HHsearch alignment for GI: 254780602 and conserved domain: KOG0053

>KOG0053 consensus.
Probab=99.45  E-value=1.2e-13  Score=103.11  Aligned_cols=186  Identities=19%  Similarity=0.205  Sum_probs=124.3

Q ss_pred             HHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC----CCCCCCCCCCCCCC
Q ss_conf             99999999864210133332233233454333322222223322322223333232222222----22222222222222
Q gi|254780602|r   72 PLREAIVEKFRRDNDLHYTSDQIIVGTGAKHVIFNALMATVNMGDEVLIPRPYWVSYPDMVA----LCGGIPVFVDTQQD  147 (400)
Q Consensus        72 ~lR~aia~~~~~~~g~~~~~e~I~it~G~~~~l~~~~~~~~~~Gd~Vlv~~P~y~~y~~~~~----~~g~~~~~v~~~~~  147 (400)
T Consensus        77 Pt~~~le~~iaal~g----a~~~l~fsSGmaA~~~al~~L~~~g~~iV~~~~~Y~gT~~~l~~~~~~~gie~~~vd~~--  150 (409)
T KOG0053          77 PTRDVLESGIAALEG----AAHALLFSSGMAAITVALLHLLPAGDHIVATGDVYGGTLRILRKFLPKFGGEGDFVDVD--  150 (409)
T ss_pred             CCHHHHHHHHHHHHC----CCEEEEECCCHHHHHHHHHHHCCCCCCEEEECCCCCCHHHHHHHHHHHHCCEEEEECHH--
T ss_conf             966899999998718----86389934407899999998467898589717875009999999999709354330416--


Q ss_pred             CCCCCHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             32221033310001221220121135421000012333321112233333201110122110000012233222111233
Q gi|254780602|r  148 DNFQVSPEKLEQAITPKTKWLFLNSPSNPSGVVYSQNRLRALADVLVRNPHVHIISDDIYEHIVYRNCQFSNIVNVEPSL  227 (400)
Q Consensus       148 ~~~~~d~~~l~~~i~~~~k~i~l~nP~NPTG~v~s~~~l~~i~~~~a~~~~i~ii~De~Y~~l~~~~~~~~s~~~~~~~~  227 (400)
T Consensus       151 -----~~~~~~~~i~~~t~~V~~ESPsNPll~v~DI~~---l~~l-a~~~g~~vvVDnTf~~p~~-----~~pL~lGA--  214 (409)
T KOG0053         151 -----DLKKILKAIKENTKAVFLESPSNPLLKVPDIEK---LARL-AHKYGFLVVVDNTFGSPYN-----QDPLPLGA--  214 (409)
T ss_pred             -----HHHHHHHHHCCCCEEEEEECCCCCCCCCCCHHH---HHHH-HHHCCCEEEEECCCCCCCC-----CCHHHCCC--
T ss_conf             -----678899862667069999779997500456999---9998-7417978999577676333-----67121388--


Q ss_pred             CCEEEEECCCCCCCCCCC-CCCCCCCCH-HHHHHHHHHHCCCCCCCCCCCCCCCCCC
Q ss_conf             322574146544322344-544422110-1226875310012223322222222222
Q gi|254780602|r  228 YERTLVVNGVSKAYAMTG-LRIGYAAGA-LSLIKSMIVLQGQQTSGACSIAQWAAVE  282 (400)
Q Consensus       228 ~~~~i~~~S~SK~~~~~G-~RiG~~v~~-~~li~~l~~~~~~~~~~~~~~~q~a~~~  282 (400)
T Consensus       215 ---DIV~hSaTKyi~Ghsdvi~G~iv~n~~~~~~~l~~~~~~lg~~~~p~~~~ll~R  268 (409)
T KOG0053         215 ---DIVVHSATKYIGGHSDVIGGSVVLNSEELASRLKFLQEDLGWCEDPFDLFLLSR  268 (409)
T ss_pred             ---CEEEEEEEEEECCCCCEEEEEEECCCHHHHHHHHHHHHHHCCCCCHHHHHHHHC
T ss_conf             ---789985101444776635147761749999999999998557998899999866