HHsearch alignment for GI: 254780602 and conserved domain: PRK08069

>PRK08069 consensus.
Probab=100.00  E-value=0  Score=682.76  Aligned_cols=390  Identities=44%  Similarity=0.751  Sum_probs=371.5

Q ss_pred             HHHHHHHHHCCCCHHHHHHHHHHHHHHCCCCEEECCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHH
Q ss_conf             36788987389758999999999999869972665658974988999999999998388756998778989999999986
Q gi|254780602|r    2 VFISNILRRVQPSATLVAAQRVRDLRSKGIDVLCLTAGEPDFDMPENVKYAVVRAMERGETKYTAVAGISPLREAIVEKF   81 (400)
Q Consensus         2 ~~~s~~~~~l~~s~~~~~~~~~~~~~~~g~~ii~l~~G~p~~~~p~~i~~a~~~al~~~~~~Y~~~~G~~~lR~aia~~~   81 (400)
T Consensus         1 m~~s~r~~~~~~s~~~~i~~~a~~~~~~g~~vi~l~~G~pdf~~p~~i~~a~~~~~~~~~~~Y~~~~G~~~lreaia~~~   80 (390)
T PRK08069          1 MKLAKRVAALTPSATLAITAKAKELKAEGHDVIGLGAGEPDFNTPEHIIDAAHKAMNEGHTKYTPSGGLQALKQEIVKKF   80 (390)
T ss_pred             CCHHHHHHCCCCCHHHHHHHHHHHHHHCCCCEEECCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHH
T ss_conf             92515846499379999999999999769984789997899998899999999998548998989967299999999999


Q ss_pred             HHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHCCC
Q ss_conf             42101333322332334543333222222233223222233332322222222222222222222232221033310001
Q gi|254780602|r   82 RRDNDLHYTSDQIIVGTGAKHVIFNALMATVNMGDEVLIPRPYWVSYPDMVALCGGIPVFVDTQQDDNFQVSPEKLEQAI  161 (400)
Q Consensus        82 ~~~~g~~~~~e~I~it~G~~~~l~~~~~~~~~~Gd~Vlv~~P~y~~y~~~~~~~g~~~~~v~~~~~~~~~~d~~~l~~~i  161 (400)
T Consensus        81 ~~~~g~~~~p~~V~it~G~~~al~~~~~~l~~pGD~Vlv~~P~Y~~y~~~~~~~g~~~v~v~~~~~~~~~~d~~~l~~~i  160 (390)
T PRK08069         81 KRDQGLAYDPSEIIVCTGAKHALYTLFQVLLDEGDEVIIPTPYWVSYPEQVKLAGGKPVYVEGLEDNDFKITAEQLEEAI  160 (390)
T ss_pred             HHHHCCCCCHHEEEECCCHHHHHHHHHHHHCCCCCEEEECCCCCCCHHHHHHHHCCEEEEECCCCCCCCCCCHHHHHHHC
T ss_conf             99868998811189878889999999997279989899806866427999998188048714566678767999999854


Q ss_pred             CCCCCCEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEECCCCCCC
Q ss_conf             22122012113542100001233332111223333320111012211000001223322211123332257414654432
Q gi|254780602|r  162 TPKTKWLFLNSPSNPSGVVYSQNRLRALADVLVRNPHVHIISDDIYEHIVYRNCQFSNIVNVEPSLYERTLVVNGVSKAY  241 (400)
Q Consensus       162 ~~~~k~i~l~nP~NPTG~v~s~~~l~~i~~~~a~~~~i~ii~De~Y~~l~~~~~~~~s~~~~~~~~~~~~i~~~S~SK~~  241 (400)
T Consensus       161 ~~~~k~iil~~P~NPTG~v~s~e~l~~i~~la~~-~~~~vi~DEiY~~l~~~~~~~~s~~~~~~~~~~~~i~~~s~SK~~  239 (390)
T PRK08069        161 TEKTKAVIINSPSNPTGMIYTKEELAALGEVCLE-HDILIVSDEIYEKLIYGGAEHVSIAQLSNELKEQTIIINGVSKSH  239 (390)
T ss_pred             CCCCCEEEECCCCCCCCCCCCCHHHHHHHHHHHH-CCEEEEEEHHHHHHCCCCCCCCCHHHHCCCCCCCCCEECCCHHHC
T ss_conf             4368589988996986816550689999999875-630598533236540699898898994954345641003530203


Q ss_pred             CCCCCCCCCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHCCCCCEEEECC
Q ss_conf             23445444221101226875310012223322222222222234676432222221100000002455304776033027
Q gi|254780602|r  242 AMTGLRIGYAAGALSLIKSMIVLQGQQTSGACSIAQWAAVEALNGPQDFVVNNRKIFEYRRDLCVAQLQGVPGIRYMIPD  321 (400)
Q Consensus       242 ~~~G~RiG~~v~~~~li~~l~~~~~~~~~~~~~~~q~a~~~~l~~~~~~~~~~~~~~~~~r~~~~~~L~~~~g~~~~~p~  321 (400)
T Consensus       240 ~~~G~RiG~~~~~~~li~~~~~~~~~~~~~~~~~~q~aa~~a~~~~~~~~~~~~~~~~~r~~~~~~~l~~~~g~~~~~P~  319 (390)
T PRK08069        240 SMTGWRIGYAAGNKQIIKAMTNLASHSTSNPTSIAQYGAIAAYAGSQEPVETMRQAFEERLNIIYDKLIQIPGFTCIKPQ  319 (390)
T ss_pred             CCCCCCEEEEECCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCC
T ss_conf             77632358876699999999999865357776399999999986886879999999999999999998506688514798


Q ss_pred             CCEEEEEECCCCCCCCCCCCCCCCCHHHHHHHHHHHCCEEEECCCCCCCCCEEEEEEECCHHHHHHHHHHHHHHHH
Q ss_conf             4089986264102332113322489899999999873979983502289972899962999999999999999998
Q gi|254780602|r  322 GAFYLYPSCQDLIGKKSPSGDVIRTDLDFVNGLLEIEKVAVVQGSSFGHGPSIRISYAVSDAILEEACVRIKRFCH  397 (400)
Q Consensus       322 g~~y~~~~~~~~~~~~~~~~~~~~~~~~~~~~Ll~~~gV~v~pG~~Fg~~~~iRis~~~~~e~l~~al~rl~~~l~  397 (400)
T Consensus       320 Gg~ylw~~~~~~~~~-----~~~~~~~~~~~~ll~~~gV~v~PG~~Fg~~~~~Rl~fa~~~~~l~eal~RL~~~l~  390 (390)
T PRK08069        320 GAFYLFPNVKEAAAL-----SGFETVDEFVKALLEEEKVALVPGSGFGAPDNVRLSYATSLELLEEAIERIHRFMK  390 (390)
T ss_pred             EEEEEEEECCHHHCC-----CCCCCHHHHHHHHHHHCCEEEECCCCCCCCCCEEEEEECCHHHHHHHHHHHHHHHC
T ss_conf             038997877311122-----67888999999999859999981876799983899984999999999999999859