HHsearch alignment of GI: 254780603 and MMDB domain: 3kty_A_

>3kty_A (A:) Probable methyltransferase; alpha-beta-alpha sandwich, structural genomics, PSI-2, protein structure initiative; 2.30A {Bordetella pertussis}
Probab=100.00  E-value=7.6e-41  Score=253.04  Aligned_cols=151  Identities=19%  Similarity=0.229  Sum_probs=136.8

Q ss_pred             CCCCEEEEECCCCCHHHHHHHHHHHHHHHCCCCCCCCCCCC--CCHHHHHHHHHHHHHHHCCCC-CCCCCCCCCCCCCCC
Q ss_conf             66506887234320688999999986420011001368632--000001344433332110122-232211222222210
Q gi|254780603|r  130 RNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSP--SESAVLAKSASGALEHIPYIR-ISNLTDALQKMHSWG  206 (282)
Q Consensus       130 ~~~~~~i~ld~i~dp~NlG~I~Rta~a~g~~~vil~~~~~~--~~~~~~~ras~Ga~~~l~~~~-~~~~~~~l~~~~~~~  206 (282)
                      ...+++++||+++||+|+|+|+|||++||++.+++...+.+  |+++++.|+|+|+.+++++++ +.++.++++.++..+
T Consensus         7 ~~~~~~vvl~~v~~p~NiG~i~R~a~~fG~~~i~l~~~~~~~~~~~~~~~r~s~g~~~~~~~~~~~~~~~~~l~~~~~~~   86 (173)
T 3kty_A            7 AFSRVRFIXTQPSHPGNVGSAARAIKTXGFGELVLVAPRFPDXTAQPEAVALASGALDVLERAAVHDTLEEALAPVTLAF   86 (173)
T ss_dssp             HHTTEEEEEESCCCHHHHHHHHHHHHHTTCCCEEEESCSSTTGGGSHHHHHHHTTCHHHHHTCEEESCHHHHHTTCSEEE
T ss_pred             HHCCEEEEECCCCCCCHHHHHHHHHHHCCCCEEEEECCCCCCCCCCHHHHHHCCCCEEEEEEEEECCHHHHHHHHCCCCC
T ss_conf             13865999927989874999999999829988999899777778878898733876045444210332999985202221


Q ss_pred             CHHHHCCC------------CCCCCCCCCCCCCCEEEEECCCCCCCCHHHHHHCCCEEEECCCCCCCHHHHHHHHHHHHH
Q ss_conf             00000012------------333221122368988999758678987799985893999278968743789999999999
Q gi|254780603|r  207 FQTIGLSS------------DSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY  274 (282)
Q Consensus       207 ~~i~~~~~------------~~~~~~~~~~~~~~~~lv~G~E~~Gl~~~~~~~~d~~v~Ip~~~~~~SLNvs~a~ai~l~  274 (282)
                      +.++..+.            .+...+.+++++.+.+||||+|++|||+++++.||++|+|||.|.++|||||+|+||+||
T Consensus        87 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~lv~G~E~~Gls~~~l~~~d~~v~IP~~g~~~SLNvs~A~aI~l~  166 (173)
T 3kty_A           87 ALTTRVRDLGPPPCDIREAAGLARRHLDDTEAGVVAIVLGTERAGLTNAQIELCHRICHIPANPQYSSLNVAQALQLAAW  166 (173)
T ss_dssp             EEECC-----CCCEEHHHHHHHHHHHHHHSSSCCEEEEECCCC-CCCHHHHHTSSEEEECCCCSTTCCCCHHHHHHHHHH
T ss_pred             CHHHCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCHHHHHHCCEEEEECCCCCCCCEEHHHHHHHHHH
T ss_conf             00000122334323223433222333332146762899777567889899974797999418989982678999999999


Q ss_pred             HHHHHH
Q ss_conf             998761
Q gi|254780603|r  275 ITQNHF  280 (282)
Q Consensus       275 ~~~~~~  280 (282)
                      |+.||+
T Consensus       167 e~~rq~  172 (173)
T 3kty_A          167 ELRYAL  172 (173)
T ss_dssp             HHHHHH
T ss_pred             HHHHHH
T ss_conf             999975