HHsearch alignment for GI: 254780602 and conserved domain: PRK05355

>PRK05355 phosphoserine aminotransferase; Provisional.
Probab=97.77  E-value=0.00047  Score=44.74  Aligned_cols=324  Identities=14%  Similarity=0.129  Sum_probs=152.2

Q ss_pred             CEEECCCCCCCCCCCHHHHHHHHHHHHC-CCCCC-----CC-CCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCC-CCCC
Q ss_conf             7266565897498899999999999838-87569-----98-778989999999986421013333223323345-4333
Q gi|254780602|r   32 DVLCLTAGEPDFDMPENVKYAVVRAMER-GETKY-----TA-VAGISPLREAIVEKFRRDNDLHYTSDQIIVGTG-AKHV  103 (400)
Q Consensus        32 ~ii~l~~G~p~~~~p~~i~~a~~~al~~-~~~~Y-----~~-~~G~~~lR~aia~~~~~~~g~~~~~e~I~it~G-~~~~  103 (400)
T Consensus         3 r~~NF~aGPa--~LP~~Vl~~~~~e~~~~~g~G~silEiSHRs~~f~~i~~~a~~~lr~Ll~iPd~Y-eVlflqGGat~q   79 (360)
T PRK05355          3 RVYNFSAGPA--MLPEEVLEQAQQELLDWNGSGMSVMEISHRSKEFIAVAEEAEADLRELLNIPDNY-KVLFLQGGASLQ   79 (360)
T ss_pred             CCCCCCCCCC--CCCHHHHHHHHHHHHCCCCCCCCEEEECCCCHHHHHHHHHHHHHHHHHHCCCCCC-EEEEECCCHHHH
T ss_conf             8511788854--3899999999999860258886057545588889999999999999984899981-899957845899


Q ss_pred             CCCCCCCCCCCCCCCCCCC-CCCCC--CCCCCCCCCCCCCCCCCCCCCCCC--CHHHHHHCCCCCCCCCEEECCCCC-CC
Q ss_conf             3222222233223222233-33232--222222222222222222223222--103331000122122012113542-10
Q gi|254780602|r  104 IFNALMATVNMGDEVLIPR-PYWVS--YPDMVALCGGIPVFVDTQQDDNFQ--VSPEKLEQAITPKTKWLFLNSPSN-PS  177 (400)
Q Consensus       104 l~~~~~~~~~~Gd~Vlv~~-P~y~~--y~~~~~~~g~~~~~v~~~~~~~~~--~d~~~l~~~i~~~~k~i~l~nP~N-PT  177 (400)
T Consensus        80 F~~ip~Nll~~~~~a~y~~tG~Ws~KA~~EA-~~~~-~~~v~~~~~~~~~~~iP~~~~~--~~~~~~~Y~h~t~-NETi~  154 (360)
T PRK05355         80 FAMVPLNLLGKGGKADYVVTGSWSKKAIKEA-KKYG-EVNVAASSEDDGFTYIPPLDEW--QLSDDAAYVHYTP-NETID  154 (360)
T ss_pred             HHHHHHHCCCCCCEEEEEECCHHHHHHHHHH-HHHC-CCCEECCCCCCCCCCCCCHHHC--CCCCCCCEEEECC-CCCCC
T ss_conf             9999874678898023895388899999973-7616-8732013466777558986652--7797756799714-77501


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCHHHH
Q ss_conf             00012333321112233333201110122110000012233222111233322574146544322344544422110122
Q gi|254780602|r  178 GVVYSQNRLRALADVLVRNPHVHIISDDIYEHIVYRNCQFSNIVNVEPSLYERTLVVNGVSKAYAMTGLRIGYAAGALSL  257 (400)
Q Consensus       178 G~v~s~~~l~~i~~~~a~~~~i~ii~De~Y~~l~~~~~~~~s~~~~~~~~~~~~i~~~S~SK~~~~~G~RiG~~v~~~~l  257 (400)
T Consensus       155 Gv~~~~-----~P----~~~~~pLV~DmS-S~~l--srp-i-------D~~~~d~iYagaQKNlGpaG--vtvvIvr~~l  212 (360)
T PRK05355        155 GTEIHE-----LP----DTGDVPLVADMS-SDIL--SRP-I-------DVSKFGLIYAGAQKNIGPAG--LTIVIVREDL  212 (360)
T ss_pred             CEEECC-----CC----CCCCCCEEEECC-CCCC--CCC-C-------CHHHCCEEEEECCCCCCCCC--CEEEEEEHHH
T ss_conf             046101-----36----668984799734-5434--776-7-------77891579987433578765--1899975999


Q ss_pred             HHHHHH-------HCC----CCCC-CCCCCCCCCCC---CCCCCCCCCCCCCCCCCCCCCCCHHHHHHCCCCCEEE-ECC
Q ss_conf             687531-------001----2223-32222222222---2234676432222221100000002455304776033-027
Q gi|254780602|r  258 IKSMIV-------LQG----QQTS-GACSIAQWAAV---EALNGPQDFVVNNRKIFEYRRDLCVAQLQGVPGIRYM-IPD  321 (400)
Q Consensus       258 i~~l~~-------~~~----~~~~-~~~~~~q~a~~---~~l~~~~~~~~~~~~~~~~~r~~~~~~L~~~~g~~~~-~p~  321 (400)
T Consensus       213 l~~~~~~iP~~l~y~~~~~~~Sl~NTPp~f~iy~~~lvl~Wl~-~~GGl~~~~~~n~~KA~lLY~~iD~s~fy~~~v~~~  291 (360)
T PRK05355        213 LGRALPNIPSMLDYKTHADNDSMYNTPPTFAIYLAGLVFKWLK-EQGGVAAIEKRNQEKAALLYDAIDSSDFYRNPVAPE  291 (360)
T ss_pred             HHCCCCCCCCHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHH-HCCCHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCHH
T ss_conf             6223668960530999986367666884289999999999998-617699999999998999999986078635889856


Q ss_pred             CCEEEEEECCCCCCCCCCCCCCCCCHHHHHHHHHHHCCEEEECCCCCCCCCEEEEEE--ECCHHHHHHHHHHHHHHHHH
Q ss_conf             408998626410233211332248989999999987397998350228997289996--29999999999999999986
Q gi|254780602|r  322 GAFYLYPSCQDLIGKKSPSGDVIRTDLDFVNGLLEIEKVAVVQGSSFGHGPSIRISY--AVSDAILEEACVRIKRFCHS  398 (400)
Q Consensus       322 g~~y~~~~~~~~~~~~~~~~~~~~~~~~~~~~Ll~~~gV~v~pG~~Fg~~~~iRis~--~~~~e~l~~al~rl~~~l~~  398 (400)
T Consensus       292 --------~RS~mNV~F~~-~~~~l~~~Fl~~-a~~~Gl~~LkGhR--svGG~RaSlYNa~~~e~V~~L~~fm~~F~~~  358 (360)
T PRK05355        292 --------NRSRMNVPFTL-ADEELDKKFLAE-AEAAGLVGLKGHR--SVGGMRASIYNAMPLEGVQALVDFMKEFEKR  358 (360)
T ss_pred             --------HCCCCEEEEEC-CCHHHHHHHHHH-HHHCCCCCCCCCC--CCCCEEEEECCCCCHHHHHHHHHHHHHHHHH
T ss_conf             --------56865447871-877789999999-9987986666876--5385278801799999999999999999996