HHsearch alignment for GI: 254780602 and conserved domain: TIGR00707

>TIGR00707 argD acetylornithine and succinylornithine aminotransferases; InterPro: IPR004636 This family of proteins, for which ornithine aminotransferases form an outgroup, consists mostly of proteins designated acetylornithine aminotransferase. However, the two very closely related members from Escherichia coli are assigned different enzymatic activities. One is acetylornithine aminotransferase (2.6.1.11 from EC), ArgD, an enzyme of arginine biosynthesis, while another is succinylornithine aminotransferase, an enzyme of the arginine succinyltransferase pathway, an ammonia-generating pathway of arginine catabolism . Members of this family may also act on ornithine, like ornithine aminotransferase (2.6.1.13 from EC) and on succinyldiaminopimelate, like N-succinyldiaminopmelate-aminotransferase (2.6.1.17 from EC, DapC, an enzyme of lysine biosynthesis) . ; GO: 0008483 transaminase activity, 0006525 arginine metabolic process.
Probab=99.35  E-value=6.2e-12  Score=92.76  Aligned_cols=338  Identities=17%  Similarity=0.171  Sum_probs=193.6

Q ss_pred             CCCCEEEC--CCCCCCCC-CCHHHHHHHHHHHHC---CCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCC
Q ss_conf             69972665--65897498-899999999999838---8756998778989999999986421013333223323345433
Q gi|254780602|r   29 KGIDVLCL--TAGEPDFD-MPENVKYAVVRAMER---GETKYTAVAGISPLREAIVEKFRRDNDLHYTSDQIIVGTGAKH  102 (400)
Q Consensus        29 ~g~~ii~l--~~G~p~~~-~p~~i~~a~~~al~~---~~~~Y~~~~G~~~lR~aia~~~~~~~g~~~~~e~I~it~G~~~  102 (400)
T Consensus        27 ~GK~YlDf~aGIAV~~LGH~hP~l~Ea~~~Q~~kL~H~SNlY~~~~~-~~LA~kLv~~~~~dgG-qhd~~rvFFCNSGaE  104 (402)
T TIGR00707        27 NGKEYLDFVAGIAVNALGHAHPKLVEALKEQLEKLVHVSNLYYTEPQ-EELAEKLVEHSGADGG-QHDASRVFFCNSGAE  104 (402)
T ss_pred             CCCEEEEECCCHHHHCCCCCCHHHHHHHHHHHHHHEEECCCCCCCHH-HHHHHHHHHHHHCCCC-CCCCCEEEEECCHHH
T ss_conf             89465201002244011357889999999866240660776558089-9999999999704688-302326675147478


Q ss_pred             CCCCCCCCC---CC----CCCCCCCCCCCCCCCCCCCCC-CCCCCC----CCCCCCCCCCCC--H-HHHHHCCCCCC---
Q ss_conf             332222222---33----223222233332322222222-222222----222222232221--0-33310001221---
Q gi|254780602|r  103 VIFNALMAT---VN----MGDEVLIPRPYWVSYPDMVAL-CGGIPV----FVDTQQDDNFQV--S-PEKLEQAITPK---  164 (400)
Q Consensus       103 ~l~~~~~~~---~~----~Gd~Vlv~~P~y~~y~~~~~~-~g~~~~----~v~~~~~~~~~~--d-~~~l~~~i~~~---  164 (400)
T Consensus       105 AnEAAlKlARk~~~~~g~~k~~ivaf~naFHG-RT~g~LsaTgqpKy~~~F~PLvpgf~y~~yNDe~~~l~~~i~~~~eg  183 (402)
T TIGR00707       105 ANEAALKLARKYTGDKGKEKKKIVAFENAFHG-RTMGALSATGQPKYQKPFEPLVPGFKYVPYNDEIEALKEAIDDEKEG  183 (402)
T ss_pred             HHHHHHHHHHHHHHCCCCCCCEEEEEEECCCC-CHHHHHHCCCCCCCCCCCCCCCCCCEEECCCCCHHHHHHHHHCCCCC
T ss_conf             99999999898640227886538888707763-00454300477645685788423812444889789999985025778


Q ss_pred             --CCCEEECCC-CCCCCC-CCCCCCCCCCCCCCCCCCCCEEECCCCCCCCCCCCCCC-CCCCC--CCCCCCCEEEEECCC
Q ss_conf             --220121135-421000-01233332111223333320111012211000001223-32221--112333225741465
Q gi|254780602|r  165 --TKWLFLNSP-SNPSGV-VYSQNRLRALADVLVRNPHVHIISDDIYEHIVYRNCQF-SNIVN--VEPSLYERTLVVNGV  237 (400)
Q Consensus       165 --~k~i~l~nP-~NPTG~-v~s~~~l~~i~~~~a~~~~i~ii~De~Y~~l~~~~~~~-~s~~~--~~~~~~~~~i~~~S~  237 (400)
T Consensus       184 ~rtAAvivE-piQGEgGV~pa~~~fL~a~r~lc~~-~~~LLI~DEVQtG~GRTG~~fA~~Hygse~~PD----i~---T~  254 (402)
T TIGR00707       184 DRTAAVIVE-PIQGEGGVVPADKEFLKALRELCED-KDALLIFDEVQTGLGRTGKLFAYEHYGSEVEPD----II---TL  254 (402)
T ss_pred             CCEEEEEEE-EECCCCCCCCCCHHHHHHHHHHHHH-CCEEEEEEEEEECCCCCHHHHHHHCCCCCCCCH----HH---HH
T ss_conf             718899985-3217865334877899999999864-891899944752877433223312068845523----87---54


Q ss_pred             CCCCCCCCCCCCCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHCCC----
Q ss_conf             4432234454442211012268753100122233222222222222346764322222211000000024553047----
Q gi|254780602|r  238 SKAYAMTGLRIGYAAGALSLIKSMIVLQGQQTSGACSIAQWAAVEALNGPQDFVVNNRKIFEYRRDLCVAQLQGVP----  313 (400)
Q Consensus       238 SK~~~~~G~RiG~~v~~~~li~~l~~~~~~~~~~~~~~~q~a~~~~l~~~~~~~~~~~~~~~~~r~~~~~~L~~~~----  313 (400)
T Consensus       255 AKgLG-gG~PiGA~~~~e~~a~~~~~G~HGsTFGGNPLAc~Aa~~vl~~i~~--~~~l~~v~~~G~~f~~~L~~~~~~~~  331 (402)
T TIGR00707       255 AKGLG-GGVPIGAVLAKEEVAEALTPGDHGSTFGGNPLACAAALAVLEVIEK--ERLLEKVKEKGDYFKERLEELIKKYI  331 (402)
T ss_pred             HHHHH-CCCHHHHHEEHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHHC--CCHHHHHHHHHHHHHHHHHHHCCCCC
T ss_conf             05552-7820223202367873158989866678738999998776665505--10478999988999999998617766


Q ss_pred             -CCEEEECCCCEEEEEECCCCCCCCCCCCCCCCCHHHHHHHHHHHCCEEEECCCCCCCCCEEEEE--EECCHHHHHHHHH
Q ss_conf             -7603302740899862641023321133224898999999998739799835022899728999--6299999999999
Q gi|254780602|r  314 -GIRYMIPDGAFYLYPSCQDLIGKKSPSGDVIRTDLDFVNGLLEIEKVAVVQGSSFGHGPSIRIS--YAVSDAILEEACV  390 (400)
Q Consensus       314 -g~~~~~p~g~~y~~~~~~~~~~~~~~~~~~~~~~~~~~~~Ll~~~gV~v~pG~~Fg~~~~iRis--~~~~~e~l~~al~  390 (400)
T Consensus       332 ~l~k~VRG~G-LmlG~e~~~---------~~-~~a~~~~~~-a~~~GlLv~~Ag----~~v~Rf~PPL~i~~e~i~~~~~  395 (402)
T TIGR00707       332 DLIKEVRGKG-LMLGIELEA---------PS-VAAKDIVKE-AREKGLLVNTAG----PKVLRFVPPLIITEEEIDEAVD  395 (402)
T ss_pred             CCEEEEECCE-EEEEEEECC---------CC-CCHHHHHHH-HHHCCCEEECCC----CCEEEECCCCCCCHHHHHHHHH
T ss_conf             7401532312-346556427---------86-558999999-984892688178----8706615786445889999999


Q ss_pred             HHHHHHH
Q ss_conf             9999998
Q gi|254780602|r  391 RIKRFCH  397 (400)
Q Consensus       391 rl~~~l~  397 (400)
T Consensus       396 ~l~~~~~  402 (402)
T TIGR00707       396 ALEEAIE  402 (402)
T ss_pred             HHHHHHC
T ss_conf             9999829