HHsearch alignment for GI: 254780601 and conserved domain: PRK10919

>PRK10919 ATP-dependent DNA helicase Rep; Provisional.
Probab=95.33  E-value=0.12  Score=30.20  Aligned_cols=69  Identities=22%  Similarity=0.159  Sum_probs=45.8

Q ss_pred             CCCHHHHHHHHHHHCCCCEEEECCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCEEEEECCCHHHHHHHHHHHHHH
Q ss_conf             7898999999999759969999289874689999999998610421225568827999849989999999999998
Q gi|254780601|r   22 NLTSVQEAILNPDLREKDVLVSAQTGSGKTVAFGLALASTLLAENDRFSPASAPLALAIAPTRELAVQVGRELEWL   97 (573)
Q Consensus        22 ~pt~iQ~~~ip~~l~g~d~i~~a~TGsGKT~af~lp~l~~l~~~~~~~~~~~~~~~lil~PTrELa~Qv~~~~~~l   97 (573)
T Consensus         2 ~Ln~~Q~~AV~~--~~gp~lVlAGaGSGKT~tLt~Ria~Li~~~--~v~---P~~ILalTFT~kAA~Emk~Rl~~~   70 (672)
T PRK10919          2 RLNPGQQQAVEF--VTGPCLVLAGAGSGKTRVITNKIAHLIRGC--GYQ---ARHIAAVTFTNKAAREMKERVGQT   70 (672)
T ss_pred             CCCHHHHHHHCC--CCCCEEEEECCCHHHHHHHHHHHHHHHHCC--CCC---CCCEEEECCHHHHHHHHHHHHHHH
T ss_conf             999899999839--999989997385587999999999998668--989---333854421799999999999977