped: 15 Length of query: 205 Length of database: 5,994,473 Length adjustment: 89 Effective length of query: 116 Effective length of database: 4,071,361 Effective search space: 472277876 Effective search space used: 472277876 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 55 (25.1 bits)