BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= gi|254780598|ref|YP_003065011.1| outer membrane protein
[Candidatus Liberibacter asiaticus str. psy62]
         (205 letters)

Database: las_proteome 
           1233 sequences; 328,796 total letters

Searching...................................................done



>gi|254780598|ref|YP_003065011.1| outer membrane protein [Candidatus Liberibacter asiaticus str.
           psy62]
          Length = 205

 Score =  412 bits (1059), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 205/205 (100%), Positives = 205/205 (100%)

Query: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60
           MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL
Sbjct: 1   MQKLFLAVGVSSLALASFCSAQAADPVRRAHHGGRGVVPTIATNRYVPIRHDFNGPYAGL 60

Query: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGSL 120
           SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGSL
Sbjct: 61  SALYNGSFGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRYTVPVLADNIHSLHGIGGSL 120

Query: 121 RIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARL 180
           RIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARL
Sbjct: 121 RIRGGYEVSDSLLLYATVGPDVAQKYETGKAGEITPIAIGGTAGVGVEVGGLSESLVARL 180

Query: 181 EYRASKYSKVEGFYNTISLGVGMKF 205
           EYRASKYSKVEGFYNTISLGVGMKF
Sbjct: 181 EYRASKYSKVEGFYNTISLGVGMKF 205


>gi|254780502|ref|YP_003064915.1| ribonucleotide-diphosphate reductase subunit alpha [Candidatus
           Liberibacter asiaticus str. psy62]
          Length = 954

 Score = 23.1 bits (48), Expect = 4.1,   Method: Composition-based stats.
 Identities = 11/34 (32%), Positives = 18/34 (52%)

Query: 68  FGEEAHHNAGGSIFAGYNVEDSCIMYGVEGDVRY 101
           F +    NAG ++F+   V D   +YG E ++ Y
Sbjct: 489 FMKRVTQNAGWTLFSPDEVSDLHDLYGKEFEIAY 522


  Database: las_proteome
    Posted date:  Jun 5, 2011  6:30 PM
  Number of letters in database: 328,796
  Number of sequences in database:  1233
  
Lambda     K      H
   0.318    0.138    0.403 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 132,079
Number of Sequences: 1233
Number of extensions: 5473
Number of successful extensions: 14
Number of sequences better than 100.0: 4
Number of HSP's better than 100.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 9
Number of HSP's gapped (non-prelim): 4
length of query: 205
length of database: 328,796
effective HSP length: 70
effective length of query: 135
effective length of database: 242,486
effective search space: 32735610
effective search space used: 32735610
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 36 (18.5 bits)