HHsearch alignment for GI: 254780602 and conserved domain: PRK03715

>PRK03715 argD bifunctional N-succinyldiaminopimelate-aminotransferase/acetylornithine transaminase protein; Provisional.
Probab=99.45  E-value=1e-12  Score=97.56  Aligned_cols=335  Identities=12%  Similarity=0.112  Sum_probs=181.9

Q ss_pred             HCCCCEEECCCCC--CCCC-CCHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCC
Q ss_conf             8699726656589--7498-899999999999838875699877898999999998642101333322332334543333
Q gi|254780602|r   28 SKGIDVLCLTAGE--PDFD-MPENVKYAVVRAMERGETKYTAVAGISPLREAIVEKFRRDNDLHYTSDQIIVGTGAKHVI  104 (400)
Q Consensus        28 ~~g~~ii~l~~G~--p~~~-~p~~i~~a~~~al~~~~~~Y~~~~G~~~lR~aia~~~~~~~g~~~~~e~I~it~G~~~~l  104 (400)
T Consensus        33 ~dG~~ylD~~~g~~~~~lGh~~p~v~~Ai~~Q~~~l~~--~~~~~~~~~~~~la~~L~~~~~----~~~v~f~~sGsEAv  106 (395)
T PRK03715         33 HTGKRYLDFIQGWAVNCLGHCNPGMVEALAAQAEKLIN--PSPAFYNEPMAKLAGLLTQHSC----FDKVFFANSGAEAN  106 (395)
T ss_pred             CCCCEEEECCCCHHHHHHCCCCHHHHHHHHHHHHHCCC--CCCCCCCHHHHHHHHHHHCCCC----CCEEEEECCHHHHH
T ss_conf             98799988231788777458969999999999975476--7732027899999999841558----88799818758899


Q ss_pred             CCCCCCCC------CCC-CCCCCCCCCCCCCCCCCC-CCCCC---CCCCCCCC---CCCCCCHHHHHHCCCCCCCCCEEE
Q ss_conf             22222223------322-322223333232222222-22222---22222222---232221033310001221220121
Q gi|254780602|r  105 FNALMATV------NMG-DEVLIPRPYWVSYPDMVA-LCGGI---PVFVDTQQ---DDNFQVSPEKLEQAITPKTKWLFL  170 (400)
Q Consensus       105 ~~~~~~~~------~~G-d~Vlv~~P~y~~y~~~~~-~~g~~---~~~v~~~~---~~~~~~d~~~l~~~i~~~~k~i~l  170 (400)
T Consensus       107 E~AlKlAr~y~~~~~~gr~~ii~~~~~yHG~T~~~~s~sg~~~~~~~~~p~~~~~~~~~-~~d~~~~~~~~~~~~aAvii  185 (395)
T PRK03715        107 EGAIKLARKWGRKHKNGAYEIITFDHSFHGRTLATMSASGKPGWDTIFAPQVPGFPKAE-LNDIASVEKLITDKTVAVML  185 (395)
T ss_pred             HHHHHHHHHHHHCCCCCCCEEEEECCCCCCCCHHHHCCCCCCCCCCCCCCCCCCCCCCC-CCCHHHHHHHCCCCEEEEEE
T ss_conf             99999999986246899845999757889874022104686444556789889967555-45589999734998079999


Q ss_pred             CCCC-CCCCCC-CCCCCCCCCCCCCCCCCCCEEECCCCCCCCCCCCCCC-CCCCCCCCCCCCEEEEECCCCCCCCCCCCC
Q ss_conf             1354-210000-1233332111223333320111012211000001223-322211123332257414654432234454
Q gi|254780602|r  171 NSPS-NPSGVV-YSQNRLRALADVLVRNPHVHIISDDIYEHIVYRNCQF-SNIVNVEPSLYERTLVVNGVSKAYAMTGLR  247 (400)
Q Consensus       171 ~nP~-NPTG~v-~s~~~l~~i~~~~a~~~~i~ii~De~Y~~l~~~~~~~-~s~~~~~~~~~~~~i~~~S~SK~~~~~G~R  247 (400)
T Consensus       186 -EPiqg~gG~~~~~~~yl~~lr~lc-~~~gillI~DEV~tGfGRtG~~fa~e~~gv~PD-----iv~--~gKgl~-gG~P  255 (395)
T PRK03715        186 -EPVQGEGGVIPATREFMQQLRALT-KQHGLLLIVDEVQTGCGRTGTLFAYELAGIEPD-----IMT--LGKGIG-GGVP  255 (395)
T ss_pred             -ECCCCCCCCCCCCHHHHHHHHHHH-HHCCCCEECCCCCCCCCCCCCCCCCCCCCCCCC-----EEE--ECCHHH-CCCC
T ss_conf             -378887798529889999999999-518973562011038886668530004899999-----899--752442-8985


Q ss_pred             CCCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCC--CCCCCCCCCCCCCCCCCHHHHHHCC---CCCEEEECCC
Q ss_conf             4422110122687531001222332222222222223467--6432222221100000002455304---7760330274
Q gi|254780602|r  248 IGYAAGALSLIKSMIVLQGQQTSGACSIAQWAAVEALNGP--QDFVVNNRKIFEYRRDLCVAQLQGV---PGIRYMIPDG  322 (400)
Q Consensus       248 iG~~v~~~~li~~l~~~~~~~~~~~~~~~q~a~~~~l~~~--~~~~~~~~~~~~~~r~~~~~~L~~~---~g~~~~~p~g  322 (400)
T Consensus       256 l~av~~~~~i~-~~~~g~~g~T~~gnpla~aaa~a~L~~i~~~~l~~~----~~~~g~~l~~~L~~l~~~~~i~~vRG~G  330 (395)
T PRK03715        256 LAALLAKAEVA-VFEAGDQGGTYNGNPLMTAVGYAVISQLVAPGFLEG----VRARGEYLKEKLLELSAERGLEGERGEG  330 (395)
T ss_pred             EEEEEECHHHC-CCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCHHHH----HHHHHHHHHHHHHHHHCCCCCEEEEECC
T ss_conf             28999826742-477898887989971899999999999962689999----9999999999999865039913574355


Q ss_pred             CEEEEEECCCCCCCCCCCCCCCCCHHHHHHHHHHHCCEEEECCCCCCCCCEEEEE--EECCHHHHHHHHHHHHHHHHHC
Q ss_conf             0899862641023321133224898999999998739799835022899728999--6299999999999999999860
Q gi|254780602|r  323 AFYLYPSCQDLIGKKSPSGDVIRTDLDFVNGLLEIEKVAVVQGSSFGHGPSIRIS--YAVSDAILEEACVRIKRFCHSL  399 (400)
Q Consensus       323 ~~y~~~~~~~~~~~~~~~~~~~~~~~~~~~~Ll~~~gV~v~pG~~Fg~~~~iRis--~~~~~e~l~~al~rl~~~l~~l  399 (400)
T Consensus       331 -l~~~iel~~~~---------~~~~~~~~~~~-~~~gll~~~~----~~n~irl~PpL~it~~eid~~~~~l~~aL~~l  394 (395)
T PRK03715        331 -LLRALLLGKDI---------GPQIVEKARDM-QPDGLLLNAP----RPNLLRFMPALNVTTDEIDQMIAMLRSVLDKL  394 (395)
T ss_pred             -EEEEEEECCCC---------CHHHHHHHHHH-HHCCEEEECC----CCCEEEEECCCCCCHHHHHHHHHHHHHHHHHH
T ss_conf             -89999967887---------08999999999-8399899228----99989997994388999999999999999986