BLAST/BLAST alignment of GI: 254780601 and GI: 254780382
>gi|254780382|ref|YP_003064795.1| ATP dependent RNA helicase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 465
 Score =  187 bits (475), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 110/344 (31%), Positives = 185/344 (53%), Gaps = 7/344 (2%)

Query: 8   PQVIGEALSERGYVNLTSVQEAILNPDLREKDVLVSAQTGSGKTVAFGLALASTLLAEND 67
           P+V+   L + GYV  T +Q   +   L+  DV   AQTG+GKT +F L + + L     
Sbjct: 10  PKVVCAVL-DAGYVKPTPIQIKTIPLVLQRHDVCGIAQTGTGKTASFVLPMLTILEKGRA 68

Query: 68  RFSPASAPLALAIAPTRELAVQVGRELEWLYAKTGVVVAVCIGGVSVHRERRDLQNGAHI 127
           R      P  L + PTRELA QV    E       + VA+ IGG+    + + L+ GA +
Sbjct: 69  R---VRMPRTLILEPTRELAAQVADNFEKYGKNYNLTVALLIGGIPFEAQNKKLERGADV 125

Query: 128 VVGTPGRLCDHIRGKGLNISHLKAVVLDEADEMLDLGFRDDIEFILDSSPKKRRMLMFSA 187
           ++ TPGR+ DH     L +++++ +V+DEAD MLD+GF   I+ I    P  R+ L+FSA
Sbjct: 126 LICTPGRILDHFNRGKLLMNNIEILVIDEADRMLDMGFIPYIQNITSLVPFTRQTLLFSA 185

Query: 188 TISPAITTLAKNYQKDAVRVNIASENRQHSDID--YRAVLVALSDR-DNAIVNILRYHGA 244
           T++  +  +++N+ ++  R+ + + +     I+  + A     S +       +      
Sbjct: 186 TMTDELQKVSENFLQNPKRIEVNTPSSTAETIEHCFVATYAQYSKKCALLQQLLQSQDTM 245

Query: 245 KNAIVFCSTRASVSRFTKVLAEHLFQVVALSGELSQQERSNALQMMRDGRARVCIATDVA 304
           KN I+FC+ + +V      L +  F V A+ G + Q+ R   L   ++G  ++ +A+D+A
Sbjct: 246 KNGIIFCNQKKNVVNLCHSLEKQGFSVCAIHGNIDQRSRMKILSNFKEGTIQLMVASDLA 305

Query: 305 ARGIDLPDLELVIHAELSSNPENLLHRSGRTGRAGRKGMSVFVI 348
           ARG+D+PD+  V + ++ +  EN +HR GRTGRAGR G +  ++
Sbjct: 306 ARGLDIPDVGHVFNFDVPNRAENYIHRIGRTGRAGRHGKAFTLV 349