HHsearch alignment for GI: 254780603 and conserved domain: pfam04407

>pfam04407 DUF531 Protein of unknown function (DUF531). Family of hypothetical archaeal proteins.
Probab=91.52  E-value=0.28  Score=26.76  Aligned_cols=136  Identities=22%  Similarity=0.197  Sum_probs=73.4

Q ss_pred             EEEEECCCCCHH-----HHHHHHHH---HHHHHCCCCCCCCCCCCCCHHHHH-----HHHHHHH--HHHCCCCCCCCCCC
Q ss_conf             688723432068-----89999999---864200110013686320000013-----4443333--21101222322112
Q gi|254780603|r  134 LLMVLDHVNDPH-----NIGAILRS---AVAFSCDGIITTKRYSPSESAVLA-----KSASGAL--EHIPYIRISNLTDA  198 (282)
Q Consensus       134 ~~i~ld~i~dp~-----NlG~I~Rt---a~a~g~~~vil~~~~~~~~~~~~~-----ras~Ga~--~~l~~~~~~~~~~~  198 (282)
T Consensus         2 lTl~LyNtYd~~k~~e~H~RaIARAapic~Af~~~LAL~~FP-~~~~~~el~~~v~~~TtIG~~G~yl~~L~~-~nr~~i   79 (174)
T pfam04407         2 LTLGLYNTYDKKKVHEAHYRAIARAAPICYAFGFHLALFGFP-FDMTPKELAEYVADKTTIGESGKYLLELAE-SNKLHV   79 (174)
T ss_pred             EEEEEEECCCCCCCCCHHHHHHHHHHHHHHHCCCCEEEECCC-CCCCHHHHHHHHHHCCCCCCCHHHHHHHHH-CCCEEE
T ss_conf             379998446877566089999984604766417877987798-877879999997642732776799999987-496789


Q ss_pred             CC----C-CCCCCCHHHHCC-CCCCCCC-----CCCCC-CCCEEEEECCCCCCCCHHHHHHCCCEEEECCCCCCCHHHHH
Q ss_conf             22----2-222100000001-2333221-----12236-89889997586789877999858939992789687437899
Q gi|254780603|r  199 LQ----K-MHSWGFQTIGLS-SDSKKPL-----EQEIK-NDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVS  266 (282)
Q Consensus       199 l~----~-~~~~~~~i~~~~-~~~~~~~-----~~~~~-~~~~~lv~G~E~~Gl~~~~~~~~d~~v~Ip~~~~~~SLNvs  266 (282)
T Consensus        80 ~d~p~k~fp~qfG~~IaTT~kPd~~K~~~p~eia~~~l~~~s~~lliGLGr~GLPk~i~~~a~yHldiT--gkgIsLETc  157 (174)
T pfam04407        80 IDFPKKGFPPQFGEVVATTSKPDEKKAITPEDVAREALRNKSFLLLIGLGRHGLPKELFESARYHLDIT--GKGVSLETC  157 (174)
T ss_pred             EECCCCCCCHHCCCEEEECCCCCCCCCCCHHHHHHHHHCCCCEEEEEEECCCCCHHHHHHHCHHHEEEC--CCCEEEEEC
T ss_conf             836300383320965887789984557897999998742886799994078888699986431106612--783136620


Q ss_pred             HHHHHHH
Q ss_conf             9999999
Q gi|254780603|r  267 NAAAVAL  273 (282)
Q Consensus       267 ~a~ai~l  273 (282)
T Consensus       158 TAiGaI~  164 (174)
T pfam04407       158 TAIGAIP  164 (174)
T ss_pred             HHHHHHH
T ss_conf             4561699