HHsearch alignment of GI: 254780603 and MMDB domain: 1k3r_A_1-84_161-268

>1k3r_A (A:1-84,A:161-268) Conserved protein MT0001; beta barrel, structural genomics, PSI, protein structure initiative; 2.30A {Methanothermobacterthermautotrophicus}
Probab=90.64  E-value=0.25  Score=26.68  Aligned_cols=112  Identities=17%  Similarity=0.244  Sum_probs=61.1

Q ss_pred             CHHHHHHHHHHHHHHHCCCCCCCCCCC----------------CCCHHHHHHHHHHHHHHHCCC--CCCC-CCCCCCCCC
Q ss_conf             068899999998642001100136863----------------200000134443333211012--2232-211222222
Q gi|254780603|r  143 DPHNIGAILRSAVAFSCDGIITTKRYS----------------PSESAVLAKSASGALEHIPYI--RISN-LTDALQKMH  203 (282)
Q Consensus       143 dp~NlG~I~Rta~a~g~~~vil~~~~~----------------~~~~~~~~ras~Ga~~~l~~~--~~~~-~~~~l~~~~  203 (282)
                      -..-+|-|.|.|+-|+++.|++=++..                +||=+|.+=--..-+-+.+++  .+.- ..+.-+.++
T Consensus        24 ~t~~~g~IARaa~if~Vdeivvy~d~~~~~~~~l~~iL~YletP~YLRk~lfp~~~~Lk~a~YWGy~Vr~~~~sL~~v~~  103 (192)
T 1k3r_A           24 KTYKVVLIARAASIFGVKRIVIYHDDADGEARFIRDILTYMDTPQYLRRKVFPIMRELKHVRYWGYEVLDTRRNLAESLK  103 (192)
T ss_dssp             HHHHHHHHHHHHHHTTCCEEEEEECSSCCCHHHHHHHHHHHHSCHHHHHHHCCCCGGGGGGSCCCCEEEEEEEEHHHHHH
T ss_pred             HHHHHHHHHHHHHHHCCCEEEEECCCCCCHHHHHHHHHHHHCCCHHHHHHHCCCCCCCCEECCCCEEEEEEECCHHHCCC
T ss_conf             99999999999982266679997589976668999998885288878875368985632306677699976231765631


Q ss_pred             CCCCH-HHHCCCCCCCCCCCC-------CCC-CCEEEEECCCCCCCCHHHHHHCCCEEE-ECCCC
Q ss_conf             21000-000012333221122-------368-988999758678987799985893999-27896
Q gi|254780603|r  204 SWGFQ-TIGLSSDSKKPLEQE-------IKN-DKIALILGAEGKGLRPKTQETATSMAH-LHMPG  258 (282)
Q Consensus       204 ~~~~~-i~~~~~~~~~~~~~~-------~~~-~~~~lv~G~E~~Gl~~~~~~~~d~~v~-Ip~~~  258 (282)
                      +.||- ++|++..|. ++.+.       ... +...+|||+=..||++.+   -|..+. +|..|
T Consensus       104 ~~~~dl~IgTS~~G~-~i~~~~~~l~~~~~~~~~~lvvFGgP~~Gl~~~l---fD~~iNt~P~Qg  164 (192)
T 1k3r_A          104 TVGADVVVATSRNAS-PITSILDEVKTRMRGAREAAILFGGPYKGLPEID---ADIWVNTLPGQC  164 (192)
T ss_dssp             HHCCSEEEEECTTSC-BTTTSHHHHHHHHTTCSEEEEECCCSSSCCCSCC---CSEEEBSSTTCS
T ss_pred             CCCCCEEEEECCCCC-CCHHHCCCCCCCCCCCCCEEEEECCCCCCCHHHH---CCEEEECCCCCC
T ss_conf             369985999799988-5201012212345678708999898656874342---684897389988