HHsearch alignment for GI: 254780602 and conserved domain: PRK08088

>PRK08088 4-aminobutyrate aminotransferase; Validated.
Probab=99.49  E-value=7.2e-13  Score=98.44  Aligned_cols=350  Identities=13%  Similarity=0.121  Sum_probs=180.9

Q ss_pred             HCCCCEEECCCCCC--CCC-CCHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCC
Q ss_conf             86997266565897--498-899999999999838875699877898999999998642101333322332334543333
Q gi|254780602|r   28 SKGIDVLCLTAGEP--DFD-MPENVKYAVVRAMERGETKYTAVAGISPLREAIVEKFRRDNDLHYTSDQIIVGTGAKHVI  104 (400)
Q Consensus        28 ~~g~~ii~l~~G~p--~~~-~p~~i~~a~~~al~~~~~~Y~~~~G~~~lR~aia~~~~~~~g~~~~~e~I~it~G~~~~l  104 (400)
T Consensus        39 ~dG~~YLD~~~g~~~~~lGH~hp~i~~Av~~q~~~l~~~~~~~~~~-~~~~~lae~l~~~~p~~~-~~~v~f~~sGsEAv  116 (426)
T PRK08088         39 VEGREYIDFAGGIAVLNTGHLHPKVVAAVEAQLKKLSHTCFQVLAY-EPYLELCEKMNQKVPGDF-AKKTLLVTTGSEAV  116 (426)
T ss_pred             CCCCEEEECCCCHHHHHCCCCCHHHHHHHHHHHHHCCCCCCCCCCC-HHHHHHHHHHHHHCCCCC-CCEEEECCCHHHHH
T ss_conf             9989999915168865108996999999999986478856775566-799999999998577555-65588549769999


Q ss_pred             CCCCCCCC-CCC-CCCCCCCCCCCCCCCCC-CCCCC---------------CCCCCCCCCCCCC-CCHHHHHHCCCC---
Q ss_conf             22222223-322-32222333323222222-22222---------------2222222222322-210333100012---
Q gi|254780602|r  105 FNALMATV-NMG-DEVLIPRPYWVSYPDMV-ALCGG---------------IPVFVDTQQDDNF-QVSPEKLEQAIT---  162 (400)
Q Consensus       105 ~~~~~~~~-~~G-d~Vlv~~P~y~~y~~~~-~~~g~---------------~~~~v~~~~~~~~-~~d~~~l~~~i~---  162 (400)
T Consensus       117 e~AiklAR~~tgr~~ii~~~~syHG~t~~a~s~tg~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~  196 (426)
T PRK08088        117 ENAVKIARAATKRSGVIAFTGAYHGRTHYTLALTGKVNPYSAGMGLMPGHVYRALYPCPLHGVSEDDAIASIERIFKNDA  196 (426)
T ss_pred             HHHHHHHHHHHCCCCEEEECCCCCCCCCCHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCC
T ss_conf             99999987764366636635774898521254248877766778899987402668862357881679999999997447


Q ss_pred             --CCCCCEEECCC-CCCCCC-CCCCCCCCCCCCCCCCCCCCEEECCCCCCCCCCCCCCCC-CCCCCCCCCCCEEEEECCC
Q ss_conf             --21220121135-421000-012333321112233333201110122110000012233-2221112333225741465
Q gi|254780602|r  163 --PKTKWLFLNSP-SNPSGV-VYSQNRLRALADVLVRNPHVHIISDDIYEHIVYRNCQFS-NIVNVEPSLYERTLVVNGV  237 (400)
Q Consensus       163 --~~~k~i~l~nP-~NPTG~-v~s~~~l~~i~~~~a~~~~i~ii~De~Y~~l~~~~~~~~-s~~~~~~~~~~~~i~~~S~  237 (400)
T Consensus       197 ~~~~iAAvi~-EPi~g~gG~~~~~~~yl~~lr~lc-~~~g~llI~DEV~tGfGRtG~~fa~~~~gv~PD-----ii--~~  267 (426)
T PRK08088        197 APEDIAAIII-EPVQGEGGFYAASPAFMQRLRALC-DQHGIMLIADEVQTGAGRTGTFFAMEQMGVAAD-----LT--TF  267 (426)
T ss_pred             CCCCEEEEEE-CCCCCCCCCEECCHHHHHHHHHHH-HHCCCEEECCCCCCCCCCCCCHHHHHHCCCCCC-----EE--EH
T ss_conf             8776789997-775677886638879999999999-876905876330228776674135664198976-----20--12


Q ss_pred             CCCCCCCCCCCCCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCC--CCCCCCCCCCCCCCCCCHHHHHHC----
Q ss_conf             44322344544422110122687531001222332222222222223467--643222222110000000245530----
Q gi|254780602|r  238 SKAYAMTGLRIGYAAGALSLIKSMIVLQGQQTSGACSIAQWAAVEALNGP--QDFVVNNRKIFEYRRDLCVAQLQG----  311 (400)
Q Consensus       238 SK~~~~~G~RiG~~v~~~~li~~l~~~~~~~~~~~~~~~q~a~~~~l~~~--~~~~~~~~~~~~~~r~~~~~~L~~----  311 (400)
T Consensus       268 gK~l~-gG~Plsav~~~~~i~~~~~~~~~~~T~~gnpla~Aaa~a~L~~l~~e~l~~~~----~~~G~~l~~~L~~l~~~  342 (426)
T PRK08088        268 AKSIA-GGFPLAGVTGRAEVMDAIAPGGLGGTYAGNPIACAAALAVLEVFEEENLLQRA----NALGERLKDGLLAIAEK  342 (426)
T ss_pred             HHHHC-CCCCCCCEEECHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCHHHHH----HHHHHHHHHHHHHHHHH
T ss_conf             14403-88875000003999953368887888898989999999999999865899999----99999999999999860


Q ss_pred             CCCCEEEECCCCEEEEEECCCCCCCCCCCCCCCCCHHHHHHHHHHHCCEEEECCCCCCCCCEEEEE--EECCHHHHHHHH
Q ss_conf             477603302740899862641023321133224898999999998739799835022899728999--629999999999
Q gi|254780602|r  312 VPGIRYMIPDGAFYLYPSCQDLIGKKSPSGDVIRTDLDFVNGLLEIEKVAVVQGSSFGHGPSIRIS--YAVSDAILEEAC  389 (400)
Q Consensus       312 ~~g~~~~~p~g~~y~~~~~~~~~~~~~~~~~~~~~~~~~~~~Ll~~~gV~v~pG~~Fg~~~~iRis--~~~~~e~l~~al  389 (400)
T Consensus       343 ~p~i~~VRG~G-Lm~gvelv~~~~~~~p~---~~~~~~i~~~~-~~~Gll~~~~g~~--gnvir~~PPL~it~~eid~~~  415 (426)
T PRK08088        343 HPEIGDVRGLG-AMIAIELFEDGDHSKPA---AKLTAQIVARA-RDKGLILLSCGTY--YNVLRILVPLTIEDAQIRQGL  415 (426)
T ss_pred             CCCEEEEEECC-EEEEEEEEECCCCCCCC---HHHHHHHHHHH-HHCCCEEEECCCC--CCEEEEECCEECCHHHHHHHH
T ss_conf             99889999445-59999986068767878---99999999999-9689999833899--998999789347899999999


Q ss_pred             HHHHHHHHHCC
Q ss_conf             99999998609
Q gi|254780602|r  390 VRIKRFCHSLQ  400 (400)
Q Consensus       390 ~rl~~~l~~l~  400 (400)
T Consensus       416 ~~l~~al~ea~  426 (426)
T PRK08088        416 EIIAQCFDEAK  426 (426)
T ss_pred             HHHHHHHHHHC
T ss_conf             99999999539