RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254780600|ref|YP_003065013.1| CDP-diacylglycerol/glycerol-3-phosphate 3-phosphatidyltransferase [Candidatus Liberibacter asiaticus str. psy62] (200 letters) >d1jboa_ a.1.1.3 (A:) Phycocyanin alpha subunit {Synechococcus elongatus [TaxId: 32046]} Length = 162 Score = 24.4 bits (53), Expect = 7.5 Identities = 10/36 (27%), Positives = 15/36 (41%) Query: 101 YSIWAAITILCREILVSGLREYLAELKVSVPVTRIA 136 Y + A T E L++GL E + +S A Sbjct: 97 YCLVAGGTGPMDEYLIAGLSEINSTFDLSPSWYIEA 132 >d1shyb1 b.69.12.1 (B:40-515) Hepatocyte growth factor receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 476 Score = 24.4 bits (52), Expect = 7.9 Identities = 8/35 (22%), Positives = 14/35 (40%) Query: 37 SPNLMRWIALSLFTIASITDFFDGYLARVWNQTSN 71 S M A+ F I + DFF+ + + + Sbjct: 314 SAEPMDRSAMCAFPIKYVNDFFNKIVNKNNVRCLQ 348 >d1b8da_ a.1.1.3 (A:) Phycoerythrin alpha subunit {Red alga (Griffithsia monilis) [TaxId: 42003]} Length = 164 Score = 24.1 bits (52), Expect = 8.3 Identities = 9/36 (25%), Positives = 13/36 (36%) Query: 101 YSIWAAITILCREILVSGLREYLAELKVSVPVTRIA 136 YS+ T E ++G RE L + A Sbjct: 95 YSLVVGGTGPVDEWGIAGSREVYRALNLPGSAYIAA 130 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.327 0.141 0.423 Gapped Lambda K H 0.267 0.0605 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 758,530 Number of extensions: 33376 Number of successful extensions: 78 Number of sequences better than 10.0: 1 Number of HSP's gapped: 78 Number of HSP's successfully gapped: 7 Length of query: 200 Length of database: 2,407,596 Length adjustment: 81 Effective length of query: 119 Effective length of database: 1,295,466 Effective search space: 154160454 Effective search space used: 154160454 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 51 (23.7 bits)