BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780603|ref|YP_003065016.1| tRNA/rRNA methyltransferase
protein [Candidatus Liberibacter asiaticus str. psy62]
         (282 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780603|ref|YP_003065016.1| tRNA/rRNA methyltransferase protein [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040280|gb|ACT57076.1| tRNA/rRNA methyltransferase protein [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 282

 Score =  580 bits (1496), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 282/282 (100%), Positives = 282/282 (100%)

Query: 1   MNLISKKKSEKIFSLKDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAA 60
           MNLISKKKSEKIFSLKDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAA
Sbjct: 1   MNLISKKKSEKIFSLKDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAA 60

Query: 61  LNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAP 120
           LNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAP
Sbjct: 61  LNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAP 120

Query: 121 LLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSA 180
           LLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSA
Sbjct: 121 LLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSA 180

Query: 181 SGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGL 240
           SGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGL
Sbjct: 181 SGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGL 240

Query: 241 RPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHFAK 282
           RPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHFAK
Sbjct: 241 RPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHFAK 282


>gi|315121804|ref|YP_004062293.1| tRNA/rRNA methyltransferase protein [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495206|gb|ADR51805.1| tRNA/rRNA methyltransferase protein [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 300

 Score =  461 bits (1186), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 222/286 (77%), Positives = 251/286 (87%), Gaps = 4/286 (1%)

Query: 1   MNLISKKKSEKIFSLKDSHYAKLRRNHRDYKKMQSFNQK----SRHTSQPENLFLYGVHT 56
           M L+   K+ KI S KDSHYAKLRRN+RD KK+Q  NQK    ++H +Q  NLFLYG+HT
Sbjct: 15  MKLMPPNKNNKISSPKDSHYAKLRRNYRDRKKIQLINQKDTLQNKHITQANNLFLYGIHT 74

Query: 57  VSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLAL 116
           V AALNNP RKIFQLLAT+N+L RL+WDAN PHPFPVK V P TID+IVGKEAVHQGLAL
Sbjct: 75  VGAALNNPQRKIFQLLATRNSLTRLNWDANRPHPFPVKIVSPSTIDQIVGKEAVHQGLAL 134

Query: 117 ETAPLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVL 176
           ET PL SPTLD ++NSQL+++LDH+NDPHN+GAILRS+VAF C GIITT+RYSPSESAVL
Sbjct: 135 ETTPLSSPTLDTIQNSQLIIILDHINDPHNVGAILRSSVAFGCGGIITTRRYSPSESAVL 194

Query: 177 AKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAE 236
           AKSASGALEHIPYIRI NLTDAL K+H+W FQTIGLSS+S  PLE+EIK+DKIALILGAE
Sbjct: 195 AKSASGALEHIPYIRIGNLTDALHKIHAWQFQTIGLSSESNNPLEKEIKSDKIALILGAE 254

Query: 237 GKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHFAK 282
           GKGLR KTQETATS+AHL+MPGIIK+LNVSNAAAVALYITQNHFAK
Sbjct: 255 GKGLRQKTQETATSIAHLNMPGIIKSLNVSNAAAVALYITQNHFAK 300


>gi|15889284|ref|NP_354965.1| tRNA/rRNA metyltransferase [Agrobacterium tumefaciens str. C58]
 gi|15157117|gb|AAK87750.1| tRNA/rRNA metyltransferase [Agrobacterium tumefaciens str. C58]
          Length = 295

 Score =  297 bits (761), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 152/283 (53%), Positives = 195/283 (68%), Gaps = 14/283 (4%)

Query: 14  SLKDSHYAKLRRNHRDYKKM-------QSFNQKSRHTSQ-------PENLFLYGVHTVSA 59
           S +D+HYA LRR  RD K+        Q   +++R           P+ + LYG+HTV A
Sbjct: 10  STRDTHYATLRRAVRDAKRERGEIPTPQQPKRRNRGADDWKPPQLAPDQVHLYGLHTVRA 69

Query: 60  ALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETA 119
           AL+NP R++ +L  T NA ARLD       PFPV+ V PQ IDK++G EA+HQG+ LET 
Sbjct: 70  ALSNPQRQLIKLSVTLNAFARLDIGEADAQPFPVEIVSPQEIDKVLGPEAIHQGVMLETR 129

Query: 120 PLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKS 179
           PL    LDA++ S L++VLD V DPHN+GAI+RSAVAF+   +ITT R+SP+ES VLAKS
Sbjct: 130 PLPVKKLDALKKSPLILVLDQVTDPHNVGAIMRSAVAFNAGAVITTIRHSPTESGVLAKS 189

Query: 180 ASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKG 239
           ASGALE IPYI+I+NL D L ++H  GF ++GL S+   P+EQ     KIAL+LGAEGKG
Sbjct: 190 ASGALELIPYIQITNLADTLGELHKLGFFSVGLDSEGPAPIEQTFTGAKIALVLGAEGKG 249

Query: 240 LRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHFAK 282
           LR KT+ET +++A L MPG IK+LNVSNAAA+ALY TQ    K
Sbjct: 250 LRQKTRETVSALARLDMPGEIKSLNVSNAAAIALYATQQFLGK 292


>gi|325293360|ref|YP_004279224.1| tRNA/rRNA metyltransferase [Agrobacterium sp. H13-3]
 gi|325061213|gb|ADY64904.1| tRNA/rRNA metyltransferase [Agrobacterium sp. H13-3]
          Length = 295

 Score =  297 bits (760), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 152/283 (53%), Positives = 195/283 (68%), Gaps = 14/283 (4%)

Query: 14  SLKDSHYAKLRRNHRDYKKM-------QSFNQKSRHTSQ-------PENLFLYGVHTVSA 59
           S +D+HYA LRR  RD K+        Q   +++R           P+ + LYG+HTV A
Sbjct: 10  STRDTHYATLRRAVRDAKRERGEIPTPQQPKRRNRGAEDWKPPQLAPDQVHLYGLHTVRA 69

Query: 60  ALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETA 119
           AL+NP R++ +L  T NA ARLD       PFPV+ V PQ IDK++G EA+HQG+ LET 
Sbjct: 70  ALSNPERQLIKLSVTLNAFARLDIGEADAQPFPVEIVSPQDIDKVLGPEAIHQGVMLETR 129

Query: 120 PLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKS 179
           PL    LDA++ S L++VLD V DPHN+GAI+RSAVAF+   +ITT R+SP+ES VLAKS
Sbjct: 130 PLPVKKLDALKKSPLILVLDQVTDPHNVGAIMRSAVAFNAGAVITTIRHSPTESGVLAKS 189

Query: 180 ASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKG 239
           ASGALE IPYI+I+NL D L ++H  GF ++GL S+   P+EQ     KIAL+LGAEGKG
Sbjct: 190 ASGALELIPYIQITNLADTLGELHKLGFFSVGLDSEGPAPIEQTFTGAKIALVLGAEGKG 249

Query: 240 LRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHFAK 282
           LR KT+ET +++A L MPG IK+LNVSNAAA+ALY TQ    K
Sbjct: 250 LRQKTRETVSALARLDMPGEIKSLNVSNAAAIALYATQQFLGK 292


>gi|222148346|ref|YP_002549303.1| tRNA/rRNA metyltransferase [Agrobacterium vitis S4]
 gi|221735334|gb|ACM36297.1| tRNA/rRNA metyltransferase [Agrobacterium vitis S4]
          Length = 293

 Score =  291 bits (745), Expect = 6e-77,   Method: Compositional matrix adjust.
 Identities = 150/282 (53%), Positives = 197/282 (69%), Gaps = 13/282 (4%)

Query: 14  SLKDSHYAKLRRNHRDYKKMQSF-----NQKSRHTSQ--------PENLFLYGVHTVSAA 60
           S +DSHYA LRR  RD K+ +        QK R ++         P+ +FLYG+HTV AA
Sbjct: 10  SDRDSHYATLRRQVRDAKRERGEIPTPQPQKRRKSNADWTPPPIAPDQVFLYGLHTVRAA 69

Query: 61  LNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAP 120
           LNNP RK  +L  T+NAL RL+       PFPV+ V PQ +DK +G EA+HQG+ LET P
Sbjct: 70  LNNPERKPIKLSLTQNALVRLEIGPVDALPFPVEIVTPQDLDKHLGPEAIHQGVMLETRP 129

Query: 121 LLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSA 180
           L    L+A++ S LL+VLD V DPHN+GAI+R+AVAF    +ITT R+SP+ES VLAKSA
Sbjct: 130 LPPRRLEALKESPLLLVLDQVTDPHNVGAIMRTAVAFGAGAVITTMRHSPTESGVLAKSA 189

Query: 181 SGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGL 240
           SGALE IPYI+I+NL +AL ++H  GF +IGL S+  +PLE+    DK+AL+LG+EGKGL
Sbjct: 190 SGALELIPYIQITNLAEALGELHKLGFVSIGLDSEGPRPLEETFSGDKLALVLGSEGKGL 249

Query: 241 RPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHFAK 282
           R KT++T  ++A L MPG IK+LNVSNAAA+ALY ++    +
Sbjct: 250 RQKTRDTVNALARLDMPGEIKSLNVSNAAAIALYASRQFLLR 291


>gi|150396189|ref|YP_001326656.1| RNA methyltransferase [Sinorhizobium medicae WSM419]
 gi|150027704|gb|ABR59821.1| RNA methyltransferase, TrmH family, group 3 [Sinorhizobium medicae
           WSM419]
          Length = 291

 Score =  288 bits (738), Expect = 5e-76,   Method: Compositional matrix adjust.
 Identities = 148/280 (52%), Positives = 197/280 (70%), Gaps = 13/280 (4%)

Query: 14  SLKDSHYAKLRRNHRDYKKMQSFNQKSRHTSQ-------------PENLFLYGVHTVSAA 60
           S +D+HYA LRR HRD ++ +      R   +             P+ + LYG+HTV AA
Sbjct: 10  SARDTHYANLRRAHRDGRRERGEIPTPRQDKRGKPSADWKPPALAPDQVLLYGLHTVRAA 69

Query: 61  LNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAP 120
           L+NP R+I +L  T+NA ARLD   +   PFPV+TV PQ +D+I+G +A+HQG+ LET P
Sbjct: 70  LDNPERRIIRLSVTQNAAARLDLGDSAALPFPVETVTPQELDRILGPDAIHQGVMLETRP 129

Query: 121 LLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSA 180
           L    L+A+R+  L++VLD V DPHN+GAI+RSAVAF    +ITT R+SP+ES VLAKSA
Sbjct: 130 LPHRKLEALRDCPLILVLDQVTDPHNVGAIMRSAVAFDAGALITTMRHSPTESGVLAKSA 189

Query: 181 SGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGL 240
           SGALE IPYI+ISNL D + ++H+ GF TIGL S+  +PLE     DKIAL+LG+EGKGL
Sbjct: 190 SGALELIPYIQISNLADTIDELHALGFMTIGLDSEGPQPLEGTFAGDKIALVLGSEGKGL 249

Query: 241 RPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
           R KT++T  ++A L MPG IK+LNVSNAAA+A+Y  ++H 
Sbjct: 250 RQKTRQTVKALARLDMPGAIKSLNVSNAAAIAMYAARHHL 289


>gi|86357288|ref|YP_469180.1| tRNA/rRNA methyltransferase protein [Rhizobium etli CFN 42]
 gi|86281390|gb|ABC90453.1| probable tRNA/rRNA methyltransferase protein [Rhizobium etli CFN
           42]
          Length = 296

 Score =  288 bits (737), Expect = 6e-76,   Method: Compositional matrix adjust.
 Identities = 149/268 (55%), Positives = 191/268 (71%), Gaps = 16/268 (5%)

Query: 14  SLKDSHYAKLRRNHRDYKKMQSF-----NQKSRHTSQ--------PENLFLYGVHTVSAA 60
           S KD+HYA LRR HRD K+ +        QK R  ++        P+ ++LYG+HTV AA
Sbjct: 16  SAKDTHYANLRRAHRDAKRERGEIPTPQPQKRRRGAEDWKPPALAPDQVYLYGLHTVRAA 75

Query: 61  LNNPSRKIFQLLATKNALARLDWDAN-LPHPFPVKTVPPQTIDKIVGKEAVHQGLALETA 119
           L+NP RK  +L  T+NALARL+ D   L  PF +  V P  IDK++G EA+HQG+ LET 
Sbjct: 76  LDNPERKKIKLFTTQNALARLEIDVETLGIPFEI--VSPHEIDKVLGPEAIHQGVMLETR 133

Query: 120 PLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKS 179
           PL    L+A+++S LL+VLD V DPHN+GAI+RSAVAF+   +ITT+R+SP+ES VLAKS
Sbjct: 134 PLPVRRLEALKDSPLLLVLDQVTDPHNVGAIMRSAVAFNAGAVITTQRHSPTESGVLAKS 193

Query: 180 ASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKG 239
           ASGALE IPYI+I+NL DAL ++H  GF TIGL S+   PLE     DK+AL+LG+EGKG
Sbjct: 194 ASGALELIPYIQITNLADALGELHKLGFSTIGLDSEGPAPLEGTFSGDKVALVLGSEGKG 253

Query: 240 LRPKTQETATSMAHLHMPGIIKALNVSN 267
           LR KT+ET T++A L MPG IK+LNVSN
Sbjct: 254 LRQKTRETVTALARLDMPGAIKSLNVSN 281


>gi|153009269|ref|YP_001370484.1| RNA methyltransferase [Ochrobactrum anthropi ATCC 49188]
 gi|151561157|gb|ABS14655.1| RNA methyltransferase, TrmH family, group 3 [Ochrobactrum anthropi
           ATCC 49188]
          Length = 286

 Score =  288 bits (736), Expect = 8e-76,   Method: Compositional matrix adjust.
 Identities = 141/274 (51%), Positives = 189/274 (68%), Gaps = 10/274 (3%)

Query: 16  KDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPE---------NLFLYGVHTVSAALNNPSR 66
           KDSHYA+LRR HRD K + +  +  R   +P           + LYG+HTV AA+ NP R
Sbjct: 11  KDSHYARLRRQHRDQKAV-TEGKSPRKPQRPSISAGAVTEGTVRLYGLHTVRAAVENPER 69

Query: 67  KIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTL 126
           KI ++ AT+N  ARL+       PFPV+ V P+ IDK  G EAVHQG+ +E  PL +  L
Sbjct: 70  KILRMRATRNGFARLEIGEAESLPFPVEIVDPRDIDKETGSEAVHQGVMIEAEPLRARKL 129

Query: 127 DAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEH 186
             +++S LL+VLD V DPHN+GAI+RSAVAF    +ITT R+SP E+ VLAK+ASGALE 
Sbjct: 130 SELKDSPLLLVLDQVTDPHNVGAIMRSAVAFGAGALITTSRHSPQETGVLAKAASGALEM 189

Query: 187 IPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQE 246
           I +I + NL +A++++HS GFQTIGL S+  + +E  +   +IAL+LGAEGKGLR KT+E
Sbjct: 190 ISHIEVRNLAEAIEELHSLGFQTIGLDSEGPQEMEATLSGGRIALVLGAEGKGLRQKTRE 249

Query: 247 TATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
           T T++A L MPG IK+LNVSNAAA++LY  + + 
Sbjct: 250 TVTALARLDMPGEIKSLNVSNAAAISLYAAERYL 283


>gi|190891338|ref|YP_001977880.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Rhizobium etli CIAT
           652]
 gi|190696617|gb|ACE90702.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Rhizobium etli CIAT
           652]
          Length = 296

 Score =  287 bits (734), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 147/267 (55%), Positives = 190/267 (71%), Gaps = 14/267 (5%)

Query: 14  SLKDSHYAKLRRNHRDYKKMQSF-----NQKSRHTSQ--------PENLFLYGVHTVSAA 60
           S KD+HYA LRR HRD K+ +        QK +  ++        P+ ++LYG+HTV AA
Sbjct: 16  SAKDTHYANLRRAHRDAKRERGEIPTPQPQKRKRGAEDWKPPALAPDQVYLYGLHTVRAA 75

Query: 61  LNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAP 120
           L+NP RK  +L  T+NALARL+ D   P   P + V P  IDK++G EA+HQG+ LET P
Sbjct: 76  LDNPERKKIKLSVTQNALARLEIDIE-PLGIPFEIVAPHEIDKVLGPEAIHQGVMLETRP 134

Query: 121 LLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSA 180
           L    L+A+++S LL+VLD V DPHN+GAI+RSAVAF+   +ITT+R+SP+ES VLAKSA
Sbjct: 135 LPVRRLEALKDSPLLLVLDQVTDPHNVGAIMRSAVAFNAGAVITTQRHSPTESGVLAKSA 194

Query: 181 SGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGL 240
           SGALE IPYI+I+NL DAL ++H  GF TIGL S+   PLE     DK+AL+LG+EGKGL
Sbjct: 195 SGALELIPYIQITNLADALGELHKLGFSTIGLDSEGPAPLEGTFSGDKLALVLGSEGKGL 254

Query: 241 RPKTQETATSMAHLHMPGIIKALNVSN 267
           R KT+ET T++A L MPG IK+LNVSN
Sbjct: 255 RQKTRETVTALARLDMPGAIKSLNVSN 281


>gi|239832139|ref|ZP_04680468.1| RNA methyltransferase, TrmH family, group 3 [Ochrobactrum
           intermedium LMG 3301]
 gi|239824406|gb|EEQ95974.1| RNA methyltransferase, TrmH family, group 3 [Ochrobactrum
           intermedium LMG 3301]
          Length = 303

 Score =  286 bits (733), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 145/276 (52%), Positives = 192/276 (69%), Gaps = 14/276 (5%)

Query: 16  KDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPE---------NLFLYGVHTVSAALNNPSR 66
           KDSHYA+LRR HRD +K  +  +  R   +P           + LYG+HTV AA+ NP R
Sbjct: 28  KDSHYARLRRQHRD-QKAGTEGKSPRKPQRPSISASAVTEGTVRLYGLHTVRAAVENPER 86

Query: 67  KIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTL 126
           +I ++LAT+N  ARL+       PFPV+ V P+ IDK  G EAVHQG+ +E  PL +  L
Sbjct: 87  RILRMLATRNGFARLEIGEAESLPFPVEIVEPRDIDKETGSEAVHQGVMIEAEPLRARKL 146

Query: 127 DAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEH 186
             +++S LL+VLD V DPHN+GAI+RSAVAF    +ITT R+SP E+ VLAK+ASGALE 
Sbjct: 147 SELKDSPLLLVLDQVTDPHNVGAIMRSAVAFGAGALITTSRHSPQETGVLAKAASGALEL 206

Query: 187 IPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQE--IKNDKIALILGAEGKGLRPKT 244
           I +I + NL +A++++HS GFQTIGL  DS+ PLE E  +   +IAL+LGAEGKGLR KT
Sbjct: 207 ISHIEVRNLAEAIEELHSLGFQTIGL--DSEGPLEMEATLSGGRIALVLGAEGKGLRQKT 264

Query: 245 QETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
           +ET T++A L MPG IK+LNVSNAAA++LY  + + 
Sbjct: 265 RETVTALARLDMPGEIKSLNVSNAAAISLYAAERYL 300


>gi|254719306|ref|ZP_05181117.1| RNA methyltransferase, TrmH family, group 3 [Brucella sp. 83/13]
 gi|265984307|ref|ZP_06097042.1| RNA methyltransferase [Brucella sp. 83/13]
 gi|306839077|ref|ZP_07471894.1| RNA methyltransferase, TrmH family, group 3 [Brucella sp. NF 2653]
 gi|264662899|gb|EEZ33160.1| RNA methyltransferase [Brucella sp. 83/13]
 gi|306405624|gb|EFM61886.1| RNA methyltransferase, TrmH family, group 3 [Brucella sp. NF 2653]
          Length = 286

 Score =  286 bits (733), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 146/276 (52%), Positives = 191/276 (69%), Gaps = 14/276 (5%)

Query: 16  KDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPE---------NLFLYGVHTVSAALNNPSR 66
           KDSHYA+LRR HRD +K  +  +  R   +P           + LYG+HTV AA+ NP R
Sbjct: 11  KDSHYARLRRQHRD-QKAGAEGKSPRKPQRPAIAASAVAEGTVRLYGLHTVRAAVENPQR 69

Query: 67  KIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTL 126
           KI ++ AT+N  ARL+       PFPV+ V P+ IDK  G EAVHQG+ +E  PL +  L
Sbjct: 70  KILRMRATRNGFARLEIGEADSLPFPVEIVDPRDIDKETGSEAVHQGVMIEAEPLRARKL 129

Query: 127 DAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEH 186
             +R S LL+VLD V DPHN+GAI+RSAVAF    +ITT R+SP ES VLAK+ASGALE 
Sbjct: 130 SELRESPLLLVLDQVTDPHNVGAIMRSAVAFGAGALITTSRHSPQESGVLAKAASGALEL 189

Query: 187 IPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQE--IKNDKIALILGAEGKGLRPKT 244
           I +I + NL +A++++H+ GFQTIGL  DS+ PLE E  +  ++IAL+LGAEGKGLR KT
Sbjct: 190 IAHIEVRNLAEAIEELHTLGFQTIGL--DSQGPLEMEATLSGNRIALVLGAEGKGLRQKT 247

Query: 245 QETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
           +ET T++A L MPG IK+LNVSNAAA++LY  + + 
Sbjct: 248 RETVTALARLDMPGEIKSLNVSNAAAISLYAAERYL 283


>gi|62290163|ref|YP_221956.1| RNA methyltransferase [Brucella abortus bv. 1 str. 9-941]
 gi|189024398|ref|YP_001935166.1| RNA methyltransferase, TrmH family, group 3 [Brucella abortus S19]
 gi|254689467|ref|ZP_05152721.1| RNA methyltransferase, TrmH family, group 3 [Brucella abortus bv. 6
           str. 870]
 gi|254697605|ref|ZP_05159433.1| RNA methyltransferase, TrmH family, group 3 [Brucella abortus bv. 2
           str. 86/8/59]
 gi|254730496|ref|ZP_05189074.1| RNA methyltransferase, TrmH family, group 3 [Brucella abortus bv. 4
           str. 292]
 gi|256257714|ref|ZP_05463250.1| RNA methyltransferase, TrmH family, group 3 [Brucella abortus bv. 9
           str. C68]
 gi|260546707|ref|ZP_05822446.1| RNA methyltransferase [Brucella abortus NCTC 8038]
 gi|260754991|ref|ZP_05867339.1| RNA methyltransferase [Brucella abortus bv. 6 str. 870]
 gi|260758207|ref|ZP_05870555.1| RNA methyltransferase [Brucella abortus bv. 4 str. 292]
 gi|260762034|ref|ZP_05874377.1| RNA methyltransferase [Brucella abortus bv. 2 str. 86/8/59]
 gi|260884001|ref|ZP_05895615.1| RNA methyltransferase [Brucella abortus bv. 9 str. C68]
 gi|62196295|gb|AAX74595.1| RNA methyltransferase, TrmH family, group 3 [Brucella abortus bv. 1
           str. 9-941]
 gi|189019970|gb|ACD72692.1| RNA methyltransferase, TrmH family, group 3 [Brucella abortus S19]
 gi|260095757|gb|EEW79634.1| RNA methyltransferase [Brucella abortus NCTC 8038]
 gi|260668525|gb|EEX55465.1| RNA methyltransferase [Brucella abortus bv. 4 str. 292]
 gi|260672466|gb|EEX59287.1| RNA methyltransferase [Brucella abortus bv. 2 str. 86/8/59]
 gi|260675099|gb|EEX61920.1| RNA methyltransferase [Brucella abortus bv. 6 str. 870]
 gi|260873529|gb|EEX80598.1| RNA methyltransferase [Brucella abortus bv. 9 str. C68]
          Length = 286

 Score =  286 bits (732), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 145/276 (52%), Positives = 192/276 (69%), Gaps = 14/276 (5%)

Query: 16  KDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPE---------NLFLYGVHTVSAALNNPSR 66
           KDSHYA+LRR HRD +K  +  +  R   +P           + LYG+HTV AA+ NP R
Sbjct: 11  KDSHYARLRRQHRD-QKAGAEGKSPRKPQRPAIAASAVAEGTVRLYGLHTVRAAVENPQR 69

Query: 67  KIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTL 126
           KI ++ AT+N  ARL+   +   PFPV+ V P+ IDK  G EAVHQG+ +E  PL +  L
Sbjct: 70  KILRMRATRNGFARLEIGESDSLPFPVEIVDPRDIDKETGSEAVHQGVMIEAEPLRTRKL 129

Query: 127 DAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEH 186
             +R S LL+VLD V DPHN+GAI+RSAVAF    +ITT R+SP E+ VLAK+ASGALE 
Sbjct: 130 SELRESPLLLVLDQVTDPHNVGAIMRSAVAFGAGALITTSRHSPQETGVLAKAASGALEL 189

Query: 187 IPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQE--IKNDKIALILGAEGKGLRPKT 244
           I +I + NL +A++++H+ GFQTIGL  DS+ PLE E  +  ++IAL+LGAEGKGLR KT
Sbjct: 190 IAHIEVRNLAEAIEELHTLGFQTIGL--DSQGPLEMEATLSGNRIALVLGAEGKGLRQKT 247

Query: 245 QETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
           +ET T++A L MPG IK+LNVSNAAA++LY  + + 
Sbjct: 248 RETVTALARLDMPGEIKSLNVSNAAAISLYAAERYL 283


>gi|237815670|ref|ZP_04594667.1| RNA methyltransferase, TrmH family, group 3 [Brucella abortus str.
           2308 A]
 gi|297248557|ref|ZP_06932275.1| TrmH family RNA methyltransferase [Brucella abortus bv. 5 str.
           B3196]
 gi|237788968|gb|EEP63179.1| RNA methyltransferase, TrmH family, group 3 [Brucella abortus str.
           2308 A]
 gi|297175726|gb|EFH35073.1| TrmH family RNA methyltransferase [Brucella abortus bv. 5 str.
           B3196]
          Length = 303

 Score =  286 bits (732), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 145/276 (52%), Positives = 192/276 (69%), Gaps = 14/276 (5%)

Query: 16  KDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPE---------NLFLYGVHTVSAALNNPSR 66
           KDSHYA+LRR HRD +K  +  +  R   +P           + LYG+HTV AA+ NP R
Sbjct: 28  KDSHYARLRRQHRD-QKAGAEGKSPRKPQRPAIAASAVAEGTVRLYGLHTVRAAVENPQR 86

Query: 67  KIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTL 126
           KI ++ AT+N  ARL+   +   PFPV+ V P+ IDK  G EAVHQG+ +E  PL +  L
Sbjct: 87  KILRMRATRNGFARLEIGESDSLPFPVEIVDPRDIDKETGSEAVHQGVMIEAEPLRTRKL 146

Query: 127 DAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEH 186
             +R S LL+VLD V DPHN+GAI+RSAVAF    +ITT R+SP E+ VLAK+ASGALE 
Sbjct: 147 SELRESPLLLVLDQVTDPHNVGAIMRSAVAFGAGALITTSRHSPQETGVLAKAASGALEL 206

Query: 187 IPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQE--IKNDKIALILGAEGKGLRPKT 244
           I +I + NL +A++++H+ GFQTIGL  DS+ PLE E  +  ++IAL+LGAEGKGLR KT
Sbjct: 207 IAHIEVRNLAEAIEELHTLGFQTIGL--DSQGPLEMEATLSGNRIALVLGAEGKGLRQKT 264

Query: 245 QETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
           +ET T++A L MPG IK+LNVSNAAA++LY  + + 
Sbjct: 265 RETVTALARLDMPGEIKSLNVSNAAAISLYAAERYL 300


>gi|148559141|ref|YP_001259170.1| RNA methyltransferase [Brucella ovis ATCC 25840]
 gi|148370398|gb|ABQ60377.1| RNA methyltransferase, TrmH family, group 3 [Brucella ovis ATCC
           25840]
          Length = 303

 Score =  286 bits (732), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 145/276 (52%), Positives = 191/276 (69%), Gaps = 14/276 (5%)

Query: 16  KDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPE---------NLFLYGVHTVSAALNNPSR 66
           KDSHYA+LRR HRD +K  +  +  R   +P           + LYG+HTV AA+ NP R
Sbjct: 28  KDSHYARLRRQHRD-QKAGAEGKSPRKPQRPAIAASAVAEGTVRLYGLHTVRAAVENPQR 86

Query: 67  KIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTL 126
           KI ++ AT+N  ARL+       PFPV+ V P+ IDK  G EAVHQG+ +E  PL +  L
Sbjct: 87  KILRMRATRNGFARLEIGEADSLPFPVEIVDPRDIDKETGSEAVHQGVMIEAEPLRTRKL 146

Query: 127 DAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEH 186
             +R S LL+VLD V DPHN+GAI+RSAVAF    +ITT R+SP E+ VLAK+ASGALE 
Sbjct: 147 SELRESPLLLVLDQVTDPHNVGAIMRSAVAFGAGALITTSRHSPQETGVLAKAASGALEL 206

Query: 187 IPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEI--KNDKIALILGAEGKGLRPKT 244
           I +I + NL +A++++H+ GFQTIGL  DS+ PLE E+    ++IAL+LGAEGKGLR KT
Sbjct: 207 IAHIEVRNLAEAIEELHTLGFQTIGL--DSQGPLEMEVTLSGNRIALVLGAEGKGLRQKT 264

Query: 245 QETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
           +ET T++A L MPG IK+LNVSNAAA++LY  + + 
Sbjct: 265 RETVTALARLDMPGEIKSLNVSNAAAISLYAAERYL 300


>gi|260460674|ref|ZP_05808924.1| RNA methyltransferase, TrmH family, group 3 [Mesorhizobium
           opportunistum WSM2075]
 gi|259033251|gb|EEW34512.1| RNA methyltransferase, TrmH family, group 3 [Mesorhizobium
           opportunistum WSM2075]
          Length = 282

 Score =  286 bits (731), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 150/272 (55%), Positives = 187/272 (68%), Gaps = 6/272 (2%)

Query: 9   SEKIFSLKDSHYAKLRRNHRDYKKMQSFNQKSRHTSQP-EN-----LFLYGVHTVSAALN 62
           S K  + KD+HYAKLRR  RD K   +   K R    P EN     + LYG+HTV AAL+
Sbjct: 2   SNKTNTPKDTHYAKLRRAFRDEKSGGAPAFKPRQPVPPGENAGDGLVRLYGLHTVRAALD 61

Query: 63  NPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLL 122
           NP R+I ++L T+NA  RL+       PF  + V P+ IDKI G +AVHQG+ +E  PL 
Sbjct: 62  NPRRRIKKMLVTRNAAERLEIADLAALPFSAELVEPRDIDKITGSDAVHQGVLIEAEPLK 121

Query: 123 SPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASG 182
              LDA+ +++L++VLD V DPHN+GAILRSAVAF    +ITT R+SP ES VLAKSASG
Sbjct: 122 PKRLDALGDTKLVLVLDQVTDPHNVGAILRSAVAFGAGALITTARHSPQESGVLAKSASG 181

Query: 183 ALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRP 242
           ALEHI  I + NL DAL ++H  GFQTIGL SD    LE     D++AL+LGAEGKGLR 
Sbjct: 182 ALEHIDQIEVKNLADALGQLHEAGFQTIGLDSDGPAELETSFAGDRVALVLGAEGKGLRQ 241

Query: 243 KTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
           KT+ET T++A L MPG I++LNVSNAAAV+LY
Sbjct: 242 KTRETVTTLARLDMPGAIRSLNVSNAAAVSLY 273


>gi|15965091|ref|NP_385444.1| putative tRNA/rRNA methyltransferase protein [Sinorhizobium
           meliloti 1021]
 gi|307315061|ref|ZP_07594646.1| RNA methyltransferase, TrmH family, group 3 [Sinorhizobium meliloti
           BL225C]
 gi|15074271|emb|CAC45917.1| Putative tRNA/rRNA methyltransferase [Sinorhizobium meliloti 1021]
 gi|306898900|gb|EFN29550.1| RNA methyltransferase, TrmH family, group 3 [Sinorhizobium meliloti
           BL225C]
          Length = 291

 Score =  286 bits (731), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 147/280 (52%), Positives = 195/280 (69%), Gaps = 13/280 (4%)

Query: 14  SLKDSHYAKLRRNHRDYKKMQSFNQKSRHTSQ-------------PENLFLYGVHTVSAA 60
           S +D+HYA LRR HRD ++ +      R   +             P+ + LYG+HTV AA
Sbjct: 10  SARDTHYANLRRAHRDARRERGEIPTPRQDKRAKLSADWKPPALAPDQVLLYGLHTVRAA 69

Query: 61  LNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAP 120
           L+NP R+I +L  T+NA ARLD       PFP +TV PQ +D+I+G +A+HQG+ LET P
Sbjct: 70  LDNPERRIIRLSVTQNAAARLDLGDLTALPFPTETVMPQELDRILGPDAIHQGVMLETQP 129

Query: 121 LLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSA 180
           L    L+A+R+  L++VLD V DPHN+GAI+RSAVAF    +ITT R+SP+ES VLAKSA
Sbjct: 130 LPHRKLEALRDCPLILVLDQVTDPHNVGAIMRSAVAFDAGALITTMRHSPTESGVLAKSA 189

Query: 181 SGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGL 240
           SGALE IPYI+I+NL D L+++H  GF TIGL S+  +PLE     DKIAL+LG+EGKGL
Sbjct: 190 SGALELIPYIQITNLADTLEELHELGFMTIGLDSEGPQPLEGTFAGDKIALVLGSEGKGL 249

Query: 241 RPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
           R KT++T  ++A L MPG IK+LNVSNAAA+A+Y  ++H 
Sbjct: 250 RQKTRQTVKALARLDMPGAIKSLNVSNAAAIAMYAARHHL 289


>gi|307322674|ref|ZP_07602003.1| RNA methyltransferase, TrmH family, group 3 [Sinorhizobium meliloti
           AK83]
 gi|306891673|gb|EFN22530.1| RNA methyltransferase, TrmH family, group 3 [Sinorhizobium meliloti
           AK83]
          Length = 291

 Score =  286 bits (731), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 147/280 (52%), Positives = 195/280 (69%), Gaps = 13/280 (4%)

Query: 14  SLKDSHYAKLRRNHRDYKKMQSFNQKSRHTSQ-------------PENLFLYGVHTVSAA 60
           S +D+HYA LRR HRD ++ +      R   +             P+ + LYG+HTV AA
Sbjct: 10  SARDTHYANLRRAHRDARRERGEIPTPRQDKRGKPPADWKPPALAPDQVLLYGLHTVRAA 69

Query: 61  LNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAP 120
           L+NP R+I +L  T+NA ARLD       PFP +TV PQ +D+I+G +A+HQG+ LET P
Sbjct: 70  LDNPERRIIRLSVTQNAAARLDLGDLTALPFPTETVMPQELDRILGPDAIHQGVMLETQP 129

Query: 121 LLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSA 180
           L    L+A+R+  L++VLD V DPHN+GAI+RSAVAF    +ITT R+SP+ES VLAKSA
Sbjct: 130 LPHRKLEALRDCPLILVLDQVTDPHNVGAIMRSAVAFDAGALITTMRHSPTESGVLAKSA 189

Query: 181 SGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGL 240
           SGALE IPYI+I+NL D L+++H  GF TIGL S+  +PLE     DKIAL+LG+EGKGL
Sbjct: 190 SGALELIPYIQITNLADTLEELHELGFMTIGLDSEGPQPLEGTFAGDKIALVLGSEGKGL 249

Query: 241 RPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
           R KT++T  ++A L MPG IK+LNVSNAAA+A+Y  ++H 
Sbjct: 250 RQKTRQTVKALARLDMPGAIKSLNVSNAAAIAMYAARHHL 289


>gi|326409274|gb|ADZ66339.1| TrmH family RNA methyltransferase [Brucella melitensis M28]
 gi|326538984|gb|ADZ87199.1| RNA methyltransferase, TrmH family, group 3 [Brucella melitensis
           M5-90]
          Length = 303

 Score =  286 bits (731), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 145/276 (52%), Positives = 191/276 (69%), Gaps = 14/276 (5%)

Query: 16  KDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPE---------NLFLYGVHTVSAALNNPSR 66
           KDSHYA+LRR HRD +K  +  +  R   +P           + LYG+HTV AA+ NP R
Sbjct: 28  KDSHYARLRRQHRD-QKAGAEGKSPRKPQRPAIAASAVAEGTVRLYGLHTVRAAVENPQR 86

Query: 67  KIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTL 126
           KI ++ AT+N  ARL+       PFPV+ V P+ IDK  G EAVHQG+ +E  PL +  L
Sbjct: 87  KILRMRATRNGFARLEIGEADSLPFPVEIVDPRDIDKETGSEAVHQGVMIEAEPLRTRKL 146

Query: 127 DAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEH 186
             +R S LL+VLD V DPHN+GAI+RSAVAF    +ITT R+SP E+ VLAK+ASGALE 
Sbjct: 147 SELRESPLLLVLDQVTDPHNVGAIMRSAVAFGAGALITTSRHSPQETGVLAKAASGALEL 206

Query: 187 IPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQE--IKNDKIALILGAEGKGLRPKT 244
           I +I + NL +A++++H+ GFQTIGL  DS+ PLE E  +  ++IAL+LGAEGKGLR KT
Sbjct: 207 IAHIEVRNLAEAIEELHTLGFQTIGL--DSQGPLEMEATLSGNRIALVLGAEGKGLRQKT 264

Query: 245 QETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
           +ET T++A L MPG IK+LNVSNAAA++LY  + + 
Sbjct: 265 RETVTALARLDMPGEIKSLNVSNAAAISLYAAERYL 300


>gi|225627720|ref|ZP_03785757.1| RNA methyltransferase, TrmH family, group 3 [Brucella ceti str.
           Cudo]
 gi|225617725|gb|EEH14770.1| RNA methyltransferase, TrmH family, group 3 [Brucella ceti str.
           Cudo]
          Length = 303

 Score =  285 bits (730), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 145/276 (52%), Positives = 191/276 (69%), Gaps = 14/276 (5%)

Query: 16  KDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPE---------NLFLYGVHTVSAALNNPSR 66
           KDSHYA+LRR HRD +K  +  +  R   +P           + LYG+HTV AA+ NP R
Sbjct: 28  KDSHYARLRRQHRD-QKAGAEGKSPRKPQRPAIAASAVAEGTVRLYGLHTVRAAVENPQR 86

Query: 67  KIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTL 126
           KI ++ AT+N  ARL+       PFPV+ V P+ IDK  G EAVHQG+ +E  PL +  L
Sbjct: 87  KILRMRATRNGFARLEIGEADSLPFPVEIVDPRDIDKETGSEAVHQGVMIEAEPLRTRKL 146

Query: 127 DAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEH 186
             +R S LL+VLD V DPHN+GAI+RSAVAF    +ITT R+SP E+ VLAK+ASGALE 
Sbjct: 147 SELRESPLLLVLDQVTDPHNVGAIMRSAVAFGAGALITTSRHSPQETGVLAKAASGALEL 206

Query: 187 IPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQE--IKNDKIALILGAEGKGLRPKT 244
           I +I + NL +A++++H+ GFQTIGL  DS+ PLE E  +  ++IAL+LGAEGKGLR KT
Sbjct: 207 IAHIEVRNLAEAIEELHTLGFQTIGL--DSQGPLEMEATLSGNRIALVLGAEGKGLRQKT 264

Query: 245 QETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
           +ET T++A L MPG IK+LNVSNAAA++LY  + + 
Sbjct: 265 RETVTALARLDMPGEIKSLNVSNAAAISLYAAERYL 300


>gi|306840281|ref|ZP_07473055.1| RNA methyltransferase, TrmH family, group 3 [Brucella sp. BO2]
 gi|306289808|gb|EFM60990.1| RNA methyltransferase, TrmH family, group 3 [Brucella sp. BO2]
          Length = 286

 Score =  285 bits (730), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 145/276 (52%), Positives = 191/276 (69%), Gaps = 14/276 (5%)

Query: 16  KDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPE---------NLFLYGVHTVSAALNNPSR 66
           KDSHYA+LRR HRD +K  +  +  R   +P           + LYG+HTV AA+ NP R
Sbjct: 11  KDSHYARLRRQHRD-QKAGAEGKSPRKPQRPTIAASAVAEGTVRLYGLHTVRAAVENPQR 69

Query: 67  KIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTL 126
           KI ++ AT+N  ARL+       PFPV+ V P+ IDK  G EAVHQG+ +E  PL +  L
Sbjct: 70  KILRMRATRNGFARLEIGEADSLPFPVEIVDPRDIDKETGSEAVHQGVMIEAEPLRTRKL 129

Query: 127 DAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEH 186
             +R S LL+VLD V DPHN+GAI+RSAVAF    +ITT R+SP E+ VLAK+ASGALE 
Sbjct: 130 SELRESPLLLVLDQVTDPHNVGAIMRSAVAFGAGALITTSRHSPQETGVLAKAASGALEL 189

Query: 187 IPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQE--IKNDKIALILGAEGKGLRPKT 244
           I +I + NL +A++++H+ GFQTIGL  DS+ PLE E  +  ++IAL+LGAEGKGLR KT
Sbjct: 190 IAHIEVRNLAEAIEELHTLGFQTIGL--DSQGPLEMEATLSGNRIALVLGAEGKGLRQKT 247

Query: 245 QETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
           +ET T++A L MPG IK+LNVSNAAA++LY  + + 
Sbjct: 248 RETVTALARLDMPGEIKSLNVSNAAAISLYAAERYL 283


>gi|23502131|ref|NP_698258.1| RNA methyltransferase [Brucella suis 1330]
 gi|161619208|ref|YP_001593095.1| RNA methyltransferase [Brucella canis ATCC 23365]
 gi|225852749|ref|YP_002732982.1| TrmH family RNA methyltransferase [Brucella melitensis ATCC 23457]
 gi|254693953|ref|ZP_05155781.1| RNA methyltransferase, TrmH family, group 3 [Brucella abortus bv. 3
           str. Tulya]
 gi|254701991|ref|ZP_05163819.1| RNA methyltransferase, TrmH family, group 3 [Brucella suis bv. 5
           str. 513]
 gi|254704533|ref|ZP_05166361.1| RNA methyltransferase, TrmH family, group 3 [Brucella suis bv. 3
           str. 686]
 gi|254706572|ref|ZP_05168400.1| RNA methyltransferase, TrmH family, group 3 [Brucella pinnipedialis
           M163/99/10]
 gi|254710319|ref|ZP_05172130.1| RNA methyltransferase, TrmH family, group 3 [Brucella pinnipedialis
           B2/94]
 gi|254714316|ref|ZP_05176127.1| RNA methyltransferase, TrmH family, group 3 [Brucella ceti
           M644/93/1]
 gi|254717753|ref|ZP_05179564.1| RNA methyltransferase, TrmH family, group 3 [Brucella ceti
           M13/05/1]
 gi|256031813|ref|ZP_05445427.1| RNA methyltransferase, TrmH family, group 3 [Brucella pinnipedialis
           M292/94/1]
 gi|256061333|ref|ZP_05451477.1| RNA methyltransferase, TrmH family, group 3 [Brucella neotomae
           5K33]
 gi|256113812|ref|ZP_05454605.1| RNA methyltransferase, TrmH family, group 3 [Brucella melitensis
           bv. 3 str. Ether]
 gi|256159988|ref|ZP_05457701.1| RNA methyltransferase, TrmH family, group 3 [Brucella ceti
           M490/95/1]
 gi|256255213|ref|ZP_05460749.1| RNA methyltransferase, TrmH family, group 3 [Brucella ceti B1/94]
 gi|256263765|ref|ZP_05466297.1| RNA methyltransferase [Brucella melitensis bv. 2 str. 63/9]
 gi|256369676|ref|YP_003107186.1| RNA methyltransferase, TrmH family, group 3 [Brucella microti CCM
           4915]
 gi|260168947|ref|ZP_05755758.1| RNA methyltransferase, TrmH family, group 3 [Brucella sp. F5/99]
 gi|260566224|ref|ZP_05836694.1| RNA methyltransferase [Brucella suis bv. 4 str. 40]
 gi|261214245|ref|ZP_05928526.1| RNA methyltransferase [Brucella abortus bv. 3 str. Tulya]
 gi|261219597|ref|ZP_05933878.1| RNA methyltransferase [Brucella ceti M13/05/1]
 gi|261222409|ref|ZP_05936690.1| RNA methyltransferase [Brucella ceti B1/94]
 gi|261314030|ref|ZP_05953227.1| RNA methyltransferase [Brucella pinnipedialis M163/99/10]
 gi|261317883|ref|ZP_05957080.1| RNA methyltransferase [Brucella pinnipedialis B2/94]
 gi|261322092|ref|ZP_05961289.1| RNA methyltransferase [Brucella ceti M644/93/1]
 gi|261325334|ref|ZP_05964531.1| RNA methyltransferase [Brucella neotomae 5K33]
 gi|261752558|ref|ZP_05996267.1| RNA methyltransferase [Brucella suis bv. 5 str. 513]
 gi|261755216|ref|ZP_05998925.1| RNA methyltransferase [Brucella suis bv. 3 str. 686]
 gi|261758439|ref|ZP_06002148.1| RNA methyltransferase [Brucella sp. F5/99]
 gi|265988911|ref|ZP_06101468.1| RNA methyltransferase [Brucella pinnipedialis M292/94/1]
 gi|265995162|ref|ZP_06107719.1| RNA methyltransferase [Brucella melitensis bv. 3 str. Ether]
 gi|265998376|ref|ZP_06110933.1| RNA methyltransferase [Brucella ceti M490/95/1]
 gi|294852588|ref|ZP_06793261.1| RNA methyltransferase [Brucella sp. NVSL 07-0026]
 gi|306844157|ref|ZP_07476750.1| RNA methyltransferase, TrmH family, group 3 [Brucella sp. BO1]
 gi|23348093|gb|AAN30173.1| RNA methyltransferase, TrmH family, group 3 [Brucella suis 1330]
 gi|161336019|gb|ABX62324.1| RNA methyltransferase, TrmH family, group 3 [Brucella canis ATCC
           23365]
 gi|225641114|gb|ACO01028.1| RNA methyltransferase, TrmH family, group 3 [Brucella melitensis
           ATCC 23457]
 gi|255999838|gb|ACU48237.1| RNA methyltransferase, TrmH family, group 3 [Brucella microti CCM
           4915]
 gi|260155742|gb|EEW90822.1| RNA methyltransferase [Brucella suis bv. 4 str. 40]
 gi|260915852|gb|EEX82713.1| RNA methyltransferase [Brucella abortus bv. 3 str. Tulya]
 gi|260920993|gb|EEX87646.1| RNA methyltransferase [Brucella ceti B1/94]
 gi|260924686|gb|EEX91254.1| RNA methyltransferase [Brucella ceti M13/05/1]
 gi|261294782|gb|EEX98278.1| RNA methyltransferase [Brucella ceti M644/93/1]
 gi|261297106|gb|EEY00603.1| RNA methyltransferase [Brucella pinnipedialis B2/94]
 gi|261301314|gb|EEY04811.1| RNA methyltransferase [Brucella neotomae 5K33]
 gi|261303056|gb|EEY06553.1| RNA methyltransferase [Brucella pinnipedialis M163/99/10]
 gi|261738423|gb|EEY26419.1| RNA methyltransferase [Brucella sp. F5/99]
 gi|261742311|gb|EEY30237.1| RNA methyltransferase [Brucella suis bv. 5 str. 513]
 gi|261744969|gb|EEY32895.1| RNA methyltransferase [Brucella suis bv. 3 str. 686]
 gi|262552844|gb|EEZ08834.1| RNA methyltransferase [Brucella ceti M490/95/1]
 gi|262766275|gb|EEZ12064.1| RNA methyltransferase [Brucella melitensis bv. 3 str. Ether]
 gi|263093865|gb|EEZ17827.1| RNA methyltransferase [Brucella melitensis bv. 2 str. 63/9]
 gi|264661108|gb|EEZ31369.1| RNA methyltransferase [Brucella pinnipedialis M292/94/1]
 gi|294821177|gb|EFG38176.1| RNA methyltransferase [Brucella sp. NVSL 07-0026]
 gi|306275432|gb|EFM57169.1| RNA methyltransferase, TrmH family, group 3 [Brucella sp. BO1]
          Length = 286

 Score =  285 bits (730), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 145/276 (52%), Positives = 191/276 (69%), Gaps = 14/276 (5%)

Query: 16  KDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPE---------NLFLYGVHTVSAALNNPSR 66
           KDSHYA+LRR HRD +K  +  +  R   +P           + LYG+HTV AA+ NP R
Sbjct: 11  KDSHYARLRRQHRD-QKAGAEGKSPRKPQRPAIAASAVAEGTVRLYGLHTVRAAVENPQR 69

Query: 67  KIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTL 126
           KI ++ AT+N  ARL+       PFPV+ V P+ IDK  G EAVHQG+ +E  PL +  L
Sbjct: 70  KILRMRATRNGFARLEIGEADSLPFPVEIVDPRDIDKETGSEAVHQGVMIEAEPLRTRKL 129

Query: 127 DAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEH 186
             +R S LL+VLD V DPHN+GAI+RSAVAF    +ITT R+SP E+ VLAK+ASGALE 
Sbjct: 130 SELRESPLLLVLDQVTDPHNVGAIMRSAVAFGAGALITTSRHSPQETGVLAKAASGALEL 189

Query: 187 IPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQE--IKNDKIALILGAEGKGLRPKT 244
           I +I + NL +A++++H+ GFQTIGL  DS+ PLE E  +  ++IAL+LGAEGKGLR KT
Sbjct: 190 IAHIEVRNLAEAIEELHTLGFQTIGL--DSQGPLEMEATLSGNRIALVLGAEGKGLRQKT 247

Query: 245 QETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
           +ET T++A L MPG IK+LNVSNAAA++LY  + + 
Sbjct: 248 RETVTALARLDMPGEIKSLNVSNAAAISLYAAERYL 283


>gi|327191383|gb|EGE58409.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Rhizobium etli
           CNPAF512]
          Length = 296

 Score =  285 bits (729), Expect = 5e-75,   Method: Compositional matrix adjust.
 Identities = 148/268 (55%), Positives = 191/268 (71%), Gaps = 16/268 (5%)

Query: 14  SLKDSHYAKLRRNHRDYKKMQSF-----NQKSRHTSQ--------PENLFLYGVHTVSAA 60
           S KD+HYA LRR HRD K+ +        QK +  ++        P+ ++LYG+HTV AA
Sbjct: 16  SAKDTHYANLRRAHRDAKRERGEIPTPQPQKRKRGAEDWKPPALAPDQVYLYGLHTVRAA 75

Query: 61  LNNPSRKIFQLLATKNALARLDWDAN-LPHPFPVKTVPPQTIDKIVGKEAVHQGLALETA 119
           L+NP RK  +L  T+NALARL+ D   L  PF +  V P  IDK++G EA+HQG+ LET 
Sbjct: 76  LDNPERKKIKLSVTQNALARLEIDVEALDIPFEI--VAPHEIDKVLGPEAIHQGVMLETR 133

Query: 120 PLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKS 179
           PL    L+A+++S LL+VLD V DPHN+GAI+RSAVAF+   +ITT+R+SP+ES VLAKS
Sbjct: 134 PLPVRRLEALKDSPLLLVLDQVTDPHNVGAIMRSAVAFNAGAVITTQRHSPTESGVLAKS 193

Query: 180 ASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKG 239
           ASGALE IPYI+I+NL DAL ++H  GF TIGL S+   PLE     DK+AL+LG+EGKG
Sbjct: 194 ASGALELIPYIQITNLADALGELHKLGFSTIGLDSEGPAPLEGTFSGDKLALVLGSEGKG 253

Query: 240 LRPKTQETATSMAHLHMPGIIKALNVSN 267
           LR KT+ET T++A L MPG IK+LNVSN
Sbjct: 254 LRQKTRETVTALARLDMPGAIKSLNVSN 281


>gi|319783294|ref|YP_004142770.1| RNA methyltransferase, TrmH family, group 3 [Mesorhizobium ciceri
           biovar biserrulae WSM1271]
 gi|317169182|gb|ADV12720.1| RNA methyltransferase, TrmH family, group 3 [Mesorhizobium ciceri
           biovar biserrulae WSM1271]
          Length = 282

 Score =  284 bits (727), Expect = 8e-75,   Method: Compositional matrix adjust.
 Identities = 146/275 (53%), Positives = 193/275 (70%), Gaps = 6/275 (2%)

Query: 9   SEKIFSLKDSHYAKLRRNHRDYKKMQSFNQKSRHTSQP-EN-----LFLYGVHTVSAALN 62
           S+K  + KD+HYAKLRR +RD K   +   + R    P EN     + LYG+HTV AAL+
Sbjct: 2   SDKTNTPKDTHYAKLRRAYRDEKSGGAPAFRPRQPVPPGENAADGLVRLYGLHTVRAALD 61

Query: 63  NPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLL 122
           NP RKI ++L T+NA  RL+       PF  + V P+ IDKI G +AVHQG+ +E  PL 
Sbjct: 62  NPRRKIRKMLVTRNAAERLEIADLAALPFKTELVEPRDIDKITGSDAVHQGVLIEAEPLK 121

Query: 123 SPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASG 182
           +  LDA+ +++L++VLD + DPHN+GAILRSAVAF    +ITT R+SP ES VLAKSASG
Sbjct: 122 AKRLDALGDAKLVLVLDQITDPHNVGAILRSAVAFGAGALITTARHSPQESGVLAKSASG 181

Query: 183 ALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRP 242
           ALEHI  I + NL +AL ++H  GF+T+GL SD+   LE+    +KIAL+LGAEGKGLR 
Sbjct: 182 ALEHIDQIEVKNLAEALGQLHEAGFRTMGLDSDAPAELEKSFAGEKIALVLGAEGKGLRQ 241

Query: 243 KTQETATSMAHLHMPGIIKALNVSNAAAVALYITQ 277
           KT+ET T++A L MPG I +LNVSNAAA++LY+ +
Sbjct: 242 KTRETVTTLARLDMPGAIHSLNVSNAAAISLYVAR 276


>gi|218682806|ref|ZP_03530407.1| RNA methyltransferase, TrmH family, group 3 [Rhizobium etli CIAT
           894]
          Length = 296

 Score =  283 bits (725), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 148/268 (55%), Positives = 189/268 (70%), Gaps = 16/268 (5%)

Query: 14  SLKDSHYAKLRRNHRDYKKMQSF-----NQKSRHTSQ--------PENLFLYGVHTVSAA 60
           S KD+HYA LRR HRD K+ +        QK R            P+ + LYG+HTV AA
Sbjct: 16  SAKDTHYATLRRAHRDAKRERGEIPTPPPQKRRRGGDDWKPPALAPDQVHLYGLHTVRAA 75

Query: 61  LNNPSRKIFQLLATKNALARLDWDAN-LPHPFPVKTVPPQTIDKIVGKEAVHQGLALETA 119
           L+NP RK  +L  T+NALARL+ DA  L  PF +  V PQ IDK++G EA+HQG+ LET 
Sbjct: 76  LDNPERKKIKLFVTQNALARLEIDAETLGIPFEI--VSPQEIDKVLGPEAIHQGVMLETR 133

Query: 120 PLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKS 179
           PL    L+A+++S LL+VLD V DPHN+GAI+RSAVAF+   +ITT+R+SP+ES VLAKS
Sbjct: 134 PLPVRRLEALKDSPLLLVLDQVTDPHNVGAIMRSAVAFNAGAVITTQRHSPTESGVLAKS 193

Query: 180 ASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKG 239
           ASGALE IPYI+++NL DAL ++H  GF TIGL S+   PLE     +K+AL+LG+EGKG
Sbjct: 194 ASGALELIPYIQVTNLADALGELHKLGFSTIGLDSEGPAPLEGTFSGEKLALVLGSEGKG 253

Query: 240 LRPKTQETATSMAHLHMPGIIKALNVSN 267
           LR KT+ET  ++A L MPG IK+LNVSN
Sbjct: 254 LRQKTRETVNALARLDMPGAIKSLNVSN 281


>gi|17987024|ref|NP_539658.1| 23S ribosomal RNA methyltransferase [Brucella melitensis bv. 1 str.
           16M]
 gi|17982677|gb|AAL51922.1| 23S ribosomal RNA methyltransferase [Brucella melitensis bv. 1 str.
           16M]
          Length = 303

 Score =  282 bits (722), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 144/276 (52%), Positives = 190/276 (68%), Gaps = 14/276 (5%)

Query: 16  KDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPE---------NLFLYGVHTVSAALNNPSR 66
           KDSHYA+LRR HRD +K  +  +  R   +P           + LYG+HTV AA+ NP R
Sbjct: 28  KDSHYARLRRQHRD-QKAGAEGKSPRKPQRPAIAASAVAEGTVRLYGLHTVRAAVENPQR 86

Query: 67  KIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTL 126
           KI ++ AT+N  ARL+       PFPV+ V P+ IDK  G EAVHQG+ +E  PL +  L
Sbjct: 87  KILRMRATRNGFARLEIGEADSLPFPVEIVDPRDIDKETGSEAVHQGVMIEAEPLRTRKL 146

Query: 127 DAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEH 186
             +R S LL+VLD V DPHN+GAI+RSAVAF    +ITT  +SP E+ VLAK+ASGALE 
Sbjct: 147 SELRESPLLLVLDQVTDPHNVGAIMRSAVAFGAGALITTSHHSPQETGVLAKAASGALEL 206

Query: 187 IPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQE--IKNDKIALILGAEGKGLRPKT 244
           I +I + NL +A++++H+ GFQTIGL  DS+ PLE E  +  ++IAL+LGAEGKGLR KT
Sbjct: 207 IAHIEVRNLAEAIEELHTLGFQTIGL--DSQGPLEMEATLSGNRIALVLGAEGKGLRQKT 264

Query: 245 QETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
           +ET T++A L MPG IK+LNVSNAAA++LY  + + 
Sbjct: 265 RETVTALARLDMPGEIKSLNVSNAAAISLYAAERYL 300


>gi|256044897|ref|ZP_05447801.1| 23S ribosomal RNA methyltransferase [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|260565501|ref|ZP_05835985.1| RNA methyltransferase [Brucella melitensis bv. 1 str. 16M]
 gi|265991325|ref|ZP_06103882.1| RNA methyltransferase [Brucella melitensis bv. 1 str. Rev.1]
 gi|260151569|gb|EEW86663.1| RNA methyltransferase [Brucella melitensis bv. 1 str. 16M]
 gi|263002109|gb|EEZ14684.1| RNA methyltransferase [Brucella melitensis bv. 1 str. Rev.1]
          Length = 286

 Score =  282 bits (721), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 144/276 (52%), Positives = 190/276 (68%), Gaps = 14/276 (5%)

Query: 16  KDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPE---------NLFLYGVHTVSAALNNPSR 66
           KDSHYA+LRR HRD +K  +  +  R   +P           + LYG+HTV AA+ NP R
Sbjct: 11  KDSHYARLRRQHRD-QKAGAEGKSPRKPQRPAIAASAVAEGTVRLYGLHTVRAAVENPQR 69

Query: 67  KIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTL 126
           KI ++ AT+N  ARL+       PFPV+ V P+ IDK  G EAVHQG+ +E  PL +  L
Sbjct: 70  KILRMRATRNGFARLEIGEADSLPFPVEIVDPRDIDKETGSEAVHQGVMIEAEPLRTRKL 129

Query: 127 DAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEH 186
             +R S LL+VLD V DPHN+GAI+RSAVAF    +ITT  +SP E+ VLAK+ASGALE 
Sbjct: 130 SELRESPLLLVLDQVTDPHNVGAIMRSAVAFGAGALITTSHHSPQETGVLAKAASGALEL 189

Query: 187 IPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQE--IKNDKIALILGAEGKGLRPKT 244
           I +I + NL +A++++H+ GFQTIGL  DS+ PLE E  +  ++IAL+LGAEGKGLR KT
Sbjct: 190 IAHIEVRNLAEAIEELHTLGFQTIGL--DSQGPLEMEATLSGNRIALVLGAEGKGLRQKT 247

Query: 245 QETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
           +ET T++A L MPG IK+LNVSNAAA++LY  + + 
Sbjct: 248 RETVTALARLDMPGEIKSLNVSNAAAISLYAAERYL 283


>gi|163843517|ref|YP_001627921.1| RNA methyltransferase [Brucella suis ATCC 23445]
 gi|163674240|gb|ABY38351.1| RNA methyltransferase, TrmH family, group 3 [Brucella suis ATCC
           23445]
          Length = 286

 Score =  282 bits (721), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 144/276 (52%), Positives = 190/276 (68%), Gaps = 14/276 (5%)

Query: 16  KDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPE---------NLFLYGVHTVSAALNNPSR 66
           KDSHYA+LRR H D +K  +  +  R   +P           + LYG+HTV AA+ NP R
Sbjct: 11  KDSHYARLRRQHHD-QKAGAEGKSPRKPQRPAIAASAVAEGTVRLYGLHTVRAAVENPQR 69

Query: 67  KIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTL 126
           KI ++ AT+N  ARL+       PFPV+ V P+ IDK  G EAVHQG+ +E  PL +  L
Sbjct: 70  KILRMRATRNGFARLEIGEADSLPFPVEIVDPRDIDKETGSEAVHQGVMIEAEPLRTRKL 129

Query: 127 DAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEH 186
             +R S LL+VLD V DPHN+GAI+RSAVAF    +ITT R+SP E+ VLAK+ASGALE 
Sbjct: 130 SELRESPLLLVLDQVTDPHNVGAIMRSAVAFGAGALITTSRHSPQETGVLAKAASGALEL 189

Query: 187 IPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQE--IKNDKIALILGAEGKGLRPKT 244
           I +I + NL +A++++H+ GFQTIGL  DS+ PLE E  +  ++IAL+LGAEGKGLR KT
Sbjct: 190 IAHIEVRNLAEAIEELHTLGFQTIGL--DSQGPLEMEATLSGNRIALVLGAEGKGLRQKT 247

Query: 245 QETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
           +ET T++A L MPG IK+LNVSNAAA++LY  + + 
Sbjct: 248 RETVTALARLDMPGEIKSLNVSNAAAISLYAAERYL 283


>gi|116251522|ref|YP_767360.1| 23S rRNA (guanosine-2'-O-)-methyltransferase RlmB [Rhizobium
           leguminosarum bv. viciae 3841]
 gi|115256170|emb|CAK07251.1| putative 23S rRNA (guanosine-2'-O-)-methyltransferase RlmB
           [Rhizobium leguminosarum bv. viciae 3841]
          Length = 296

 Score =  281 bits (719), Expect = 7e-74,   Method: Compositional matrix adjust.
 Identities = 146/268 (54%), Positives = 188/268 (70%), Gaps = 16/268 (5%)

Query: 14  SLKDSHYAKLRRNHRDYKKMQSF-----NQKSRHTSQ--------PENLFLYGVHTVSAA 60
           S KD+HYA LRR HRD K+ +        QK +   +        P+ + LYG+HTV AA
Sbjct: 16  SAKDTHYATLRRAHRDAKRERGEIPTPQAQKRKRGGEDWKPPALAPDQVHLYGLHTVRAA 75

Query: 61  LNNPSRKIFQLLATKNALARLDWDAN-LPHPFPVKTVPPQTIDKIVGKEAVHQGLALETA 119
           L+NP RK  +L  T+NALARL+ D   L  PF +  V PQ IDK++G EA+HQG+ LET 
Sbjct: 76  LDNPERKKIKLFVTQNALARLEVDVEALGIPFEI--VSPQEIDKVLGPEAIHQGVMLETR 133

Query: 120 PLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKS 179
           PL    L+A++ S LL+VLD V DPHN+GAI+RSAVAF+   +ITT+R+SP+ES VLAKS
Sbjct: 134 PLPVRRLEALKESPLLLVLDQVTDPHNVGAIMRSAVAFNAGAVITTQRHSPTESGVLAKS 193

Query: 180 ASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKG 239
           ASGALE IPYI+++NL DAL ++H  GF TIGL S+   PLE     +K+AL+LG+EGKG
Sbjct: 194 ASGALELIPYIQVTNLADALGELHKLGFSTIGLDSEGPAPLEGTFSGEKVALVLGSEGKG 253

Query: 240 LRPKTQETATSMAHLHMPGIIKALNVSN 267
           LR KT+ET  ++A L MPG IK+LNVSN
Sbjct: 254 LRQKTRETVNALARLDMPGSIKSLNVSN 281


>gi|114704462|ref|ZP_01437370.1| putative trna/rrna methyltransferase protein [Fulvimarina pelagi
           HTCC2506]
 gi|114539247|gb|EAU42367.1| putative trna/rrna methyltransferase protein [Fulvimarina pelagi
           HTCC2506]
          Length = 310

 Score =  281 bits (718), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 142/265 (53%), Positives = 184/265 (69%), Gaps = 8/265 (3%)

Query: 16  KDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATK 75
           +D+HYA LRR HRD K+    N        PE L LYG+HTV+AAL NP R   +LL T+
Sbjct: 50  RDTHYANLRRAHRDRKRELKPNA-------PEPLLLYGLHTVAAALQNPDRIRHRLLITR 102

Query: 76  NALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLL 135
           NA ARL+ D +     P++ V P+ +D+++G EAVHQG  LET PL    LDA+ ++ LL
Sbjct: 103 NARARLELD-DAEIDCPIEQVEPKDLDRLLGGEAVHQGACLETEPLEPLRLDALGDATLL 161

Query: 136 MVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNL 195
           +VLD V DPHN+GAILRSA AF+ DG+ITT R+SP ES VLAK+ASGALEH+  I + NL
Sbjct: 162 LVLDQVTDPHNVGAILRSATAFAADGLITTSRHSPRESGVLAKAASGALEHVRQIEVRNL 221

Query: 196 TDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLH 255
            + L+++   GF+TIGL S+ +   EQ I+ +KIA++LGAEGKGLR KT+ T   +A L 
Sbjct: 222 AETLERLSKLGFRTIGLDSEGESDFEQAIEGEKIAVVLGAEGKGLRQKTRATCDVLARLE 281

Query: 256 MPGIIKALNVSNAAAVALYITQNHF 280
           MPG I +LNVSNAAAVALY  +   
Sbjct: 282 MPGAIHSLNVSNAAAVALYAIRRRL 306


>gi|209548917|ref|YP_002280834.1| RNA methyltransferase, TrmH family, group 3 [Rhizobium
           leguminosarum bv. trifolii WSM2304]
 gi|209534673|gb|ACI54608.1| RNA methyltransferase, TrmH family, group 3 [Rhizobium
           leguminosarum bv. trifolii WSM2304]
          Length = 296

 Score =  281 bits (718), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 146/268 (54%), Positives = 189/268 (70%), Gaps = 16/268 (5%)

Query: 14  SLKDSHYAKLRRNHRDYKKMQSF-----NQKSRHTSQ--------PENLFLYGVHTVSAA 60
           S KD+HYA LRR HRD K+ +        QK R  ++        P+ + LYG+HTV AA
Sbjct: 16  SAKDTHYATLRRAHRDAKRERGEIPTPQPQKRRRGAEDWKPPALAPDQVHLYGLHTVRAA 75

Query: 61  LNNPSRKIFQLLATKNALARLDWDAN-LPHPFPVKTVPPQTIDKIVGKEAVHQGLALETA 119
           L+NP RK  +L  T+NALARL+ D   L  PF +  V PQ IDK++G EA+HQG+ LET 
Sbjct: 76  LDNPERKKIKLFVTQNALARLEVDVETLGIPFEI--VSPQEIDKVLGPEAIHQGVMLETR 133

Query: 120 PLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKS 179
           PL    L+A+++S LL+VLD V DPHN+GAI+RSAVAF+   +ITT+R+SP+ES VLAKS
Sbjct: 134 PLPVRRLEALKDSPLLLVLDQVTDPHNVGAIMRSAVAFNAGAVITTQRHSPTESGVLAKS 193

Query: 180 ASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKG 239
           ASGALE IPYI+++NL DAL ++H  GF TIGL S+    LE     +K+AL+LG+EGKG
Sbjct: 194 ASGALELIPYIQVTNLADALGELHKLGFSTIGLDSEGPAALEGTFSGEKVALVLGSEGKG 253

Query: 240 LRPKTQETATSMAHLHMPGIIKALNVSN 267
           LR KT+ET  ++A L MPG IK+LNVSN
Sbjct: 254 LRQKTRETVNALARLDMPGAIKSLNVSN 281


>gi|241204147|ref|YP_002975243.1| RNA methyltransferase, TrmH family, group 3 [Rhizobium
           leguminosarum bv. trifolii WSM1325]
 gi|240858037|gb|ACS55704.1| RNA methyltransferase, TrmH family, group 3 [Rhizobium
           leguminosarum bv. trifolii WSM1325]
          Length = 296

 Score =  279 bits (714), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 145/268 (54%), Positives = 187/268 (69%), Gaps = 16/268 (5%)

Query: 14  SLKDSHYAKLRRNHRDYKKMQSF------NQKSRHTSQ-------PENLFLYGVHTVSAA 60
           S KD+HYA LRR HRD K+ +        +++ R           P+ + LYG+HTV AA
Sbjct: 16  SAKDTHYATLRRAHRDAKRERGEIPTPQPHKRKRGGDDWKPPALAPDQVHLYGLHTVRAA 75

Query: 61  LNNPSRKIFQLLATKNALARLDWDAN-LPHPFPVKTVPPQTIDKIVGKEAVHQGLALETA 119
           L+NP RK   L  T+NALARL+ D   L  PF +  V PQ IDK++G EA+HQG+ LET 
Sbjct: 76  LDNPERKKITLFVTQNALARLEVDVEALGMPFEI--VSPQEIDKVLGPEAIHQGVMLETR 133

Query: 120 PLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKS 179
           PL    L+A++ S LL+VLD V DPHN+GAI+RSAVAF+   +ITT+R+SP+ES VLAKS
Sbjct: 134 PLPVRRLEALKESPLLLVLDQVTDPHNVGAIMRSAVAFNAGAVITTQRHSPTESGVLAKS 193

Query: 180 ASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKG 239
           ASGALE IPYI+++NL DAL ++H  GF TIGL S+   PLE     +K+AL+LG+EGKG
Sbjct: 194 ASGALELIPYIQVTNLADALGELHKLGFSTIGLDSEGPAPLEGTFSGEKVALVLGSEGKG 253

Query: 240 LRPKTQETATSMAHLHMPGIIKALNVSN 267
           LR KT+ET  ++A L MPG IK+LNVSN
Sbjct: 254 LRQKTRETVNALARLDMPGAIKSLNVSN 281


>gi|163759379|ref|ZP_02166465.1| RNA methyltransferase, TrmH family, group 3 [Hoeflea phototrophica
           DFL-43]
 gi|162283783|gb|EDQ34068.1| RNA methyltransferase, TrmH family, group 3 [Hoeflea phototrophica
           DFL-43]
          Length = 300

 Score =  275 bits (704), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 135/281 (48%), Positives = 190/281 (67%), Gaps = 16/281 (5%)

Query: 16  KDSHYAKLRRNHRDYKK-------MQSFNQKS---------RHTSQPENLFLYGVHTVSA 59
           +D+HYAKLRR+HRD K+       +Q   ++                E+++LYG+HTV A
Sbjct: 14  RDTHYAKLRRSHRDAKREREGLPPVQPRGKRDLPARKGALYAERGAAESVYLYGLHTVRA 73

Query: 60  ALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETA 119
           AL+NP+R+I  L AT+NAL RL+   +   PFPV+ V PQ ID+++G +AVHQG+ LE  
Sbjct: 74  ALDNPARQITSLKATRNALMRLEIAEDAELPFPVELVAPQEIDRLLGDDAVHQGVLLEAR 133

Query: 120 PLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKS 179
           PL +  L  + ++ L+++LD V DPHN+GAI+RSAVAF    ++TT+R+SP ES VLAK+
Sbjct: 134 PLSARPLTDLGDATLVVILDQVTDPHNVGAIMRSAVAFGAGALVTTQRHSPQESGVLAKA 193

Query: 180 ASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKG 239
           ASGALE I +I + NL  A++ + + GF T+GL S+   P+E  +K  +IA++LGAEGKG
Sbjct: 194 ASGALEMIDHIEVRNLASAIEDIKAQGFTTVGLDSEGPSPIEAGLKGARIAMVLGAEGKG 253

Query: 240 LRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
           LR KT+ET   +  L MPG IK+LNVSNA A+ALY  Q + 
Sbjct: 254 LRQKTRETVDVLTRLDMPGAIKSLNVSNATAIALYAAQQYL 294


>gi|90417781|ref|ZP_01225693.1| RNA methyltransferase, TrmH family, group 3 [Aurantimonas
           manganoxydans SI85-9A1]
 gi|90337453|gb|EAS51104.1| RNA methyltransferase, TrmH family, group 3 [Aurantimonas
           manganoxydans SI85-9A1]
          Length = 284

 Score =  275 bits (704), Expect = 5e-72,   Method: Compositional matrix adjust.
 Identities = 141/275 (51%), Positives = 184/275 (66%), Gaps = 10/275 (3%)

Query: 16  KDSHYAKLRRNHRDYKKMQSFNQKS---RHTSQPEN------LFLYGVHTVSAALNNPSR 66
           KD+HYA LRR HRD K+       +   +   QP        + LYG+HTV+AALNNP R
Sbjct: 11  KDTHYATLRRAHRDRKRTDGGAAPAGALKRRPQPGRPAPAGRVRLYGIHTVAAALNNPHR 70

Query: 67  KIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTL 126
           K+  LL T+NALARL+   +     PV+ V P+ +D  +G EAVHQG+ LET PL +  L
Sbjct: 71  KLHSLLVTRNALARLEIAEDAIR-CPVEMVEPKRLDAELGGEAVHQGVMLETEPLPAIRL 129

Query: 127 DAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEH 186
             +  ++L++VLD V DPHN+GAILRSA AF  D ++TT R+SP ES VLAK+ASGALEH
Sbjct: 130 SDLGKARLVIVLDQVTDPHNVGAILRSATAFGADALVTTARHSPQESGVLAKAASGALEH 189

Query: 187 IPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQE 246
           +  I + NL DAL  +   GF+TIGL SD  +  E  +  ++IA++LGAEGKGLR KTQ 
Sbjct: 190 VTQIEVVNLADALSALSKQGFRTIGLDSDGPESFEASLSGERIAIVLGAEGKGLRQKTQA 249

Query: 247 TATSMAHLHMPGIIKALNVSNAAAVALYITQNHFA 281
           T  ++A L MPG I++LNVSNAAA+ALY T+ H  
Sbjct: 250 TVDALARLEMPGAIRSLNVSNAAAIALYATRRHLG 284


>gi|227821738|ref|YP_002825708.1| RNA methyltransferase, TrmH family, group 3 [Sinorhizobium fredii
           NGR234]
 gi|227340737|gb|ACP24955.1| RNA methyltransferase, TrmH family, group 3 [Sinorhizobium fredii
           NGR234]
          Length = 291

 Score =  275 bits (703), Expect = 5e-72,   Method: Compositional matrix adjust.
 Identities = 147/290 (50%), Positives = 197/290 (67%), Gaps = 14/290 (4%)

Query: 4   ISKKKSEKIFSLKDSHYAKLRRNHRDYKKMQSFNQKSRHTSQ-------------PENLF 50
           +SK KS    S +DSHYA LRR HRD ++ +      R   +             P+ +F
Sbjct: 1   MSKDKSGD-KSARDSHYATLRRAHRDARRERGEIPTPRPDKRRKLPADWKPPALAPDEVF 59

Query: 51  LYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAV 110
           LYG+HTV AAL+NP R I +L  T+NA ARL+        FPV+ V PQ +D+ +G +A+
Sbjct: 60  LYGLHTVRAALDNPDRTIIRLRVTQNAAARLELGDLSALRFPVEIVTPQDLDRALGPDAI 119

Query: 111 HQGLALETAPLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSP 170
           HQG+ LET PL    L+A+ +  L+++LD V DPHN+GAI+RSAVAF    +ITT R+SP
Sbjct: 120 HQGVMLETRPLPHRKLEALSDCPLILLLDQVTDPHNVGAIMRSAVAFEAGALITTMRHSP 179

Query: 171 SESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIA 230
           +ES VLAKSASGALE IPYI+I+NL D ++++H  GFQTIGL S+  +PLE      K+A
Sbjct: 180 TESGVLAKSASGALELIPYIQITNLADTIEELHKLGFQTIGLDSEGPQPLEDTFSGGKVA 239

Query: 231 LILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
           L+LG+EGKGLR KT++T T++A L MPG IK+LNVSNAAA+A+Y  + H 
Sbjct: 240 LVLGSEGKGLRQKTRQTVTALARLDMPGAIKSLNVSNAAAIAMYAARQHL 289


>gi|222085654|ref|YP_002544184.1| tRNA/rRNA methyltransferase protein [Agrobacterium radiobacter K84]
 gi|221723102|gb|ACM26258.1| tRNA/rRNA methyltransferase protein [Agrobacterium radiobacter K84]
          Length = 302

 Score =  275 bits (702), Expect = 7e-72,   Method: Compositional matrix adjust.
 Identities = 142/268 (52%), Positives = 183/268 (68%), Gaps = 14/268 (5%)

Query: 14  SLKDSHYAKLRRNHRDYKKMQS-----FNQKSRHTSQ---------PENLFLYGVHTVSA 59
           S KD+HYA LRR HRD K+ +        QK +             P+ ++LYG+HTV A
Sbjct: 20  SAKDTHYATLRRAHRDAKRERGEIPTPVPQKRKRPGADDWKPPALAPDQVYLYGLHTVRA 79

Query: 60  ALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETA 119
           AL NP RK  +L  T+NAL RL+         P + V PQ IDK++G EA+HQG+ LET 
Sbjct: 80  ALANPERKNIKLSTTQNALVRLEIGPVDALGIPFEIVSPQDIDKVLGPEAIHQGVMLETR 139

Query: 120 PLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKS 179
           PL    L+A+++S LL+VLD V DPHN+GAI+RSAVAF    +ITT+R+SP+ES VLAKS
Sbjct: 140 PLPVRRLEALKDSPLLLVLDQVTDPHNVGAIMRSAVAFDAAAVITTQRHSPTESGVLAKS 199

Query: 180 ASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKG 239
           ASGALE IPYI+I+NL DAL ++H  GF +IGL S+   PLE     +K+AL+LG+EGKG
Sbjct: 200 ASGALELIPYIQITNLADALGELHRLGFVSIGLDSEGPAPLEGTFSGEKVALVLGSEGKG 259

Query: 240 LRPKTQETATSMAHLHMPGIIKALNVSN 267
           LR KT+ET  ++A L MPG IK+LNVSN
Sbjct: 260 LRQKTRETVNALARLDMPGAIKSLNVSN 287


>gi|110633438|ref|YP_673646.1| tRNA/rRNA methyltransferase (SpoU) [Mesorhizobium sp. BNC1]
 gi|110284422|gb|ABG62481.1| tRNA/rRNA methyltransferase (SpoU) [Chelativorans sp. BNC1]
          Length = 276

 Score =  274 bits (700), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 137/274 (50%), Positives = 192/274 (70%), Gaps = 5/274 (1%)

Query: 10  EKIFSLKDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPENLF-LYGVHTVSAALNNPSRKI 68
           +K  + KDSHYA+LRR HR+     + N+++     PE +  LYG+HTV AA++NP+R I
Sbjct: 5   KKTGTPKDSHYARLRRAHRERT---APNERA-GADLPEGIVRLYGLHTVRAAIDNPARSI 60

Query: 69  FQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDA 128
            Q+L T+NA  RL        PFPV+ V P+ ID +VG +AVHQG+ +E           
Sbjct: 61  RQMLVTRNAAQRLGIADPSTLPFPVEIVEPKAIDALVGADAVHQGVLVEATARTPKPFSG 120

Query: 129 VRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIP 188
           + ++ L++VLD V DPHN+GAI+RSAVAF  D ++TT R+SP+ES VLAK+ASGALEHI 
Sbjct: 121 LEDASLVLVLDQVTDPHNVGAIMRSAVAFGADALVTTARHSPAESGVLAKAASGALEHID 180

Query: 189 YIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETA 248
           +I + NL +A++++H+ GF T+GL S+  + LE+ ++  KIAL+LG+EGKGLR KT+ET 
Sbjct: 181 HIEVRNLANAIEELHAAGFLTVGLDSEGPQRLEKTLQGKKIALVLGSEGKGLRQKTRETV 240

Query: 249 TSMAHLHMPGIIKALNVSNAAAVALYITQNHFAK 282
            ++A L MPG I +LNVSNAAAVALYI +   A+
Sbjct: 241 RALARLDMPGAIHSLNVSNAAAVALYIARRSLAE 274


>gi|319407391|emb|CBI81042.1| tRNA/rRNA metyltransferase [Bartonella sp. 1-1C]
          Length = 272

 Score =  271 bits (693), Expect = 7e-71,   Method: Compositional matrix adjust.
 Identities = 143/273 (52%), Positives = 185/273 (67%), Gaps = 11/273 (4%)

Query: 15  LKDSHYAKLRRNHRDYKKMQSFNQKSRHTSQP------ENLFLYGVHTVSAALNNPSRKI 68
           LKDSHYA+LRR +R+ K   SF Q + +  QP      E ++LYG+H V AAL NP R +
Sbjct: 2   LKDSHYARLRRRYRNTKG--SFFQSTTYVKQPPIPLQKEQIYLYGIHPVHAALKNPRRVL 59

Query: 69  FQLLATKNALARLDW-DANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLD 127
             L AT NAL RL   ++N+    PV +  P+ ++  VG+EAVHQG+ LET PL S  L 
Sbjct: 60  RHLYATPNALKRLGINESNIA--CPVTSCLPKKLEMFVGREAVHQGIVLETEPLKSRPLS 117

Query: 128 AVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHI 187
            + N+ L++++D + DPHN+GAI+RSAVAF    IITT R+SP ES VLAK+ASGALE I
Sbjct: 118 ELTNTDLIIIMDQITDPHNVGAIMRSAVAFKAGAIITTNRHSPQESGVLAKAASGALELI 177

Query: 188 PYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQET 247
            YI + NL   LQ++H   F + GL S+ K PLE  +K  KI+LILGAEGKGLR KT+E 
Sbjct: 178 EYITVRNLFKTLQELHQMNFISFGLDSEGKFPLETALKGTKISLILGAEGKGLRQKTREN 237

Query: 248 ATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
           A S+A L +PG IK+LNVSNAAA+ALY    + 
Sbjct: 238 AYSLARLDLPGDIKSLNVSNAAAIALYAVHKYL 270


>gi|319404391|emb|CBI77994.1| tRNA/rRNA metyltransferase [Bartonella rochalimae ATCC BAA-1498]
          Length = 272

 Score =  270 bits (691), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 141/272 (51%), Positives = 183/272 (67%), Gaps = 11/272 (4%)

Query: 16  KDSHYAKLRRNHRDYKKMQSFNQKSRHTSQP------ENLFLYGVHTVSAALNNPSRKIF 69
           KDSHYA+LRR +RD K   SF Q + +  QP      E ++LYG+H V AAL NP R + 
Sbjct: 3   KDSHYARLRRRYRDTKG--SFFQSTTYVKQPPIPLQKEQIYLYGIHPVHAALKNPRRILR 60

Query: 70  QLLATKNALARLDW-DANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDA 128
            L  T NAL RLD  ++N+    P+    P+ ++  VG+EAVHQG+ LET PL S +L  
Sbjct: 61  HLYTTPNALKRLDINESNIA--CPITPCSPKKLEMFVGREAVHQGIVLETEPLKSRSLSE 118

Query: 129 VRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIP 188
           + N+ L++++D + DPHN+GAI+RSAVAF    IITT R+SP ES VLAK+ASGALE I 
Sbjct: 119 LTNTDLIIIMDQITDPHNVGAIMRSAVAFKAGAIITTNRHSPQESGVLAKAASGALELIE 178

Query: 189 YIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETA 248
           YI + NL  ALQ++H   F + GL S+ K PLE  +   KI+LILGAEGKGLR KT+E  
Sbjct: 179 YITVRNLFKALQELHQMNFISFGLDSEGKFPLETALTGTKISLILGAEGKGLRQKTRENV 238

Query: 249 TSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
            S+A L +PG IK+LNVSNAAA+ALY    + 
Sbjct: 239 YSLARLDLPGDIKSLNVSNAAAIALYAVHKYL 270


>gi|163868081|ref|YP_001609285.1| tRNA/rRNA metyltransferase [Bartonella tribocorum CIP 105476]
 gi|161017732|emb|CAK01290.1| tRNA/rRNA metyltransferase [Bartonella tribocorum CIP 105476]
          Length = 276

 Score =  270 bits (689), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 136/269 (50%), Positives = 181/269 (67%), Gaps = 5/269 (1%)

Query: 16  KDSHYAKLRRNHRDYK---KMQSFNQKSRHTSQPENLF-LYGVHTVSAALNNPSRKIFQL 71
           ++SHYA+LRR +RD K      S N K +  S  + +  LYG+H+V AAL NP R    L
Sbjct: 7   QNSHYARLRRRYRDTKASSSRSSKNMKKKTASLQQGIIHLYGIHSVQAALKNPKRIFKCL 66

Query: 72  LATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRN 131
             T+NAL RL+   +  +P PV    P+ +D +VG EAVHQG+ LET+PL    L  + N
Sbjct: 67  YVTQNALKRLNMSES-DYPCPVTLCTPKYLDSLVGSEAVHQGIVLETSPLKPCKLSELTN 125

Query: 132 SQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIR 191
           + L++V+D + DPHN+GAI+RSAVAF    +ITT R+SP ES VLAK+ASGALE I YI 
Sbjct: 126 TDLVIVMDQITDPHNVGAIMRSAVAFKAKALITTCRHSPHESGVLAKAASGALEMIHYIT 185

Query: 192 ISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSM 251
           + NL + LQ++H  GF + GL S+  +PLE  +   KIAL+LGAEGKGLR KT+ET  ++
Sbjct: 186 VRNLAETLQEIHQTGFTSFGLDSEGDQPLETTLTGSKIALVLGAEGKGLRKKTRETVCAL 245

Query: 252 AHLHMPGIIKALNVSNAAAVALYITQNHF 280
           A L MPG IK+LNVSNAA +ALY+   + 
Sbjct: 246 ARLDMPGNIKSLNVSNAATIALYVAHKYL 274


>gi|13470525|ref|NP_102094.1| tRNA/rRNA metyltransferase [Mesorhizobium loti MAFF303099]
 gi|14021267|dbj|BAB47880.1| tRNA/rRNA metyltransferase [Mesorhizobium loti MAFF303099]
          Length = 235

 Score =  268 bits (685), Expect = 6e-70,   Method: Compositional matrix adjust.
 Identities = 131/224 (58%), Positives = 164/224 (73%)

Query: 51  LYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAV 110
           LYG+HTV AAL+NP RKI ++L T+NA  RL+ +      F  + V P+ IDKI G +AV
Sbjct: 3   LYGLHTVRAALDNPRRKIRKMLVTRNAAERLEIEDLAALTFKAELVEPRDIDKITGSDAV 62

Query: 111 HQGLALETAPLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSP 170
           HQG+ +E  PL    LDA+ +++L++VLD + DPHN+GAILRSAVAF    +ITT R+SP
Sbjct: 63  HQGVLIEAEPLKPKRLDALGDTRLVLVLDQITDPHNVGAILRSAVAFGAGALITTARHSP 122

Query: 171 SESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIA 230
            ES VLAKSASGALEHI  I + NL DAL ++H  GFQTIGL SD    LE     D+IA
Sbjct: 123 QESGVLAKSASGALEHIDQIEVKNLADALGQLHEAGFQTIGLDSDGPAELETSFAGDRIA 182

Query: 231 LILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
           L+LGAEGKGLR KT+ET T++A L MPG I++LNVSNAAAV+LY
Sbjct: 183 LVLGAEGKGLRQKTRETVTTLARLDMPGAIRSLNVSNAAAVSLY 226


>gi|240850284|ref|YP_002971677.1| tRNA/rRNA methyltransferase [Bartonella grahamii as4aup]
 gi|240267407|gb|ACS50995.1| tRNA/rRNA methyltransferase [Bartonella grahamii as4aup]
          Length = 276

 Score =  263 bits (673), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 135/269 (50%), Positives = 181/269 (67%), Gaps = 5/269 (1%)

Query: 16  KDSHYAKLRRNHRDYKKM--QSFN--QKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQL 71
           ++SHYA+LRR +RD K    +SF   +K   + Q   + LYG+H+V AAL NP R +  L
Sbjct: 7   QNSHYARLRRRYRDTKGSPSRSFTHLKKKAASLQQGIIHLYGIHSVQAALENPKRILKCL 66

Query: 72  LATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRN 131
             T+NAL RL+   +  +P  V    P+ +D +VG EAVHQG+ LET PL    L  + N
Sbjct: 67  YVTQNALKRLNISES-DYPCSVTLCTPKYLDSLVGSEAVHQGIVLETLPLKPCKLSELTN 125

Query: 132 SQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIR 191
           + L++V+D + DPHN+GAI+RSAVA     +ITT R+SP ES VLAK+ASGALE I YI 
Sbjct: 126 TDLVIVMDQITDPHNVGAIMRSAVALKAKALITTCRHSPHESGVLAKAASGALEMIHYIT 185

Query: 192 ISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSM 251
           + NL +ALQ++H  GF + GL S+  KPLE  +  +KIAL+LGAEGKGLR KT+ET  ++
Sbjct: 186 VRNLAEALQELHQTGFSSFGLDSEGDKPLETALTGNKIALVLGAEGKGLRKKTRETVCAL 245

Query: 252 AHLHMPGIIKALNVSNAAAVALYITQNHF 280
             L MPG IK+LNVSNAA +ALY+   + 
Sbjct: 246 TRLDMPGNIKSLNVSNAATIALYVAHKYL 274


>gi|218661645|ref|ZP_03517575.1| tRNA/rRNA methyltransferase protein [Rhizobium etli IE4771]
          Length = 254

 Score =  260 bits (665), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 131/223 (58%), Positives = 166/223 (74%), Gaps = 3/223 (1%)

Query: 46  PENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDA-NLPHPFPVKTVPPQTIDKI 104
           P+    YG+HTV AAL+NP RK  +L  T+NALARL+ D   L   F +  V P  IDK+
Sbjct: 19  PDQGLSYGLHTVRAALDNPERKKIKLSVTQNALARLEIDVETLGIAFEI--VSPHEIDKV 76

Query: 105 VGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIIT 164
           +G EA+HQG+ LET PL    L+A+++S LL+VLD V DPHN+GAI+RSAVAF+   +IT
Sbjct: 77  LGPEAIHQGVMLETRPLPVRRLEALKDSPLLLVLDQVTDPHNVGAIMRSAVAFNAGAVIT 136

Query: 165 TKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEI 224
           T+R+SP+ES VLAKSASGALE IPYI+I+NL DAL ++H  GF TIGL S+   PLE   
Sbjct: 137 TQRHSPTESGVLAKSASGALELIPYIQITNLADALGELHKLGFSTIGLDSEGPAPLEGTF 196

Query: 225 KNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSN 267
             DK+AL+LG+EGKGLR KT+ET T++A L MPG IK+LNVSN
Sbjct: 197 SGDKVALVLGSEGKGLRQKTRETVTALARLDMPGAIKSLNVSN 239


>gi|319899065|ref|YP_004159158.1| tRNA/rRNA metyltransferase [Bartonella clarridgeiae 73]
 gi|319403029|emb|CBI76584.1| tRNA/rRNA metyltransferase [Bartonella clarridgeiae 73]
          Length = 271

 Score =  257 bits (656), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 135/260 (51%), Positives = 176/260 (67%), Gaps = 4/260 (1%)

Query: 16  KDSHYAKLRRNHRDYKKMQSFNQKSRHTS-QPENLFLYGVHTVSAALNNPSRKIFQLLAT 74
           KDSHYA+LRR +RD K      Q S H   Q E ++LYG+H V AAL NP R +  L AT
Sbjct: 7   KDSHYARLRRQYRDTKGF--LFQSSTHPKLQKEKIYLYGIHPVRAALKNPRRILRHLYAT 64

Query: 75  KNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQL 134
            NAL RL+ + +     P+    P+ ++  VG EAVHQGL LET  L S +L  + N+ L
Sbjct: 65  PNALKRLNINES-SLSCPITLCLPKKLEAFVGNEAVHQGLVLETETLKSHSLSELTNTDL 123

Query: 135 LMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISN 194
           ++V+D + DPHN+GAI+RSAVAF    IITT R+SP ES VLAK+ASGALE I YI + N
Sbjct: 124 IIVMDQITDPHNVGAIMRSAVAFKAGAIITTNRHSPQESGVLAKAASGALELIEYITVQN 183

Query: 195 LTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHL 254
           L+ AL++++   F + GL S+ + PLE  +  +KI+L+LGAE KGLR KT+ET   +A L
Sbjct: 184 LSQALKELNQMNFISFGLDSEGELPLEIALTGNKISLVLGAESKGLRQKTRETVYKLARL 243

Query: 255 HMPGIIKALNVSNAAAVALY 274
            MPG IK+LNVSNAA +ALY
Sbjct: 244 DMPGDIKSLNVSNAATIALY 263


>gi|121602409|ref|YP_988872.1| RNA methyltransferase [Bartonella bacilliformis KC583]
 gi|120614586|gb|ABM45187.1| RNA methyltransferase, TrmH family [Bartonella bacilliformis KC583]
          Length = 276

 Score =  254 bits (648), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 133/269 (49%), Positives = 184/269 (68%), Gaps = 5/269 (1%)

Query: 16  KDSHYAKLRRNHRDYKK-MQSFNQKSRHTSQP---ENLFLYGVHTVSAALNNPSRKIFQL 71
           ++S++A LRR +RD K  + S + + ++   P   E + LYG+H V+AAL NP+R +  L
Sbjct: 7   RNSYFASLRRQYRDTKGFISSPSARFKYGPSPLTAEKIRLYGIHAVNAALQNPNRVLECL 66

Query: 72  LATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRN 131
            AT NAL RL+   + P P  ++   P+ +D ++G +AVHQG+ LET PL S  L  + +
Sbjct: 67  YATPNALKRLNIVESNP-PCLLELCSPKKLDTLIGSDAVHQGVVLETKPLKSRHLSELTH 125

Query: 132 SQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIR 191
           + L++V+D + DPHN+GAI+RSAVAF    +ITT R+SP ES VLAK+ASGALE I YI 
Sbjct: 126 TDLVVVMDQITDPHNVGAIMRSAVAFKAGALITTHRHSPQESGVLAKAASGALEMIDYIT 185

Query: 192 ISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSM 251
           + NL +AL+++H   F + GL S+  KPLE  +   KIALILGAEGKGLR KT+ET  ++
Sbjct: 186 VRNLAEALKELHKADFISFGLDSEGGKPLEIALTGQKIALILGAEGKGLRKKTRETVCAL 245

Query: 252 AHLHMPGIIKALNVSNAAAVALYITQNHF 280
           A L MPG IK+LNVSNAA +ALY T  + 
Sbjct: 246 ARLDMPGNIKSLNVSNAATIALYATHKYL 274


>gi|218516180|ref|ZP_03513020.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Rhizobium etli 8C-3]
          Length = 252

 Score =  247 bits (630), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 127/238 (53%), Positives = 166/238 (69%), Gaps = 14/238 (5%)

Query: 14  SLKDSHYAKLRRNHRDYKKMQSF-----NQKSRHTSQ--------PENLFLYGVHTVSAA 60
           S KD+HYA LRR HRD K+ +        QK +  ++        P+ ++LYG+HTV AA
Sbjct: 16  SAKDTHYANLRRAHRDAKRERGEIPTPQPQKRKRGAEDWKPPALAPDQVYLYGLHTVRAA 75

Query: 61  LNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAP 120
           L+NP RK  +L  T+NALARL+ D   P   P + V P  IDK++G EA+HQG+ LET P
Sbjct: 76  LDNPERKKIKLSVTQNALARLEIDIE-PLGIPFEIVAPHEIDKVLGPEAIHQGVMLETRP 134

Query: 121 LLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSA 180
           L    L+A+++S LL+VLD V DPHN+GAI+RSAVAF+   +ITT+R+SP+ES VLAKSA
Sbjct: 135 LPVRRLEALKDSPLLLVLDQVTDPHNVGAIMRSAVAFNAGAVITTQRHSPTESGVLAKSA 194

Query: 181 SGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGK 238
           SGALE IPYI+I+NL DAL ++H  GF TIGL S+   PLE     DK+AL+LG+EGK
Sbjct: 195 SGALELIPYIQITNLADALGELHKLGFSTIGLDSEGPAPLEGTFSGDKLALVLGSEGK 252


>gi|319405864|emb|CBI79496.1| tRNA/rRNA metyltransferase [Bartonella sp. AR 15-3]
          Length = 276

 Score =  246 bits (628), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 130/259 (50%), Positives = 173/259 (66%), Gaps = 11/259 (4%)

Query: 16  KDSHYAKLRRNHRDYKKMQSFNQKSRHTSQP------ENLFLYGVHTVSAALNNPSRKIF 69
           +DS YA+LRR +RD K   SF Q S +  QP        ++LYG+H V AAL NP R + 
Sbjct: 7   QDSRYARLRRQYRDIKG--SFFQSSTYVKQPFIPLQKAQIYLYGIHPVHAALKNPRRILR 64

Query: 70  QLLATKNALARLDW-DANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDA 128
            L AT NAL RL+  ++N+P    + +  P+ ++  VG EAVHQG+ LET PL S +L  
Sbjct: 65  HLYATPNALKRLNINESNIP--CSITSCSPKKLETFVGSEAVHQGIVLETEPLKSHSLSE 122

Query: 129 VRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIP 188
           + N+ L++V+D + DPHN+GAI+RSAVAF    IITT R+SP ES VLAK+ASGALE I 
Sbjct: 123 LTNTNLIIVMDQITDPHNVGAIMRSAVAFKAGAIITTNRHSPQESGVLAKAASGALELIE 182

Query: 189 YIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETA 248
           YI + NL+ AL+++    F + GL S+   PLE  +  +KI+LILGAEGKGLR KT+E  
Sbjct: 183 YITVHNLSKALKELQQMNFISFGLDSEGGFPLETALTGNKISLILGAEGKGLRQKTRENV 242

Query: 249 TSMAHLHMPGIIKALNVSN 267
            S+  L +PG IK+LNVSN
Sbjct: 243 YSLVRLDLPGDIKSLNVSN 261


>gi|49475390|ref|YP_033431.1| tRNA /rRNA methyltransferase [Bartonella henselae str. Houston-1]
 gi|49238196|emb|CAF27406.1| tRNA /rRNA methyltransferase [Bartonella henselae str. Houston-1]
          Length = 274

 Score =  246 bits (627), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 130/274 (47%), Positives = 173/274 (63%), Gaps = 17/274 (6%)

Query: 16  KDSHYAKLRRNHRDYK------KMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIF 69
           K  HY +L+R   D K      +M+  +   RH +    ++LYG+H+V AAL NP R   
Sbjct: 7   KSFHYNRLQRRSHDKKGFLPAARMKQKSVPMRHGT----IYLYGLHSVHAALKNPKRVFE 62

Query: 70  QLLATKNALARLDWDANLPH---PFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTL 126
            L  T NAL RL    N+P    P P+    P+ +D  VG +AVHQG+ LET PL    L
Sbjct: 63  HLYITPNALKRL----NIPESDLPCPITLCLPKQLDSFVGNDAVHQGIVLETEPLKPCQL 118

Query: 127 DAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEH 186
             + N+ L++V+D + DPHN+GAI+RSAVAF  + +ITT R+SP ES VLAK+ASGALE 
Sbjct: 119 SELTNTDLVIVMDQITDPHNVGAIMRSAVAFKAEALITTYRHSPQESGVLAKAASGALEM 178

Query: 187 IPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQE 246
           I YI + NL + LQ++H  GF + GL S+   PLE  +  +KIAL+LGAEGKGLR KT+E
Sbjct: 179 IHYITVQNLAETLQELHKAGFISFGLDSEGNHPLETTLTGEKIALVLGAEGKGLRKKTRE 238

Query: 247 TATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
              ++  L MPG IK+LNVSNAA +ALY    + 
Sbjct: 239 NVCALTRLDMPGNIKSLNVSNAATIALYAAHKYL 272


>gi|319408375|emb|CBI82028.1| tRNA/rRNA metyltransferase [Bartonella schoenbuchensis R1]
          Length = 276

 Score =  243 bits (621), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 136/269 (50%), Positives = 181/269 (67%), Gaps = 5/269 (1%)

Query: 16  KDSHYAKLRRNHRDYKKMQSFNQKS-RHTSQP---ENLFLYGVHTVSAALNNPSRKIFQL 71
           K+S++   RR +RD K     +    +H S P     ++LYG+H+V  AL NP R    L
Sbjct: 7   KNSYFPHPRRQYRDIKSATRVSSTHLKHRSAPLIQGTVYLYGIHSVKEALKNPKRVFNHL 66

Query: 72  LATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRN 131
            AT NAL RL+   +   P P+K  PP+ +D +VGK+AVHQG+ LET  L    L  + N
Sbjct: 67  YATPNALKRLNITES-DVPCPLKLYPPKKLDTLVGKDAVHQGVVLETEVLKPRHLSELTN 125

Query: 132 SQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIR 191
           + L++V+D + DPHN+GAI+RSAVAF    IITT R+SP ES VLAK+ASGALE I YI 
Sbjct: 126 TNLIIVMDQITDPHNVGAIMRSAVAFKAGAIITTYRHSPQESGVLAKAASGALELIDYIT 185

Query: 192 ISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSM 251
           + NL +AL+++H  GF ++GL S+ + PLE  +   KIALILGAEGKGLR KT+ET  S+
Sbjct: 186 VRNLAEALKEIHQAGFNSLGLDSEGELPLETALTGKKIALILGAEGKGLRKKTRETVHSL 245

Query: 252 AHLHMPGIIKALNVSNAAAVALYITQNHF 280
           A L++PG IK+LNVSNAAA+ALY   N+ 
Sbjct: 246 ARLNIPGDIKSLNVSNAAAIALYAAHNYL 274


>gi|49474315|ref|YP_032357.1| tRNA /rRNA methyltransferase [Bartonella quintana str. Toulouse]
 gi|49239819|emb|CAF26210.1| tRNA /rRNA methyltransferase [Bartonella quintana str. Toulouse]
          Length = 272

 Score =  235 bits (600), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 129/273 (47%), Positives = 169/273 (61%), Gaps = 13/273 (4%)

Query: 16  KDSHYAKLRRNHRD-----YKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQ 70
           K+ HYA L+   RD     ++      QK+    Q   + LYG HTV+AAL NP R    
Sbjct: 3   KNFHYAHLQDRSRDKKSFPFRPAAHLKQKAVPLRQ-GTIRLYGFHTVNAALKNPKRVFGH 61

Query: 71  LLATKNALARLDWDANLPH---PFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLD 127
           L  T NAL RL    N+P    P  V    P+ +D +VG +AVHQG+ LET  L    L 
Sbjct: 62  LYITLNALKRL----NIPKSDLPCSVTLYSPKQLDSLVGSDAVHQGIILETESLKPCQLS 117

Query: 128 AVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHI 187
            + N+ L++V+D + DPHN+GAI+RSA+AF    +ITT R+SP ES VLAK+ASGALE I
Sbjct: 118 ELTNTDLVIVMDQITDPHNVGAIMRSAIAFKAGALITTCRHSPQESGVLAKAASGALEII 177

Query: 188 PYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQET 247
            YI + NL + LQ++H  GF + GL S+    LE  +   KIAL+LGAEGKGLR KT+ET
Sbjct: 178 NYITVRNLAETLQELHKAGFISFGLDSEGDHSLETALTGRKIALVLGAEGKGLRKKTRET 237

Query: 248 ATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
             ++  L MPG IK+LNVSNAA +ALY+   + 
Sbjct: 238 VCALTRLDMPGNIKSLNVSNAATIALYVAHKYL 270


>gi|75676251|ref|YP_318672.1| RNA methyltransferase TrmH, group 3 [Nitrobacter winogradskyi
           Nb-255]
 gi|74421121|gb|ABA05320.1| RNA methyltransferase TrmH, group 3 [Nitrobacter winogradskyi
           Nb-255]
          Length = 283

 Score =  225 bits (574), Expect = 5e-57,   Method: Compositional matrix adjust.
 Identities = 119/254 (46%), Positives = 165/254 (64%), Gaps = 1/254 (0%)

Query: 28  RDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANL 87
           R+++  +   +K+R TS      LYG HTV+AAL NP R+I +LL T+NA  RL  + N+
Sbjct: 28  RNHQPKRGSARKARETSPDGPAVLYGWHTVTAALANPRRRIRKLLVTENAARRLTHE-NI 86

Query: 88  PHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDHVNDPHNI 147
             P   + V P  ID+ +G +AVHQGL  E  PL SP ++ +    +++VLD + DPHN+
Sbjct: 87  DTPITPEIVRPSAIDQRLGPDAVHQGLLAEADPLPSPDIETLTQEGIVLVLDQITDPHNV 146

Query: 148 GAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGF 207
           GAI+RSA AFS   I+TT R+SP  + VLAKSASGALE +P + + NL  AL  ++  GF
Sbjct: 147 GAIMRSAAAFSVKAIVTTARHSPEATGVLAKSASGALEIVPLVLVQNLARALAGLNDRGF 206

Query: 208 QTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSN 267
            T+GL S   + L      + +AL+LGAEGKGLR  T++T +++A L MPG IK+LNVSN
Sbjct: 207 MTVGLDSAGSENLAAVPLREPLALVLGAEGKGLRQLTRDTCSAVARLDMPGHIKSLNVSN 266

Query: 268 AAAVALYITQNHFA 281
           AA +ALYI  +   
Sbjct: 267 AAVLALYIGASRLG 280


>gi|90425125|ref|YP_533495.1| RNA methyltransferase TrmH, group 3 [Rhodopseudomonas palustris
           BisB18]
 gi|90107139|gb|ABD89176.1| RNA methyltransferase TrmH, group 3 [Rhodopseudomonas palustris
           BisB18]
          Length = 275

 Score =  223 bits (569), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 123/269 (45%), Positives = 165/269 (61%), Gaps = 1/269 (0%)

Query: 13  FSLKDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLL 72
           F  K     K  ++ R+ K+      + R +       LYG HTV AAL NP R I +LL
Sbjct: 4   FERKPRFGRKPDKSSRNPKEAGRQPWRDRESRPDGPAILYGWHTVVAALGNPQRTIRKLL 63

Query: 73  ATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNS 132
            ++NA  RL  D N+    P + V P  ID+ +G +AVHQGL  E  PL  P LD +   
Sbjct: 64  LSENAARRL-ADENIDTRVPPEIVRPSLIDQRLGPDAVHQGLLAEADPLEPPELDTLPQQ 122

Query: 133 QLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRI 192
            +++VLD + DPHN+GAILRSA AF+   I+TT R+SP  + VLAKSASGALE +P + +
Sbjct: 123 GIVLVLDQITDPHNVGAILRSAAAFAVKAIVTTARHSPEATGVLAKSASGALELVPMVTV 182

Query: 193 SNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMA 252
            NL  AL  ++  GFQT+GL S+    L     +  +AL+LGAEGKGLR  T++T +++A
Sbjct: 183 QNLARALTDLNDRGFQTVGLDSEGGDDLATIPLSAPLALVLGAEGKGLRQLTRQTCSALA 242

Query: 253 HLHMPGIIKALNVSNAAAVALYITQNHFA 281
            L MPG IK+LNVSNAAA+ALYI  +   
Sbjct: 243 RLDMPGEIKSLNVSNAAALALYIGASRLG 271


>gi|254470423|ref|ZP_05083827.1| RNA methyltransferase, TrmH family, group 3 [Pseudovibrio sp.
           JE062]
 gi|211960734|gb|EEA95930.1| RNA methyltransferase, TrmH family, group 3 [Pseudovibrio sp.
           JE062]
          Length = 289

 Score =  221 bits (564), Expect = 6e-56,   Method: Compositional matrix adjust.
 Identities = 115/276 (41%), Positives = 177/276 (64%), Gaps = 13/276 (4%)

Query: 14  SLKDSHYAKLRRNHRDYKKMQ--------SFNQ----KSRHTSQPENLFLYGVHTVSAAL 61
           S   S ++  + N R YKK +        SF++    + +  ++    ++YG+HT+ AA 
Sbjct: 9   STGGSRWSPTQGNDRPYKKKRPDGKSSGGSFSKGKPWQKKSAAEDGPFYIYGLHTIEAAF 68

Query: 62  NNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPL 121
            NP RK  +L+ T+NAL RL+ + NL    PV+   P+ IDK+VGK+AVHQG AL    L
Sbjct: 69  KNPERKRHKLVVTQNALRRLE-ERNLKIDVPVEDASPRDIDKLVGKDAVHQGAALLVDAL 127

Query: 122 LSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSAS 181
                + +++ QL++ LD V DPHN+GAILRSAVA + D ++TT+R++P E  VLAK+AS
Sbjct: 128 PEYGPEELKDGQLVLALDQVTDPHNVGAILRSAVALNADAVVTTRRHAPEEGPVLAKTAS 187

Query: 182 GALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLR 241
           GAL+ I ++RI N++  +++M   G+Q I L S+  + +E     DK  L+LG+EGKG+R
Sbjct: 188 GALDMIKHVRIQNMSRFVEEMRDKGYQAIALDSEGPEAVENTAFTDKTLLVLGSEGKGVR 247

Query: 242 PKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQ 277
              +++  ++A L MPG IK+LNVSNAA ++LY+ +
Sbjct: 248 EGVRKSCDTLARLDMPGEIKSLNVSNAAILSLYVAR 283


>gi|220924093|ref|YP_002499395.1| tRNA/rRNA methyltransferase (SpoU) [Methylobacterium nodulans ORS
           2060]
 gi|219948700|gb|ACL59092.1| tRNA/rRNA methyltransferase (SpoU) [Methylobacterium nodulans ORS
           2060]
          Length = 259

 Score =  221 bits (564), Expect = 8e-56,   Method: Compositional matrix adjust.
 Identities = 114/251 (45%), Positives = 158/251 (62%), Gaps = 2/251 (0%)

Query: 24  RRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDW 83
           R   RD +     ++++      + + LYG H V+ AL NP R + +LLAT+NALARL  
Sbjct: 5   RTAPRDRRHRSGADRRAAPAGD-DRIILYGWHPVTEALRNPGRGLHRLLATENALARLAA 63

Query: 84  DANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDHVND 143
           +       P + V P  I  +VG +AVHQGL LE  PL +P  D +    +L+ LD + D
Sbjct: 64  ELGELRIVP-QMVRPGEISALVGPDAVHQGLYLEAEPLRAPAFDTLPPDAVLLALDQITD 122

Query: 144 PHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMH 203
           PHN+GAI+R+A AF+   I+TT R+SP+ + VLAKSASG LEH+P++ + NL +AL  + 
Sbjct: 123 PHNVGAIVRTAAAFNVTAIVTTARHSPAATGVLAKSASGGLEHVPFVTVRNLAEALIDLG 182

Query: 204 SWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKAL 263
             GF  IGL S++  PL+Q      + ++LGAEGKGLR +T+E    MA L  PG IK+L
Sbjct: 183 ERGFTRIGLDSEAPVPLDQVTPAPPLVIVLGAEGKGLRQRTRECCDVMARLDFPGAIKSL 242

Query: 264 NVSNAAAVALY 274
           NVSNAAA+ LY
Sbjct: 243 NVSNAAAITLY 253


>gi|148256472|ref|YP_001241057.1| putative rRNA methylase [Bradyrhizobium sp. BTAi1]
 gi|146408645|gb|ABQ37151.1| putative rRNA methylase [Bradyrhizobium sp. BTAi1]
          Length = 280

 Score =  220 bits (561), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 117/254 (46%), Positives = 159/254 (62%), Gaps = 3/254 (1%)

Query: 28  RDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANL 87
           R +++ Q +  + + +  P  + LYG HTV+ AL NP R+I +L  T+NA  RL  D  +
Sbjct: 26  RKFERPQPWRDREQGSDGP--VILYGWHTVTLALGNPKRRIRKLYLTENAARRL-ADERI 82

Query: 88  PHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDHVNDPHNI 147
                 + V P  ID+ +G +AVHQGL  E  PL SP +D +    +++VLD + DPHN+
Sbjct: 83  ETRVTPEIVRPSQIDQRLGPDAVHQGLLAEADPLPSPDIDTLAAEGMILVLDQITDPHNV 142

Query: 148 GAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGF 207
           GAILRSA AF    I+TT R+SP  + VLAKSASGALE +P I + NL  AL ++   GF
Sbjct: 143 GAILRSAAAFDVKAIVTTARHSPEATGVLAKSASGALELVPIITVQNLARALTRLDERGF 202

Query: 208 QTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSN 267
           QT+GL S     +      + +AL+LGAEGKGLR  T+ET + +A L MPG IK+LNVSN
Sbjct: 203 QTVGLDSAGPTDIAAVALREPLALVLGAEGKGLRQLTRETCSVVARLDMPGAIKSLNVSN 262

Query: 268 AAAVALYITQNHFA 281
           AA +ALYI  +   
Sbjct: 263 AAVLALYIGASRLG 276


>gi|92118023|ref|YP_577752.1| RNA methyltransferase TrmH, group 3 [Nitrobacter hamburgensis X14]
 gi|91800917|gb|ABE63292.1| RNA methyltransferase TrmH, group 3 [Nitrobacter hamburgensis X14]
          Length = 283

 Score =  219 bits (559), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 121/265 (45%), Positives = 162/265 (61%), Gaps = 3/265 (1%)

Query: 17  DSHYAKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKN 76
           DSH  K     R   +  + N +      P    LYG HTV+AAL NP R+I +LL T+N
Sbjct: 19  DSHARKAGDRKRPPGRGSARNGRETGADGPA--ILYGWHTVTAALANPRRRIRKLLLTEN 76

Query: 77  ALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLM 136
           A  RL  + N+      + V P  ID+ +G +AVHQGL  E  PL SP +D +    +++
Sbjct: 77  AARRL-ANENIETRLTPEIVRPSAIDQRLGPDAVHQGLLAEADPLPSPDIDTLAQEGIVL 135

Query: 137 VLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLT 196
           VLD + DPHN+GAI+RSA AF+   I+TT R+SP  + VLAKSASGALE +P + + NL 
Sbjct: 136 VLDQITDPHNVGAIMRSAAAFAVKAIVTTARHSPEATGVLAKSASGALELVPLVLVQNLA 195

Query: 197 DALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHM 256
            AL +++  GF T+GL S   + L        +AL+LGAEGKGLR  T+ET  ++A L M
Sbjct: 196 RALTELNDRGFMTVGLDSAGGEDLAAIQLRQPLALVLGAEGKGLRQLTRETCNAVARLDM 255

Query: 257 PGIIKALNVSNAAAVALYITQNHFA 281
           PG IK+LNVSNAA +ALYI  +   
Sbjct: 256 PGDIKSLNVSNAAVLALYIGASRLG 280


>gi|170741100|ref|YP_001769755.1| tRNA/rRNA methyltransferase (SpoU) [Methylobacterium sp. 4-46]
 gi|168195374|gb|ACA17321.1| tRNA/rRNA methyltransferase (SpoU) [Methylobacterium sp. 4-46]
          Length = 268

 Score =  219 bits (557), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 110/228 (48%), Positives = 150/228 (65%), Gaps = 1/228 (0%)

Query: 47  ENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVG 106
           + + LYG H V+ AL NP R++ +LLAT+N LARL  +       P +TV P  I  +VG
Sbjct: 36  DTVVLYGWHPVAEALRNPRRRLTRLLATENGLARLTEEVGELRIAP-ETVRPGEISALVG 94

Query: 107 KEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTK 166
            +AVHQGL LE  PL  P ++ +    +L+ LD + DPHN+GAI+R+A AF+   I+TT 
Sbjct: 95  PDAVHQGLYLEAEPLPVPPIEDLPADAVLLALDQITDPHNVGAIVRTAAAFAVTAIVTTA 154

Query: 167 RYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKN 226
           R+SP+ + VLAKSASG LEH+P+I + NL +AL +    GF  IGL S++  PL +    
Sbjct: 155 RHSPAATGVLAKSASGGLEHVPFITVRNLAEALIRFGEQGFTRIGLDSEAPVPLSEVTPT 214

Query: 227 DKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
             + ++LGAEGKGLR +T+E    MA L  PG IK+LNVSNAAA+ LY
Sbjct: 215 RPLVIVLGAEGKGLRQRTRECCDVMARLDFPGAIKSLNVSNAAAITLY 262


>gi|27380610|ref|NP_772139.1| tRNA/rRNA metyltransferase [Bradyrhizobium japonicum USDA 110]
 gi|27353775|dbj|BAC50764.1| tRNA/rRNA metyltransferase [Bradyrhizobium japonicum USDA 110]
          Length = 308

 Score =  219 bits (557), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 111/243 (45%), Positives = 160/243 (65%), Gaps = 1/243 (0%)

Query: 39  KSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPP 98
           + R ++    + LYG H+V+ AL NP+R+I +L  T+NA  RL  + N+      + V P
Sbjct: 63  RDRDSASDGPVILYGWHSVTMALQNPARRIRKLTLTENAARRLA-EENIETRVTPEIVRP 121

Query: 99  QTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFS 158
           Q ID+++  +AVHQGL  E  PL SP ++ +    +++VLD + DPHN+GAILRSA AF+
Sbjct: 122 QEIDRLLSPDAVHQGLLAEADPLPSPDIETLTPEGMVLVLDQITDPHNVGAILRSAAAFA 181

Query: 159 CDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKK 218
              I+TT R+SP  + VLAK+ASGALE +P + + NL  AL  ++  GFQT+GL S+  +
Sbjct: 182 VKAIVTTARHSPEATGVLAKAASGALELVPVVTVQNLARALTALNERGFQTVGLDSEGSE 241

Query: 219 PLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQN 278
            L      + +AL+LGAEGKGLR  T+ET + +A L MPG IK+LNVSNAAA++LY+  +
Sbjct: 242 DLSNVALREPLALVLGAEGKGLRQLTRETCSVVARLDMPGEIKSLNVSNAAALSLYVGAS 301

Query: 279 HFA 281
              
Sbjct: 302 RLG 304


>gi|158422502|ref|YP_001523794.1| RNA methyltransferase [Azorhizobium caulinodans ORS 571]
 gi|158329391|dbj|BAF86876.1| RNA methyltransferase [Azorhizobium caulinodans ORS 571]
          Length = 281

 Score =  218 bits (556), Expect = 6e-55,   Method: Compositional matrix adjust.
 Identities = 113/233 (48%), Positives = 153/233 (65%), Gaps = 1/233 (0%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEA 109
            LYG HTVS AL NP+R+  ++LAT+NA  RL  +   P P   + V P  IDK++G +A
Sbjct: 48  LLYGWHTVSEALANPARRFRKILATENAANRLQ-EEGFPLPVAPEIVRPSEIDKLLGSDA 106

Query: 110 VHQGLALETAPLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYS 169
           VHQGL  E   L SP L  V  S L++VLD + DPHN+GAI+RSA AF+   I+TT R+S
Sbjct: 107 VHQGLLAEAEHLPSPPLKKVAKSDLVLVLDQITDPHNVGAIVRSAAAFAVGAIVTTARHS 166

Query: 170 PSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKI 229
           P  + VLAKSASG LEH+P+  ++NL  AL+++ + G   +GL S+    LE       +
Sbjct: 167 PVATGVLAKSASGGLEHVPFCLVTNLARALEELKASGMLVVGLDSEGPADLEDTAMRPPM 226

Query: 230 ALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHFAK 282
           AL+LGAEGKGLR  T+ET   +A + +PG IK+LNVSNAAA++L I +    +
Sbjct: 227 ALVLGAEGKGLRQLTRETCDVLARIDLPGAIKSLNVSNAAALSLGIARRALKR 279


>gi|115525681|ref|YP_782592.1| RNA methyltransferase [Rhodopseudomonas palustris BisA53]
 gi|115519628|gb|ABJ07612.1| RNA methyltransferase, TrmH family, group 3 [Rhodopseudomonas
           palustris BisA53]
          Length = 276

 Score =  218 bits (556), Expect = 6e-55,   Method: Compositional matrix adjust.
 Identities = 117/238 (49%), Positives = 154/238 (64%), Gaps = 2/238 (0%)

Query: 45  QPEN-LFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDK 103
           +PE    LYG HTV AAL NP R+I  L  T+NA  RL  D N+P     + V P  ID+
Sbjct: 35  RPEGPAILYGWHTVVAALANPQRRIRSLFLTENAARRLS-DENIPTRVQPEIVRPSAIDQ 93

Query: 104 IVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGII 163
            +G +AVHQGL  E  PL SP +D++    +++VLD + DPHN+GAILRSA AF+   I+
Sbjct: 94  RLGPDAVHQGLLAEVDPLPSPDIDSLPQEGIVLVLDQITDPHNVGAILRSAAAFAVKAIV 153

Query: 164 TTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQE 223
            T R+SP  + VLAKSASGALE +P + + NL  AL +++  GF TIGL S+    L   
Sbjct: 154 ITARHSPEATGVLAKSASGALELVPLVSVGNLARALTELNDRGFLTIGLDSEGDDDLASI 213

Query: 224 IKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHFA 281
                +AL+LGAEGKGLR  T++T  ++A L +PG IK+LNVSNAAA+ALYI  +   
Sbjct: 214 ELTQPLALVLGAEGKGLRQLTRQTCGALARLDLPGDIKSLNVSNAAALALYIGASRLG 271


>gi|316933379|ref|YP_004108361.1| RNA methyltransferase, TrmH family, group 3 [Rhodopseudomonas
           palustris DX-1]
 gi|315601093|gb|ADU43628.1| RNA methyltransferase, TrmH family, group 3 [Rhodopseudomonas
           palustris DX-1]
          Length = 275

 Score =  218 bits (554), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 117/265 (44%), Positives = 165/265 (62%), Gaps = 1/265 (0%)

Query: 17  DSHYAKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKN 76
           +S +++     R   +   F + +R       + LYG HTV+AAL NP RK  +L  T+N
Sbjct: 7   NSRFSRRDGPPRGKPRPAGFRRDARERDGDGPVILYGWHTVTAALANPRRKFRKLWLTEN 66

Query: 77  ALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLM 136
           A AR   D N+      + V P  ID+ +G +AVHQG+  E   L +P +D +    +++
Sbjct: 67  A-ARKLADENIDTRIAPEIVRPSEIDRRLGPDAVHQGMLAEADALETPRIDTLPEHGIVL 125

Query: 137 VLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLT 196
           VLD + DPHN+GAILRSA AF+   I+TT R+SP  + VLAKSASGALE +P + + NL+
Sbjct: 126 VLDQITDPHNVGAILRSAAAFAVQAIVTTARHSPEATGVLAKSASGALELVPLVLVQNLS 185

Query: 197 DALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHM 256
            AL +++  GF T+GL S+ +  L        +AL+LGAEGKGLR  T++T T++A L M
Sbjct: 186 RALTELNERGFLTVGLDSEGEDDLAAVALRQPLALVLGAEGKGLRQLTRQTCTTVARLDM 245

Query: 257 PGIIKALNVSNAAAVALYITQNHFA 281
           PG IK+LNVSNAAA+ALYI  +   
Sbjct: 246 PGEIKSLNVSNAAALALYIGASRLG 270


>gi|146340002|ref|YP_001205050.1| putative rRNA methylase 23S rRNA
           (guanosine-2'-O-)-methyltransferase rlmB-like
           [Bradyrhizobium sp. ORS278]
 gi|146192808|emb|CAL76813.1| putative rRNA methylase; putative 23S rRNA
           (guanosine-2'-O-)-methyltransferase rlmB-like
           [Bradyrhizobium sp. ORS278]
          Length = 297

 Score =  216 bits (551), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 114/233 (48%), Positives = 151/233 (64%), Gaps = 1/233 (0%)

Query: 49  LFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKE 108
           + LYG HTVS AL NP R+I +L  T+NA  RL  D ++      + V P  ID+ +G +
Sbjct: 62  VILYGWHTVSLALANPKRRIRKLYLTENAARRL-ADEHIETRVTPEIVRPSQIDQRLGPD 120

Query: 109 AVHQGLALETAPLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRY 168
           AVHQGL  E  PL SP +D +    +++VLD + DPHN+GAILRSA AF    I+TT R+
Sbjct: 121 AVHQGLLAEADPLPSPDIDTLAPEGMILVLDQITDPHNVGAILRSAAAFDVKAIVTTARH 180

Query: 169 SPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDK 228
           SP  + VLAKSASGALE +P I + NL  AL +++  GFQT+GL S     +        
Sbjct: 181 SPEATGVLAKSASGALELVPMITVQNLARALTRLNERGFQTVGLDSAGDTDIAAVTLRQP 240

Query: 229 IALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHFA 281
           +AL+LGAEGKGLR  T+ET +++A L MPG IK+LNVSNAA +ALY+  +   
Sbjct: 241 LALVLGAEGKGLRQLTRETCSAVARLDMPGAIKSLNVSNAAVLALYVGASRLG 293


>gi|304391896|ref|ZP_07373838.1| 23S rRNA (guanosine-2'-O-)-methyltransferase RlmB [Ahrensia sp.
           R2A130]
 gi|303296125|gb|EFL90483.1| 23S rRNA (guanosine-2'-O-)-methyltransferase RlmB [Ahrensia sp.
           R2A130]
          Length = 287

 Score =  216 bits (551), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 119/245 (48%), Positives = 163/245 (66%), Gaps = 11/245 (4%)

Query: 47  ENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHP-FPVKTVPPQTIDKIV 105
           EN++LYGVHTV AAL NP RK+ QLLAT + + RLD +A   HP   ++      +D++V
Sbjct: 44  ENVWLYGVHTVDAALRNPKRKVRQLLATDSGMERLDHNALAQHPDLDIRIGKTADLDRMV 103

Query: 106 GKEAVHQGLALETAPLLSPT---LDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGI 162
             ++VHQGL L+  PLL      L    + Q+++VLD V DPHN+GAILRSAVA     +
Sbjct: 104 TADSVHQGLLLDCEPLLREEPKDLYDFADDQIILVLDQVTDPHNVGAILRSAVAMGVKTV 163

Query: 163 ITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLE- 221
           + T R+  SE+ VLAKSASGA++ +  + I NL+ +L ++    F  IGL  DS+ PLE 
Sbjct: 164 LVTSRHQSSETGVLAKSASGAVDMVDMLAIRNLSKSLDELREHRFAVIGL--DSEGPLEV 221

Query: 222 QEIKND----KIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQ 277
           QE  +D    K+AL+LGAEGKGLR +T+E  T++A L MPG IK+LNVSNAAA++LY+ +
Sbjct: 222 QETLDDLKPSKVALVLGAEGKGLREQTREACTALARLDMPGPIKSLNVSNAAALSLYLVR 281

Query: 278 NHFAK 282
               K
Sbjct: 282 AAIKK 286


>gi|91977697|ref|YP_570356.1| RNA methyltransferase TrmH, group 3 [Rhodopseudomonas palustris
           BisB5]
 gi|91684153|gb|ABE40455.1| RNA methyltransferase TrmH, group 3 [Rhodopseudomonas palustris
           BisB5]
          Length = 273

 Score =  216 bits (551), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 115/232 (49%), Positives = 154/232 (66%), Gaps = 1/232 (0%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEA 109
            LYG HTV+AAL NP R+I +L  T+NA AR   D N+      + V P  ID+ +G +A
Sbjct: 40  ILYGWHTVTAALANPERRIRKLWLTENA-ARKLADENIDTKVTPEIVRPGEIDQRLGPDA 98

Query: 110 VHQGLALETAPLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYS 169
           VHQG+  E  PL SP +D +    +++VLD + DPHN+GAILRSA AF+   I+TT R+S
Sbjct: 99  VHQGMLAEADPLDSPRIDTLPQDGIVLVLDQITDPHNVGAILRSAAAFAVKAIVTTARHS 158

Query: 170 PSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKI 229
           P  + VLAKSASGALE +P + + NL+ AL +++  GF T+GL S+    L     ++ +
Sbjct: 159 PEATGVLAKSASGALELVPLVLVGNLSRALAELNDRGFLTVGLDSEGSADLAAVELHEPL 218

Query: 230 ALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHFA 281
           AL+LGAEGKGLR  T+ET   +A L MPG IK+LNVSNAAA+ALYI  +   
Sbjct: 219 ALVLGAEGKGLRQLTRETCNVVARLDMPGAIKSLNVSNAAALALYIGASRLG 270


>gi|86749323|ref|YP_485819.1| RNA methyltransferase TrmH, group 3 [Rhodopseudomonas palustris
           HaA2]
 gi|86572351|gb|ABD06908.1| RNA methyltransferase TrmH, group 3 [Rhodopseudomonas palustris
           HaA2]
          Length = 273

 Score =  216 bits (550), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 114/232 (49%), Positives = 152/232 (65%), Gaps = 1/232 (0%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEA 109
            LYG HTV+AAL NP+R+I +LL T+NA AR   D N+        V P  ID+ +G +A
Sbjct: 40  ILYGWHTVTAALANPARRIRKLLLTENA-ARKLADENINTRITPDIVRPGEIDQRLGPDA 98

Query: 110 VHQGLALETAPLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYS 169
           VHQG+  E  PL SP +D +    +++VLD + DPHN+GAI+RSA AF+   I+TT R+S
Sbjct: 99  VHQGMLAEVDPLESPRIDTLPEDGIVLVLDQITDPHNVGAIMRSAAAFAVKAIVTTARHS 158

Query: 170 PSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKI 229
           P  + VLAKSASGALE +P + ++NL  AL ++   G+ T+GL S+    L        +
Sbjct: 159 PEATGVLAKSASGALELVPLVLVTNLARALTELEDRGYLTVGLDSEGSADLAAVELRQPL 218

Query: 230 ALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHFA 281
           AL+LGAEGKGLR  T+ET   +A L MPG IK+LNVSNAAA+ALYI  +   
Sbjct: 219 ALVLGAEGKGLRQLTRETCNVVARLDMPGAIKSLNVSNAAALALYIGASRLG 270


>gi|39936427|ref|NP_948703.1| RNA methyltransferase TrmH group 3 [Rhodopseudomonas palustris
           CGA009]
 gi|192292212|ref|YP_001992817.1| RNA methyltransferase, TrmH family, group 3 [Rhodopseudomonas
           palustris TIE-1]
 gi|39650282|emb|CAE28805.1| putative rRNA methylase [Rhodopseudomonas palustris CGA009]
 gi|192285961|gb|ACF02342.1| RNA methyltransferase, TrmH family, group 3 [Rhodopseudomonas
           palustris TIE-1]
          Length = 275

 Score =  214 bits (546), Expect = 8e-54,   Method: Compositional matrix adjust.
 Identities = 115/254 (45%), Positives = 156/254 (61%), Gaps = 1/254 (0%)

Query: 28  RDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANL 87
           R   +   F +  R       + LYG HTV+AAL NP RK  +L  T+NA  RL  + N+
Sbjct: 18  RGKPRPAGFRRDPRERDGDGPVILYGWHTVTAALANPQRKFRKLWLTENAARRL-AEENI 76

Query: 88  PHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDHVNDPHNI 147
                 + V P  ID+ +G +AVHQG+  E  PL  P +D +    +++VLD + DPHN+
Sbjct: 77  DTRIAPEIVRPSEIDRQLGPDAVHQGMLAEADPLQGPRIDTLPQHGIVLVLDQITDPHNV 136

Query: 148 GAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGF 207
           GAILRSA AF+   I+TT R+SP  + VLAKSASGALE +P + + NL  AL +++  GF
Sbjct: 137 GAILRSAAAFAVQAIVTTARHSPEATGVLAKSASGALELVPLVLVQNLARALTELNDRGF 196

Query: 208 QTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSN 267
            T+GL S+    L        +AL+LGAEGKGLR  T++T  ++A L MPG IK+LNVSN
Sbjct: 197 LTVGLDSEGDDDLAAVELRQPLALVLGAEGKGLRQLTRQTCNTVARLDMPGEIKSLNVSN 256

Query: 268 AAAVALYITQNHFA 281
           AAA+ALYI  +   
Sbjct: 257 AAALALYIGASRLG 270


>gi|118591205|ref|ZP_01548604.1| tRNA/rRNA metyltransferase [Stappia aggregata IAM 12614]
 gi|118436281|gb|EAV42923.1| tRNA/rRNA metyltransferase [Stappia aggregata IAM 12614]
          Length = 271

 Score =  213 bits (543), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 111/251 (44%), Positives = 160/251 (63%), Gaps = 2/251 (0%)

Query: 28  RDYKKMQSFNQKSRHTSQPEN-LFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDAN 86
           R  KK        R    PE  + LYG+HTV AA  N  RK  +L AT NAL RL+ +  
Sbjct: 17  RGNKKFGGKPAPRRPGLPPEGPVLLYGLHTVEAAFANKDRKRLKLFATDNALRRLE-ERG 75

Query: 87  LPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDHVNDPHN 146
           +    PV+++ P+ +D++V K+AVHQG+ LE  PL +   + ++ ++L++ LD V DPHN
Sbjct: 76  VKIDVPVESMMPRALDRMVTKDAVHQGMILEADPLPAYGAEHLKGARLVLALDQVTDPHN 135

Query: 147 IGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWG 206
           +GAILRSAVA   D ++TT+R++P E +VLAKSASGAL+ I ++R+ N+   + +M   G
Sbjct: 136 VGAILRSAVALDADAVVTTERHAPEEGSVLAKSASGALDMIKHVRVKNMARFIAEMKDEG 195

Query: 207 FQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVS 266
           F  I L SD    LE+   +DK  L+LG+EGKG+R   +E     A L MPG I++LNVS
Sbjct: 196 FSCIALDSDGPASLEETPFSDKTVLVLGSEGKGVRQGVREACGLTARLDMPGEIRSLNVS 255

Query: 267 NAAAVALYITQ 277
           NAA ++LY+ +
Sbjct: 256 NAAVLSLYVAR 266


>gi|85716737|ref|ZP_01047705.1| RNA methyltransferase TrmH, group 3 [Nitrobacter sp. Nb-311A]
 gi|85696455|gb|EAQ34345.1| RNA methyltransferase TrmH, group 3 [Nitrobacter sp. Nb-311A]
          Length = 234

 Score =  211 bits (536), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 113/232 (48%), Positives = 151/232 (65%), Gaps = 1/232 (0%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEA 109
            LYG HTV+AAL NP R I +LL T+NA  RL  + N+      + V P TID+ +G +A
Sbjct: 1   MLYGWHTVTAALANPRRHIRKLLLTENAALRLKHE-NINTRITPEIVRPSTIDQRLGPDA 59

Query: 110 VHQGLALETAPLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYS 169
           VHQGL  E  PL SP +  +    +++VLD + DPHN+GAI+RSA AFS   I+TT R+S
Sbjct: 60  VHQGLLAEADPLPSPDIGTLTQEGIVLVLDQITDPHNVGAIMRSAAAFSVKAIVTTARHS 119

Query: 170 PSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKI 229
           P  + VLAKSASGALE +P +++ NL  AL  ++  G+ T+GL S   + L        +
Sbjct: 120 PEATGVLAKSASGALEVVPLVQVQNLARALTGLNDRGYMTVGLDSTGGENLAAVQLRQPL 179

Query: 230 ALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHFA 281
           AL+LGAEGKGLR  T++T + +A L MPG IK+LNVSNAA +ALYI  +   
Sbjct: 180 ALVLGAEGKGLRQLTRDTCSLVARLDMPGHIKSLNVSNAAVLALYIGASRLG 231


>gi|307946264|ref|ZP_07661599.1| 23S rRNA (guanosine-2'-O-)-methyltransferase RlmB [Roseibium sp.
           TrichSKD4]
 gi|307769928|gb|EFO29154.1| 23S rRNA (guanosine-2'-O-)-methyltransferase RlmB [Roseibium sp.
           TrichSKD4]
          Length = 277

 Score =  208 bits (530), Expect = 7e-52,   Method: Compositional matrix adjust.
 Identities = 109/261 (41%), Positives = 163/261 (62%), Gaps = 5/261 (1%)

Query: 25  RNHRDYKKMQSFNQKSRHTSQ---PEN-LFLYGVHTVSAALNNPSRKIFQLLATKNALAR 80
           R  RD K+   + +K         PE  + LYG+HTV AA  N  RK  +L AT+NA  R
Sbjct: 17  RPSRDNKRAGKWTKKPAPRCPGLPPEGPILLYGLHTVEAAFANTERKRMKLYATENAQRR 76

Query: 81  LDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDH 140
           L  + ++    P++T+ P+ +DK+V ++AVHQG+ LE  PL +   + ++ ++L++ LD 
Sbjct: 77  L-AERDVVVDVPIETLAPRALDKMVTRDAVHQGVILEADPLPAYGPEHLKGARLVLALDQ 135

Query: 141 VNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQ 200
           V DPHN+GAILRSAVA   D ++TT+R++P E  VLAKSASGAL+ I ++R+ N+   + 
Sbjct: 136 VTDPHNVGAILRSAVALDADAVVTTERHAPEEGPVLAKSASGALDMIKHVRVKNMARFVS 195

Query: 201 KMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGII 260
           +M    F  + L SD    LE+     K  L+LG+EGKG+R   +E  +++A L MPG I
Sbjct: 196 EMQEQAFTAVALDSDGPASLEETELAPKTVLVLGSEGKGVRQGVREACSTLARLDMPGEI 255

Query: 261 KALNVSNAAAVALYITQNHFA 281
           ++LNVSNAA +ALY+ +    
Sbjct: 256 RSLNVSNAAVLALYVARQKMG 276


>gi|154247282|ref|YP_001418240.1| RNA methyltransferase [Xanthobacter autotrophicus Py2]
 gi|154161367|gb|ABS68583.1| RNA methyltransferase, TrmH family, group 3 [Xanthobacter
           autotrophicus Py2]
          Length = 288

 Score =  208 bits (529), Expect = 9e-52,   Method: Compositional matrix adjust.
 Identities = 108/228 (47%), Positives = 150/228 (65%), Gaps = 1/228 (0%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEA 109
            LYG HTV+ A+ NP R+  +L AT+NA+ RL  +   P P   + V P  IDK++G +A
Sbjct: 56  LLYGWHTVAEAIGNPKRRFRRLRATENAIHRLAEEGLTP-PIAPEIVRPGDIDKLLGADA 114

Query: 110 VHQGLALETAPLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYS 169
           VHQGL  E   L SP L  +  + L++VLD + DPHN+GAI+RSA AF+   I+TT R+S
Sbjct: 115 VHQGLLAEVDHLPSPRLKDIAKTDLVLVLDQITDPHNVGAIVRSAAAFAVSAIVTTARHS 174

Query: 170 PSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKI 229
           P+ + VLAKSASG LEH+P+  ++NL  AL ++   G   +GL S+    LE       +
Sbjct: 175 PAATGVLAKSASGGLEHVPFCLVTNLARALTELKENGMLVVGLDSEGPADLEDTPMRAPL 234

Query: 230 ALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQ 277
           AL+LGAEGKGLR  T+ET   +A + +PG IK+LNVSNAAA++L + +
Sbjct: 235 ALVLGAEGKGLRQLTRETCDVLARIDLPGAIKSLNVSNAAALSLGMAR 282


>gi|254504591|ref|ZP_05116742.1| RNA methyltransferase, TrmH family, group 3 [Labrenzia alexandrii
           DFL-11]
 gi|222440662|gb|EEE47341.1| RNA methyltransferase, TrmH family, group 3 [Labrenzia alexandrii
           DFL-11]
          Length = 275

 Score =  207 bits (527), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 104/233 (44%), Positives = 149/233 (63%), Gaps = 1/233 (0%)

Query: 49  LFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKE 108
           + LYG+HTV AA  N  RK  +L AT+NA  RL  +  +    PV+   P+ +D++V K+
Sbjct: 43  VLLYGLHTVEAAFANKDRKRLKLYATENAKNRL-QERGVVIDVPVEDKRPKELDRMVTKD 101

Query: 109 AVHQGLALETAPLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRY 168
           AVHQG+ LE  PL +   + ++ ++L++ LD V DPHN+GAILRSAVA   D ++TT+R+
Sbjct: 102 AVHQGMILEADPLPAYGAEHLKGARLILALDQVTDPHNVGAILRSAVALDADAVVTTERH 161

Query: 169 SPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDK 228
           +P E  VLAKSASGAL+ I ++R+ N+   + +M   GF  I L SD    LE     DK
Sbjct: 162 APEEGPVLAKSASGALDMIKHVRVKNMARFITEMKEQGFGCIALDSDGHASLEDTDFTDK 221

Query: 229 IALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHFA 281
             L+LG+EGKG+R   +E    +A L MPG I++LNVSNAA ++LY+ +    
Sbjct: 222 TVLVLGSEGKGVRQGVREACGLLARLDMPGEIRSLNVSNAAVLSLYVARQKMG 274


>gi|209884778|ref|YP_002288635.1| RNA methyltransferase, TrmH family, group 3 [Oligotropha
           carboxidovorans OM5]
 gi|209872974|gb|ACI92770.1| RNA methyltransferase, TrmH family, group 3 [Oligotropha
           carboxidovorans OM5]
          Length = 274

 Score =  205 bits (521), Expect = 6e-51,   Method: Compositional matrix adjust.
 Identities = 125/269 (46%), Positives = 161/269 (59%), Gaps = 21/269 (7%)

Query: 31  KKMQSFNQKSRHTSQPEN----------------LFLYGVHTVSAALNNPSRKIFQLLAT 74
           ++  SF  KS H   P                  + LYG HTV+AAL NP RKI +L AT
Sbjct: 4   REYSSFKGKSSHRKPPHGRGGRPAWRDRDDHNAPVILYGWHTVTAALLNPKRKIRKLFAT 63

Query: 75  KNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQ- 133
           +NAL RL  +     P P + V P  ID+ +G +AVHQGL  E  PL  P LD  +  Q 
Sbjct: 64  ENALRRLTEENITLRPAP-EIVRPSVIDQRLGPDAVHQGLLAEADPL--PALDIAKLPQD 120

Query: 134 -LLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRI 192
            +++VLD + DPHN+GAILRSA AF+   ++TT R+SP  + VLAKSASGALE +P + +
Sbjct: 121 GIVLVLDQITDPHNVGAILRSAAAFAVKAVVTTARHSPEATGVLAKSASGALELVPLVTV 180

Query: 193 SNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMA 252
            NL  AL +M   GF T+GL S+    L +      +AL+LGAEGKGLR  T+ET  ++A
Sbjct: 181 QNLARALNEMKEHGFLTVGLDSEGSADLAETELRAPLALVLGAEGKGLRQLTRETCGTVA 240

Query: 253 HLHMPGIIKALNVSNAAAVALYITQNHFA 281
            L MPG IK+LNVSNA A+ALYI      
Sbjct: 241 RLDMPGEIKSLNVSNATALALYIGATRLG 269


>gi|328543340|ref|YP_004303449.1| RNA methyltransferase, TrmH family, group 3 [polymorphum gilvum
           SL003B-26A1]
 gi|326413085|gb|ADZ70148.1| RNA methyltransferase, TrmH family, group 3 [Polymorphum gilvum
           SL003B-26A1]
          Length = 265

 Score =  202 bits (515), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 107/237 (45%), Positives = 157/237 (66%), Gaps = 2/237 (0%)

Query: 46  PEN-LFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKI 104
           PE  + LYG+HTV AA  NP R+  +L AT+NAL RL+     P   PV+ + P+ +D++
Sbjct: 29  PEGPILLYGLHTVEAAFQNPDRRRHKLFATENALRRLEERGIRPD-VPVEILAPRALDRM 87

Query: 105 VGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIIT 164
           V ++AVHQG+ LE   L +  +D ++ ++L++ LD V DPHN+GAILRSAVA + D ++T
Sbjct: 88  VTRDAVHQGVVLEADALPAYGVDELKGARLVLALDQVTDPHNVGAILRSAVALAADAVVT 147

Query: 165 TKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEI 224
           T+R++P E  VLAK+ASGAL+ I ++R+ N+   L +M   GF  + L SD +  LEQ  
Sbjct: 148 TERHAPEEGPVLAKAASGALDMIRHVRVKNMARFLVEMGEQGFFRVALDSDGEASLEQTP 207

Query: 225 KNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHFA 281
             DK  L+LG+EGKG+R   +     +A L MPG I++LNVSNAA +ALY+ +   +
Sbjct: 208 FGDKTVLVLGSEGKGVRQGVRAACDRLARLDMPGRIRSLNVSNAAVLALYVARQRMS 264


>gi|121281880|gb|ABM53513.1| putative RNA methyltransferase TrmH [uncultured bacterium CBNPD1
           BAC clone 67]
          Length = 319

 Score =  201 bits (512), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 110/258 (42%), Positives = 155/258 (60%), Gaps = 12/258 (4%)

Query: 35  SFNQKSRHTSQP---------ENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDA 85
           +F  KSR   +P         +   LYG+H+V  A  NP R+  +++AT+NA+ RL  D 
Sbjct: 30  AFKDKSRFAPKPKAPKPRLPDDTDVLYGMHSVKEAFANPRRRFRRIVATENAVQRLTEDG 89

Query: 86  -NLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDHVNDP 144
            NLP     + V P+ I +++  +AVHQGL +E   L    L  +   ++++ LD V DP
Sbjct: 90  VNLP--LAPELVKPEAIGRLLTPDAVHQGLYVEAERLPLLPLGKLPRDRIILALDQVTDP 147

Query: 145 HNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHS 204
           HN+GAILRSA AF   G+I T R+SP  + VLAK+ASGALEH+P   + NL  AL  +  
Sbjct: 148 HNVGAILRSAAAFDVGGVIVTHRHSPEITGVLAKAASGALEHVPMAGVQNLARALTTLKD 207

Query: 205 WGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALN 264
            GF  IGL S++ + +        I L+LGAEG+GLRP T+E  + +A L +PG IK+LN
Sbjct: 208 EGFAVIGLDSEAPEKMGDLPLKLPIVLVLGAEGRGLRPSTRELCSHLARLELPGAIKSLN 267

Query: 265 VSNAAAVALYITQNHFAK 282
           VSNAAA++LY  Q    +
Sbjct: 268 VSNAAAISLYAVQQAITR 285


>gi|299135282|ref|ZP_07028473.1| RNA methyltransferase, TrmH family, group 3 [Afipia sp. 1NLS2]
 gi|298590259|gb|EFI50463.1| RNA methyltransferase, TrmH family, group 3 [Afipia sp. 1NLS2]
          Length = 272

 Score =  198 bits (503), Expect = 9e-49,   Method: Compositional matrix adjust.
 Identities = 114/233 (48%), Positives = 151/233 (64%), Gaps = 2/233 (0%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLATKNALARL-DWDANLPHPFPVKTVPPQTIDKIVGKE 108
            LYG HTV+ AL NP RKI +L  T+NAL RL D + +L    P + V P  ID+ +G +
Sbjct: 38  ILYGWHTVTLALANPKRKIRKLFVTENALRRLQDENIDLKKLTP-EVVRPSVIDQRLGPD 96

Query: 109 AVHQGLALETAPLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRY 168
           AVHQGL  E  PL +  +  +    +++VLD + DPHN+GAILRSA AF+   ++TT R+
Sbjct: 97  AVHQGLLAEADPLPALDISELPQDGIVLVLDQITDPHNVGAILRSAAAFAVKAVVTTARH 156

Query: 169 SPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDK 228
           SP  + VLAKSASGALE +P + + NL  AL +M   GF T+GL S+    L +      
Sbjct: 157 SPEATGVLAKSASGALELVPVVIVQNLARALTEMKEHGFLTVGLDSEGSTNLAETELRAP 216

Query: 229 IALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHFA 281
           +AL+LGAEGKGLR  T+ET  ++A L MPG IK+LNVSNA A+ALYI  +   
Sbjct: 217 LALVLGAEGKGLRQLTRETCGTVARLDMPGEIKSLNVSNATALALYIGASRLG 269


>gi|298291417|ref|YP_003693356.1| RNA methyltransferase, TrmH family, group 3 [Starkeya novella DSM
           506]
 gi|296927928|gb|ADH88737.1| RNA methyltransferase, TrmH family, group 3 [Starkeya novella DSM
           506]
          Length = 270

 Score =  197 bits (501), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 108/250 (43%), Positives = 151/250 (60%), Gaps = 8/250 (3%)

Query: 24  RRNHRDYKKMQSFNQKSRHTSQP------ENLFLYGVHTVSAALNNPSRKIFQLLATKNA 77
           RR  R Y   Q    + R   +P      +   LYG H+V+ AL NP RKI +LLAT+NA
Sbjct: 6   RRPARPYHASQR-QPRPRPAGRPFGAWPDDVAILYGWHSVAEALRNPRRKIRRLLATENA 64

Query: 78  LARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMV 137
             RL+ + ++P     + V P  ID+++  +AVHQGL  E  PL + +L     S LL+V
Sbjct: 65  AKRLE-EESIPLKVKPEIVRPGEIDRLLDPDAVHQGLLAECDPLPALSLAKAAESDLLLV 123

Query: 138 LDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTD 197
           LD + DPHN+GAI+RSA A     I+TT R+SP+ + VLAKSASG LEH+P+  + NL  
Sbjct: 124 LDQITDPHNVGAIVRSAAAMKVGAIVTTARHSPAATGVLAKSASGGLEHVPFCFVGNLAR 183

Query: 198 ALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMP 257
            L+++   G Q +GL S+    L        +AL+LGAEGKGLR  T++T  ++A + +P
Sbjct: 184 TLEELKERGVQVVGLDSEGPADLADTAMRAPVALVLGAEGKGLRQLTRQTCDTLARIDLP 243

Query: 258 GIIKALNVSN 267
           G I +LNVSN
Sbjct: 244 GAIVSLNVSN 253


>gi|188579486|ref|YP_001922931.1| RNA methyltransferase, TrmH family, group 3 [Methylobacterium
           populi BJ001]
 gi|179342984|gb|ACB78396.1| RNA methyltransferase, TrmH family, group 3 [Methylobacterium
           populi BJ001]
          Length = 269

 Score =  197 bits (500), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 110/228 (48%), Positives = 147/228 (64%), Gaps = 1/228 (0%)

Query: 47  ENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVG 106
           +++ LYG H VS AL N  R   +LLAT+NALARL  +A +  P   + V P  IDK++G
Sbjct: 33  DHVVLYGWHPVSQALANAGRHFHRLLATENALARLK-EAGIELPIEPELVRPSAIDKLLG 91

Query: 107 KEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTK 166
            +AVHQGL  E  PL +P LDA+ +  LL+ LD + DPHN+GAI+R+A AF    I+TT 
Sbjct: 92  PDAVHQGLYAEAEPLAAPALDAMPDDALLLALDQITDPHNVGAIVRTAAAFGVTAIVTTA 151

Query: 167 RYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKN 226
           R+SP+ + VLAKSASG LEH+P + + NL +AL  +   GF  IGL SD+   L+     
Sbjct: 152 RHSPNATGVLAKSASGGLEHVPLVIVRNLAEALITLGERGFTRIGLDSDAGTSLDAVGPR 211

Query: 227 DKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
               L+LGAEGKGLR +T E    +  +   G I++LNVSNAAA+ LY
Sbjct: 212 RPAVLVLGAEGKGLRQRTTECCDLLVRIDATGAIRSLNVSNAAAITLY 259


>gi|163849637|ref|YP_001637680.1| RNA methyltransferase [Methylobacterium extorquens PA1]
 gi|163661242|gb|ABY28609.1| RNA methyltransferase, TrmH family, group 3 [Methylobacterium
           extorquens PA1]
          Length = 268

 Score =  197 bits (500), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 113/256 (44%), Positives = 156/256 (60%), Gaps = 11/256 (4%)

Query: 28  RDYKKMQSFNQKSRHTSQP---------ENLFLYGVHTVSAALNNPSRKIFQLLATKNAL 78
           RD +  + +  + R  +QP         +++ LYG H VS AL N  R   +LLAT+NAL
Sbjct: 5   RD-RPAKPYGFRPRPRTQPPGPAAREGRDHVVLYGWHPVSQALANAGRHFHRLLATENAL 63

Query: 79  ARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVL 138
           ARL  +A +  P   + V P  ID+++G +AVHQGL  E  PL +P  DA+ +  LL+ L
Sbjct: 64  ARLK-EAGIELPIEPEMVRPSAIDRLLGPDAVHQGLYAEAEPLAAPAFDAMPDDALLLAL 122

Query: 139 DHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDA 198
           D + DPHN+GAI+R+A AF    I+TT R+SP+ + VLAKSASG LEH+P + + NL +A
Sbjct: 123 DQITDPHNVGAIVRTAAAFGVTAIVTTARHSPNATGVLAKSASGGLEHVPLVIVRNLAEA 182

Query: 199 LQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPG 258
           L  +   GF  IGL SD+   L+         L+LGAEGKGLR +T E    +  +   G
Sbjct: 183 LITLGERGFTRIGLDSDAGTTLDAVGPRRPAVLVLGAEGKGLRQRTTECCDLLVRIDATG 242

Query: 259 IIKALNVSNAAAVALY 274
            I++LNVSNAAA+ LY
Sbjct: 243 AIRSLNVSNAAAITLY 258


>gi|218528187|ref|YP_002419003.1| RNA methyltransferase, TrmH family, group 3 [Methylobacterium
           chloromethanicum CM4]
 gi|218520490|gb|ACK81075.1| RNA methyltransferase, TrmH family, group 3 [Methylobacterium
           chloromethanicum CM4]
          Length = 268

 Score =  196 bits (498), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 114/256 (44%), Positives = 157/256 (61%), Gaps = 11/256 (4%)

Query: 28  RDYKKMQSFNQKSRHTSQP---------ENLFLYGVHTVSAALNNPSRKIFQLLATKNAL 78
           RD +  + +  + R  +QP         +++ LYG H VS AL N  R   +LLAT+NAL
Sbjct: 5   RD-RPAKPYGFRPRPRTQPPGPAAREGRDHVVLYGWHPVSQALANAGRHFHRLLATENAL 63

Query: 79  ARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVL 138
           ARL  +A +  P   + V P  ID+++G +AVHQGL  E  PL +P LDA+ +  LL+ L
Sbjct: 64  ARLK-EAGIELPIEPEMVRPSAIDRLLGPDAVHQGLYAEAEPLAAPALDAMPDDALLLAL 122

Query: 139 DHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDA 198
           D + DPHN+GAI+R+A AF    I+TT R+SP+ + VLAKSASG LEH+P + + NL +A
Sbjct: 123 DQITDPHNVGAIVRTAAAFGVTAIVTTARHSPNATGVLAKSASGGLEHVPLVIVRNLAEA 182

Query: 199 LQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPG 258
           L  +   GF  IGL SD+   L+         L+LGAEGKGLR +T E    +  +   G
Sbjct: 183 LITLGERGFTRIGLDSDAGTTLDAVGPRRPAVLVLGAEGKGLRQRTTECCDLLVRIDATG 242

Query: 259 IIKALNVSNAAAVALY 274
            I++LNVSNAAA+ LY
Sbjct: 243 AIRSLNVSNAAAITLY 258


>gi|240136836|ref|YP_002961303.1| rRNA methylase [Methylobacterium extorquens AM1]
 gi|254558711|ref|YP_003065806.1| rRNA methylase [Methylobacterium extorquens DM4]
 gi|240006800|gb|ACS38026.1| rRNA methylase [Methylobacterium extorquens AM1]
 gi|254265989|emb|CAX21739.1| rRNA methylase [Methylobacterium extorquens DM4]
          Length = 268

 Score =  196 bits (498), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 114/256 (44%), Positives = 157/256 (61%), Gaps = 11/256 (4%)

Query: 28  RDYKKMQSFNQKSRHTSQP---------ENLFLYGVHTVSAALNNPSRKIFQLLATKNAL 78
           RD +  + +  + R  +QP         +++ LYG H VS AL N  R   +LLAT+NAL
Sbjct: 5   RD-RPAKPYGFRPRPRTQPPGPAAREGRDHVVLYGWHPVSQALANAGRHFHRLLATENAL 63

Query: 79  ARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVL 138
           ARL  +A +  P   + V P  ID+++G +AVHQGL  E  PL +P LDA+ +  LL+ L
Sbjct: 64  ARLK-EAGIELPIEPEMVRPSAIDRLLGPDAVHQGLYAEAEPLAAPALDAMPDDALLLAL 122

Query: 139 DHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDA 198
           D + DPHN+GAI+R+A AF    I+TT R+SP+ + VLAKSASG LEH+P + + NL +A
Sbjct: 123 DQITDPHNVGAIVRTAAAFGVTAIVTTARHSPNATGVLAKSASGGLEHVPLVIVRNLAEA 182

Query: 199 LQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPG 258
           L  +   GF  IGL SD+   L+         L+LGAEGKGLR +T E    +  +   G
Sbjct: 183 LITLGERGFTRIGLDSDAGTTLDAVGPRRPAVLVLGAEGKGLRQRTTECCDLLVRIDATG 242

Query: 259 IIKALNVSNAAAVALY 274
            I++LNVSNAAA+ LY
Sbjct: 243 AIRSLNVSNAAAITLY 258


>gi|23014094|ref|ZP_00053931.1| COG0566: rRNA methylases [Magnetospirillum magnetotacticum MS-1]
          Length = 267

 Score =  196 bits (498), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 107/233 (45%), Positives = 153/233 (65%), Gaps = 13/233 (5%)

Query: 49  LFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHP-FPVKTVPPQTIDKIVGK 107
           ++LYG+H VSAAL NP R+I +L+AT  A        +LP    PV+T+    ID+++  
Sbjct: 35  IWLYGIHAVSAALANPERRIRRLVATTEAAK------SLPATKIPVETMERAEIDRLLAP 88

Query: 108 EAVHQGLALETAPLLSPTL-DAVR-----NSQLLMVLDHVNDPHNIGAILRSAVAFSCDG 161
            +VHQG+AL   PL + T+ D +R     +S L++VLD V DPHN+GAILRSA AF    
Sbjct: 89  GSVHQGIALLVEPLPAITMEDIIRMADSASSALVLVLDQVTDPHNVGAILRSAAAFGALA 148

Query: 162 IITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLE 221
           ++   R++P E+  LAKSASGALE +P +R++N+  AL+ M   GF T GL++D+ K L 
Sbjct: 149 VVAPDRHAPDETGTLAKSASGALERMPLVRVTNVVRALEDMKKGGFWTAGLAADAPKTLA 208

Query: 222 QEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
           +   + K+ L+LGAEG+G+R  T+E    +  L M G +++LNVSNAAAVALY
Sbjct: 209 EAELSGKVVLVLGAEGEGMRRLTREHCDHLVRLPMCGEMESLNVSNAAAVALY 261


>gi|326402255|ref|YP_004282336.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Acidiphilium
           multivorum AIU301]
 gi|325049116|dbj|BAJ79454.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Acidiphilium
           multivorum AIU301]
          Length = 276

 Score =  195 bits (495), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 109/258 (42%), Positives = 161/258 (62%), Gaps = 7/258 (2%)

Query: 22  KLRRNHRDYKKMQSFNQKSRH-TSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALAR 80
           KL R    +++ Q    + R   S    L+LYG+H+V AAL NP+R++ +L+ T+   A 
Sbjct: 17  KLPRGPHPHRRSQGDAPRDRRPASSAGGLWLYGLHSVEAALANPARRLRRLVVTEEGEAA 76

Query: 81  LDWDANLPHPFPVK--TVPPQTIDKIVGKEAVHQGLALETAPLLSPTL-DAVRNSQLLMV 137
           L     LPHP+P++   +    +D+++G+  VHQG+AL+  PL+ P+L DA++    ++V
Sbjct: 77  LA--GRLPHPWPIQPERIERDRLDQMLGRGIVHQGVALQADPLVPPSLNDALKRPGPVLV 134

Query: 138 LDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTD 197
           LD + DP N+GAILRSA AF    +I  +R +P E   LAK+ASGALE IP +R  N+  
Sbjct: 135 LDQITDPRNVGAILRSAQAFGAAMVIAQERNAPEEGGALAKAASGALERIPLLRTVNIAR 194

Query: 198 ALQKMHSWGFQTIGLSSDSKKPLEQE-IKNDKIALILGAEGKGLRPKTQETATSMAHLHM 256
           AL  + + G   +GL +     L ++ I N + AL+LGAEG+GLR  T+ET   +  L M
Sbjct: 195 ALIALKAAGLWVMGLDAAGLSHLSRDAIGNRRAALVLGAEGEGLRRLTRETCDELVSLPM 254

Query: 257 PGIIKALNVSNAAAVALY 274
           PG +++LNVS AAAVALY
Sbjct: 255 PGGMESLNVSAAAAVALY 272


>gi|148259103|ref|YP_001233230.1| RNA methyltransferase [Acidiphilium cryptum JF-5]
 gi|146400784|gb|ABQ29311.1| RNA methyltransferase, TrmH family, group 3 [Acidiphilium cryptum
           JF-5]
          Length = 276

 Score =  194 bits (494), Expect = 9e-48,   Method: Compositional matrix adjust.
 Identities = 109/258 (42%), Positives = 161/258 (62%), Gaps = 7/258 (2%)

Query: 22  KLRRNHRDYKKMQSFNQKSRH-TSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALAR 80
           KL R    +++ Q    + R   S    L+LYG+H+V AAL NP+R++ +L+ T+   A 
Sbjct: 17  KLPRGPHPHRRPQGDAPRDRRPASSAGGLWLYGLHSVEAALANPARRLRRLVVTEEGEAA 76

Query: 81  LDWDANLPHPFPVK--TVPPQTIDKIVGKEAVHQGLALETAPLLSPTL-DAVRNSQLLMV 137
           L     LPHP+P++   +    +D+++G+  VHQG+AL+  PL+ P+L DA++    ++V
Sbjct: 77  LA--GRLPHPWPIQPERIERDRLDQMLGRGIVHQGVALQADPLVPPSLNDALKRPGPVLV 134

Query: 138 LDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTD 197
           LD + DP N+GAILRSA AF    +I  +R +P E   LAK+ASGALE IP +R  N+  
Sbjct: 135 LDQITDPRNVGAILRSAQAFGAAMVIAQERNAPEEGGALAKAASGALERIPLLRTVNIAR 194

Query: 198 ALQKMHSWGFQTIGLSSDSKKPLEQE-IKNDKIALILGAEGKGLRPKTQETATSMAHLHM 256
           AL  + + G   +GL +     L ++ I N + AL+LGAEG+GLR  T+ET   +  L M
Sbjct: 195 ALIALKAAGLWVMGLDAAGLSHLSRDAIGNRRAALVLGAEGEGLRRLTRETCDELVSLPM 254

Query: 257 PGIIKALNVSNAAAVALY 274
           PG +++LNVS AAAVALY
Sbjct: 255 PGGMESLNVSAAAAVALY 272


>gi|218670695|ref|ZP_03520366.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Rhizobium etli GR56]
          Length = 209

 Score =  192 bits (488), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 104/195 (53%), Positives = 135/195 (69%), Gaps = 15/195 (7%)

Query: 14  SLKDSHYAKLRRNHRDYKKMQSF-----NQKSRHTSQ-------PENLFLYGVHTVSAAL 61
           S KD+HYA LRR HRD K+ +        QK +           P+ ++LYG+HTV AAL
Sbjct: 16  SAKDTHYANLRRAHRDAKRERGEIPTPQPQKRKRAEDWKPPALAPDQVYLYGLHTVRAAL 75

Query: 62  NNPSRKIFQLLATKNALARLDWDAN-LPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAP 120
           +NP RK  +L  T+NALARL+ D   L   F +  V P  IDK++G EA+HQG+ LET P
Sbjct: 76  DNPERKKIKLSVTQNALARLEIDVETLGIAFEI--VSPHEIDKVLGPEAIHQGVMLETRP 133

Query: 121 LLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSA 180
           L    L+A+++S LL+VLD V DPHN+GAI+RSAVAF+   +ITT+R+SP+ES VLAKSA
Sbjct: 134 LPVRRLEALKDSPLLLVLDQVTDPHNVGAIMRSAVAFNAGAVITTQRHSPTESGVLAKSA 193

Query: 181 SGALEHIPYIRISNL 195
           SGALE IPYI+I+NL
Sbjct: 194 SGALELIPYIQITNL 208


>gi|296447196|ref|ZP_06889126.1| RNA methyltransferase, TrmH family, group 3 [Methylosinus
           trichosporium OB3b]
 gi|296255255|gb|EFH02352.1| RNA methyltransferase, TrmH family, group 3 [Methylosinus
           trichosporium OB3b]
          Length = 270

 Score =  188 bits (478), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 106/226 (46%), Positives = 141/226 (62%), Gaps = 2/226 (0%)

Query: 49  LFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKE 108
           + LYG H V  AL    RK+  L AT+ A  R+   A      P + V P+ +   +G E
Sbjct: 34  VVLYGAHAVREALRARRRKLLTLYATEGAAERIAPLAAEAGLTP-QIVDPRALTSRLGDE 92

Query: 109 AVHQGLALETAPLLSPTL-DAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKR 167
           +VHQGL LE  PL +  + D    S +++VLD V DPHN+GAILR+A AF+ D ++ T R
Sbjct: 93  SVHQGLLLEARPLPAAEIADIETKSGVVLVLDQVTDPHNVGAILRTAAAFAVDALVMTDR 152

Query: 168 YSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKND 227
            SP  + VLAK+ASGALEH+  + + NL  ALQ++   G   +GL S++  PLE+    +
Sbjct: 153 NSPELTGVLAKAASGALEHVLIVSVVNLARALQELSQSGRLVVGLDSEAPAPLEETRLQN 212

Query: 228 KIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVAL 273
            IAL+LGAEGKGLR  T+E    +A L MPG IK+LNVSNA AVAL
Sbjct: 213 PIALVLGAEGKGLRRLTRERCDVLARLDMPGPIKSLNVSNACAVAL 258


>gi|170747977|ref|YP_001754237.1| RNA methyltransferase [Methylobacterium radiotolerans JCM 2831]
 gi|170654499|gb|ACB23554.1| RNA methyltransferase, TrmH family, group 3 [Methylobacterium
           radiotolerans JCM 2831]
          Length = 281

 Score =  187 bits (475), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 102/225 (45%), Positives = 144/225 (64%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEA 109
            LYG H V  AL N  R + +LLAT+NA ARL+ +         + V P  I +++G +A
Sbjct: 50  VLYGWHPVVQALGNAQRGLHRLLATENAAARLEAEFGGAVRITPELVRPSDIGRLLGPDA 109

Query: 110 VHQGLALETAPLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYS 169
           VHQGL LE  PL +P LD +    LL+ LD + DPHN+GAI+R+A AF   GI+TT R++
Sbjct: 110 VHQGLYLEAEPLPAPGLDDLPADALLLALDQITDPHNVGAIVRTAAAFGVAGIVTTARHA 169

Query: 170 PSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKI 229
           P  + VLAKSASG LEH+P++ + NL +AL ++   GF  +GL SD+ + L+       +
Sbjct: 170 PGATGVLAKSASGGLEHVPFVTVRNLAEALIELGERGFTRVGLDSDAPESLDALTVARPL 229

Query: 230 ALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
            ++LGAEGKGLR +T+     +A +   G I++LNVSNAAA+ LY
Sbjct: 230 VIVLGAEGKGLRERTRGCCDVLARIPFSGAIRSLNVSNAAAITLY 274


>gi|83312248|ref|YP_422512.1| rRNA methylase [Magnetospirillum magneticum AMB-1]
 gi|82947089|dbj|BAE51953.1| rRNA methylase [Magnetospirillum magneticum AMB-1]
          Length = 267

 Score =  187 bits (474), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 102/232 (43%), Positives = 147/232 (63%), Gaps = 11/232 (4%)

Query: 49  LFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKE 108
           ++LYG+H V AAL NP R+  +L+AT  A   L          PV+T+    ID+++   
Sbjct: 35  IWLYGIHAVCAALANPDRRARRLVATVEAAKSLPATK-----VPVETMERSEIDRLLAPG 89

Query: 109 AVHQGLALETAPLLSPTL-DAVR-----NSQLLMVLDHVNDPHNIGAILRSAVAFSCDGI 162
           +VHQG+AL   PL + T+ D +R      S L++VLD V DPHN+GAILRSA AF    +
Sbjct: 90  SVHQGVALLVEPLPATTIEDVIRMADGAPSALVLVLDQVTDPHNVGAILRSAAAFGALAV 149

Query: 163 ITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQ 222
           +   R++P E+  LAKSASGALE +P +R++N+   L+ +   GF T GL++D+ K L +
Sbjct: 150 VAPDRHTPDETGTLAKSASGALERMPLVRVTNVVRTLEDLKKAGFWTAGLAADAPKTLAE 209

Query: 223 EIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
              + K+ L+LGAEG+G+R  T+E    +  L M G +++LNVSNAAAVALY
Sbjct: 210 ANLSGKVVLVLGAEGEGMRRLTREHCDHLVRLPMCGEMESLNVSNAAAVALY 261


>gi|323136537|ref|ZP_08071619.1| RNA methyltransferase, TrmH family, group 3 [Methylocystis sp. ATCC
           49242]
 gi|322398611|gb|EFY01131.1| RNA methyltransferase, TrmH family, group 3 [Methylocystis sp. ATCC
           49242]
          Length = 278

 Score =  186 bits (472), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 105/238 (44%), Positives = 146/238 (61%), Gaps = 8/238 (3%)

Query: 46  PENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPV--KTVPPQTIDK 103
           PE + +YG H V  AL    RK+  L AT+ AL R+   A+L     V  + V  + + +
Sbjct: 38  PEVVTIYGAHAVREALKARRRKLLALYATETALPRI---ADLARGAGVEPRLVDGRDLSR 94

Query: 104 IVGKEAVHQGLALETAPLLSPTLDAVR-NSQLLMVLDHVNDPHNIGAILRSAVAFSCDGI 162
            +G EAVHQGL LE  PL    +  +   S +++ LD + DPHN+GAILR+A AF  D +
Sbjct: 95  HLGDEAVHQGLLLEARPLPEAGVGDIEPKSGIVLALDQITDPHNVGAILRTACAFGVDAL 154

Query: 163 ITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQ 222
           I T+R+SP  + VLAK+ASGALEH+  + + NL  AL ++   G+  +GL S+  +PLE 
Sbjct: 155 IITERHSPEFTGVLAKAASGALEHVTIVSVVNLARALDELRGAGYGVVGLDSEGAEPLET 214

Query: 223 EIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
                 +AL+LGAEGKGLR  T+E   ++A L +PG IK+LNVSNA A AL +   HF
Sbjct: 215 IALPKPLALVLGAEGKGLRRLTRERCDAIARLDLPGPIKSLNVSNACAAALSVA--HF 270


>gi|163732185|ref|ZP_02139631.1| RNA methyltransferase, TrmH family, putative [Roseobacter litoralis
           Och 149]
 gi|161394483|gb|EDQ18806.1| RNA methyltransferase, TrmH family, putative [Roseobacter litoralis
           Och 149]
          Length = 257

 Score =  186 bits (471), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 105/246 (42%), Positives = 149/246 (60%), Gaps = 7/246 (2%)

Query: 38  QKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVP 97
           ++ + T   E ++L+G+H V  AL N +R+  QL+ T NA A+L  DA        + V 
Sbjct: 11  EQDKKTENRETIWLFGLHAVRDALENAAREKLQLIVTLNAQAKLA-DAIETSGIAPEVVD 69

Query: 98  PQTIDKIVGKEAVHQGLALETAPLLSPTL-DAVRNSQ--LLMVLDHVNDPHNIGAILRSA 154
           P+  +  +   +VHQG ALE  PL   +L D    S+   +M+LD V DPHN+GAILRSA
Sbjct: 70  PRKFNAPLDPGSVHQGAALEVKPLNWGSLEDVCVGSEHPRVMLLDRVTDPHNVGAILRSA 129

Query: 155 VAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSS 214
             F    +I T+ +S  E+  LAKSASGALE  PY+R+ NL D ++ +   G+  +GL  
Sbjct: 130 EVFGASAVIGTRHHSAPETGALAKSASGALERQPYLRVRNLADTIRALQGMGYIVLGLDG 189

Query: 215 DSKKPLEQEIKNDK---IALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAV 271
           +++  LEQ I+  +   IAL+LGAEG GLR KT+ET  S+  +   G   +LNVSNAAA+
Sbjct: 190 EARDTLEQAIEGKRDRPIALVLGAEGPGLREKTKETVDSLVRIDAAGQFGSLNVSNAAAI 249

Query: 272 ALYITQ 277
           ALY T+
Sbjct: 250 ALYATR 255


>gi|144900864|emb|CAM77728.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Magnetospirillum
           gryphiswaldense MSR-1]
          Length = 314

 Score =  185 bits (469), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 110/273 (40%), Positives = 160/273 (58%), Gaps = 27/273 (9%)

Query: 29  DYKKMQSFNQK-SRHTSQPE----------------NLFLYGVHTVSAALNNPSRKIFQL 71
           D  +  + N + SRH S P                  L+LYG H V AAL N +RKI ++
Sbjct: 27  DCSEGDTMNHRESRHKSAPRRDPAKGGERPAKLPSNQLWLYGAHAVLAALANKARKIRRI 86

Query: 72  LATKNAL---ARLDWDANLPHPFP-VKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLD 127
           + T  AL   A     A    P P  +T   Q +D+++   AVHQG+A+    L SP ++
Sbjct: 87  VLTVEALRSHAASIQRARALRPLPGEETTERQELDRLLPPGAVHQGIAVLAEHLESPGIE 146

Query: 128 AV------RNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSAS 181
            +      R+  ++MVLD V DPHN+GAILRSA AF    ++ T R+SP E+  LAKSAS
Sbjct: 147 DIGRLAQNRDHAVVMVLDQVTDPHNVGAILRSAAAFGALAVVVTDRHSPEETGTLAKSAS 206

Query: 182 GALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLR 241
           GALE +P +R++N+  AL+++   GF T GL+ ++ + L Q   + KIAL++GAEG+GLR
Sbjct: 207 GALEVMPLVRVTNMVRALEQLKEAGFWTAGLAGEATQTLAQAKLSGKIALVMGAEGEGLR 266

Query: 242 PKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
             T+E    +  L M  ++++LNVSNAAA++LY
Sbjct: 267 RLTREHCDHLVKLPMSDLVESLNVSNAAAISLY 299


>gi|110680725|ref|YP_683732.1| RNA methyltransferase [Roseobacter denitrificans OCh 114]
 gi|109456841|gb|ABG33046.1| RNA methyltransferase, TrmH family, putative [Roseobacter
           denitrificans OCh 114]
          Length = 257

 Score =  184 bits (467), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 102/246 (41%), Positives = 147/246 (59%), Gaps = 7/246 (2%)

Query: 38  QKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVP 97
           ++ + +   E ++L+G+H V  AL NP+R+  QL+ T NA A+L          P + V 
Sbjct: 11  EQDKKSENRETIWLFGLHAVRDALENPARQKLQLIVTLNAQAKLAGAIEAAGITP-EVVD 69

Query: 98  PQTIDKIVGKEAVHQGLALETAPLLSPTLDAV---RNSQLLMVLDHVNDPHNIGAILRSA 154
           P+     +   +VHQG ALE  PL   +L+ V        +++LD V DPHN+GAILRSA
Sbjct: 70  PRKFSAPLDPGSVHQGAALEVKPLNWGSLEDVCVGAEHPRVLLLDRVTDPHNVGAILRSA 129

Query: 155 VAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSS 214
             F    +I T+ +S  E+  LAKSASGALE  PY+R+ NL+D ++ +   G+  +GL  
Sbjct: 130 EVFGASAVIGTRHHSAPETGALAKSASGALERQPYLRVRNLSDTIRALQGMGYIVLGLDG 189

Query: 215 DSKKPLEQEIKNDK---IALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAV 271
           ++   LEQ I+  +   +AL+LGAEG GLR KT+ET  S+  +   G   +LNVSNAAA+
Sbjct: 190 EASDTLEQAIEGKRDRPVALVLGAEGPGLREKTKETVDSLVRIDAAGQFGSLNVSNAAAI 249

Query: 272 ALYITQ 277
           ALY TQ
Sbjct: 250 ALYATQ 255


>gi|300022432|ref|YP_003755043.1| RNA methyltransferase, TrmH family, group 3 [Hyphomicrobium
           denitrificans ATCC 51888]
 gi|299524253|gb|ADJ22722.1| RNA methyltransferase, TrmH family, group 3 [Hyphomicrobium
           denitrificans ATCC 51888]
          Length = 285

 Score =  182 bits (461), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 95/222 (42%), Positives = 143/222 (64%), Gaps = 4/222 (1%)

Query: 49  LFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKE 108
           L L+G+H V AAL NP R++ +L+ T+NA  RL  +A  P    +  V P+ +D+++G +
Sbjct: 50  LVLFGLHAVEAALKNPKRRVHRLMLTENAERRL-IEAVGPITAKIDRVTPRDLDRLLGPD 108

Query: 109 AVHQGLALETAPLLSPTLDAVR---NSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITT 165
            VHQG+ALET PL  P  D +    + + L+VLD V DPHN+GAILRS+  F   G++ T
Sbjct: 109 TVHQGVALETEPLPEPDWDELARAADGRPLIVLDQVTDPHNVGAILRSSAVFGASGLVMT 168

Query: 166 KRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIK 225
            R+SP  + VLAKSASGALE IP   ++NL  A++++   GF  +GL  +++  +E    
Sbjct: 169 HRHSPPLNGVLAKSASGALELIPVALVANLARAMEELREAGFALVGLDGEAETAIEDLDW 228

Query: 226 NDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSN 267
           +   AL++G+EGKGLR  T++T  ++A +   G + +LNVSN
Sbjct: 229 SRPTALVMGSEGKGLRELTRKTCDTLARISTDGPVASLNVSN 270


>gi|154253162|ref|YP_001413986.1| RNA methyltransferase [Parvibaculum lavamentivorans DS-1]
 gi|154157112|gb|ABS64329.1| RNA methyltransferase, TrmH family, group 3 [Parvibaculum
           lavamentivorans DS-1]
          Length = 288

 Score =  182 bits (461), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 108/233 (46%), Positives = 144/233 (61%), Gaps = 12/233 (5%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLATKNA---LARLDWDANLPHPFPVK--TVPPQTIDKI 104
           +LYG H V AAL NP+R   +L+ T+NA   LAR    A LP   PV+   +  + I  +
Sbjct: 53  YLYGFHAVLAALANPARLAERLVLTRNAETELAR--QGARLPADLPVRLEIMENEDIAAL 110

Query: 105 VGKEAVHQGLALETAPLLSPTLD---AVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDG 161
           +   AVHQG+AL  +PL  P LD   A   +  ++VLD V DPHN GAILRSA  F    
Sbjct: 111 LPAGAVHQGIALRASPL--PDLDVVEACEGTNRVVVLDQVTDPHNFGAILRSAAVFGAGA 168

Query: 162 IITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLE 221
           +ITT+R SPS   VLAK+ASGALE +   RI+NL  A++++   GF+ +GL  + +  L 
Sbjct: 169 LITTERNSPSLGGVLAKAASGALELVRVARITNLVRAIEELKELGFEVVGLDGEGEASLP 228

Query: 222 QEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
               + ++AL+LGAEG GLR  T+E    +A L   G +K+LNVSNAAAVALY
Sbjct: 229 DLKLSPRVALVLGAEGAGLRRLTREHCDLLARLPAAGGMKSLNVSNAAAVALY 281


>gi|254450751|ref|ZP_05064188.1| RNA methyltransferase, TrmH family, group 3 [Octadecabacter
           antarcticus 238]
 gi|198265157|gb|EDY89427.1| RNA methyltransferase, TrmH family, group 3 [Octadecabacter
           antarcticus 238]
          Length = 263

 Score =  181 bits (460), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 100/255 (39%), Positives = 154/255 (60%), Gaps = 19/255 (7%)

Query: 38  QKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANL------PHPF 91
           ++++  +  E ++L+G+H V  AL NP+R+  + + TKNA  RL    ++      P P 
Sbjct: 11  ERNKRAAANETVWLFGIHAVRDALLNPAREKLRFVVTKNAFDRLGGAVDIGLKDGGPEP- 69

Query: 92  PVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTL------DAVRNSQLLMVLDHVNDPH 145
             +   P+     +  ++VHQG ALE  PL    +      D V N   +++LD V DPH
Sbjct: 70  --EMCEPRNFAAPIDPQSVHQGAALEVKPLDWGKIEDRCMGDGV-NPPRVVLLDKVTDPH 126

Query: 146 NIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSW 205
           N+GAILRSA  F    +I   R++  E+  LAK+ASGA+E  PY+R+ NL DA+ ++ + 
Sbjct: 127 NVGAILRSAEVFGAQAVIAMNRHAAPETGALAKTASGAMERQPYLRVRNLADAIVELQAM 186

Query: 206 GFQTIGLSSDSKKPLEQ--EIKNDK-IALILGAEGKGLRPKTQETATSMAHLHMPGIIKA 262
           G+  +GL  ++++ +EQ  E K D+ IAL+LGAEG GLR KT+ET  ++  +   G   +
Sbjct: 187 GYLVLGLDGEAEQTIEQVVEGKRDRAIALVLGAEGPGLRDKTKETCDALVRIDFAGEFGS 246

Query: 263 LNVSNAAAVALYITQ 277
           LNVSNAAAVALY+++
Sbjct: 247 LNVSNAAAVALYVSR 261


>gi|261883694|ref|ZP_06007733.1| RNA methyltransferase, TrmH family, group 3 [Campylobacter fetus
           subsp. venerealis str. Azul-94]
          Length = 160

 Score =  181 bits (458), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 89/156 (57%), Positives = 115/156 (73%), Gaps = 4/156 (2%)

Query: 90  PFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDHVNDPHNIGA 149
           PFPV+ V P+ IDK  G EAVHQG+ +E  PL +  L  +R S LL+VLD V DPHN+GA
Sbjct: 3   PFPVEIVDPRDIDKETGSEAVHQGVMIEAEPLRTRKLSELRESPLLLVLDQVTDPHNVGA 62

Query: 150 ILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQT 209
           I+RSAVAF    +ITT R+SP E+ VLAK+ASGALE I +I + NL +A++++H+ GFQT
Sbjct: 63  IMRSAVAFGAGALITTSRHSPQETGVLAKAASGALELIAHIEVRNLAEAIEELHTLGFQT 122

Query: 210 IGLSSDSKKPLEQE--IKNDKIALILGAEGKGLRPK 243
           IGL  DS+ PLE E  +  ++IAL+LGAEG GLR K
Sbjct: 123 IGL--DSQGPLEMEATLSGNRIALVLGAEGXGLRQK 156


>gi|254441653|ref|ZP_05055146.1| RNA methyltransferase, TrmH family, group 3 [Octadecabacter
           antarcticus 307]
 gi|198251731|gb|EDY76046.1| RNA methyltransferase, TrmH family, group 3 [Octadecabacter
           antarcticus 307]
          Length = 291

 Score =  179 bits (454), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 107/281 (38%), Positives = 157/281 (55%), Gaps = 21/281 (7%)

Query: 15  LKDSHYAKLRRNHRDYKKMQSFNQKSRH--TSQPENLFLYGVHTVSAALNNPSRKIFQLL 72
             D  +       RD KK      K R+   +  E ++L+G+H V  AL NP R+  + +
Sbjct: 14  FGDGRHEGANAKDRDMKKPTWVVDKERNKRAAANETVWLFGIHAVRDALLNPVREKLRFV 73

Query: 73  ATKNALARLDWDANL------PHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTL 126
            TKNA  RL    ++      P P   +   P+     +  ++VHQG ALE  PL    +
Sbjct: 74  VTKNAFDRLGDAVSIGLKDGGPEP---EMCEPRNFAAPIDPQSVHQGAALEVKPLDWGKI 130

Query: 127 ------DAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSA 180
                 D V N   +++LD V DPHN+GAILRSA  F    +I   R++  E+  LAK+A
Sbjct: 131 EDRCMGDGV-NPPRVVLLDKVTDPHNVGAILRSAEVFGAQAVIAMNRHAAPETGALAKTA 189

Query: 181 SGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEI--KNDK-IALILGAEG 237
           SGA+E  PY+R+ NL DA+ ++   G+  +GL  ++++ +EQ +  K D+ IAL+LGAEG
Sbjct: 190 SGAMERQPYLRVRNLADAIVELQGMGYMVLGLDGEAEQTIEQVVDGKTDRAIALVLGAEG 249

Query: 238 KGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQN 278
            GLR KT+ET  ++  +   G   +LNVSNAAAVALY T++
Sbjct: 250 PGLRDKTKETCDALVKIDFAGEFGSLNVSNAAAVALYATRS 290


>gi|209964021|ref|YP_002296936.1| RNA methyltransferase, TrmH family, group 3 [Rhodospirillum
           centenum SW]
 gi|209957487|gb|ACI98123.1| RNA methyltransferase, TrmH family, group 3 [Rhodospirillum
           centenum SW]
          Length = 251

 Score =  177 bits (450), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 100/237 (42%), Positives = 142/237 (59%), Gaps = 13/237 (5%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLATKNALARLDW------DANLPHPFPVKTVPPQTIDK 103
            +YG+H V+AA  NP R+   L  T++ALA LD       +  L  P P   +  + +DK
Sbjct: 10  LIYGLHPVAAAWINPERRCRGLYVTESALAALDGAVQRAAELGLERPDP-TFLEKEELDK 68

Query: 104 IVGKEAVHQGLALETAPLLSPTLDAV------RNSQLLMVLDHVNDPHNIGAILRSAVAF 157
           ++   AVHQG+AL+TAPL    ++ V          L++VLD V DPHN+GAI+RSA AF
Sbjct: 69  LLPPGAVHQGVALDTAPLPEVAVEDVCIAAESEPQALVIVLDQVTDPHNVGAIMRSAAAF 128

Query: 158 SCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSK 217
               +I   R++P  + VLAK+ASGA++ +P +R++NL  AL  +   GF T+GL     
Sbjct: 129 GARAVIVQDRHAPPVTGVLAKTASGAVDAVPLVRVTNLARALDTLKQAGFWTVGLDESGA 188

Query: 218 KPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
           +PL +     + AL+LG+EG+GLR  T E    +A L   G + +LNVSNAAAVALY
Sbjct: 189 RPLHEVDLTGRTALVLGSEGEGLRRLTGERCDEIARLPTGGPVGSLNVSNAAAVALY 245


>gi|260753219|ref|YP_003226112.1| RNA methyltransferase, TrmH family, group 3 [Zymomonas mobilis
           subsp. mobilis NCIMB 11163]
 gi|258552582|gb|ACV75528.1| RNA methyltransferase, TrmH family, group 3 [Zymomonas mobilis
           subsp. mobilis NCIMB 11163]
          Length = 249

 Score =  177 bits (448), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 101/234 (43%), Positives = 142/234 (60%), Gaps = 9/234 (3%)

Query: 39  KSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPP 98
           +SR+ + P +   +G H V AALNNP R I ++ AT+ ALA      N+    PV     
Sbjct: 3   RSRNKASPSHPRFWGRHAVEAALNNPERHIRRIWATREALAPY----NIDKSIPVTLSDV 58

Query: 99  QTIDKIVGKEAVHQGLALETAPL----LSPTLDAVR-NSQLLMVLDHVNDPHNIGAILRS 153
             + + V  +A HQG+ +E  PL    LS  LD    + + L+VLD V DPHN+GAILRS
Sbjct: 59  ADLGRFVPNDAPHQGIVIEVDPLPDIWLSDLLDLPETDKRPLLVLDQVTDPHNVGAILRS 118

Query: 154 AVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLS 213
           A AF   GIIT  R++P ES  LA++ASGALE +P++R++NL  AL ++   G+  IGL+
Sbjct: 119 AAAFDALGIITQDRHAPPESGALARAASGALEVVPWVRVTNLARALDEIAEAGYWRIGLT 178

Query: 214 SDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSN 267
             S+  L Q + + K AL+LGAEG+GLR  T+     +A L +   I++LNVSN
Sbjct: 179 GHSEATLSQTLGSGKTALVLGAEGEGLRQNTEAHCDELAKLPISSKIESLNVSN 232


>gi|163741609|ref|ZP_02149000.1| RNA methyltransferase, TrmH family, group 3 [Phaeobacter
           gallaeciensis 2.10]
 gi|161385343|gb|EDQ09721.1| RNA methyltransferase, TrmH family, group 3 [Phaeobacter
           gallaeciensis 2.10]
          Length = 290

 Score =  177 bits (448), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 98/243 (40%), Positives = 148/243 (60%), Gaps = 7/243 (2%)

Query: 38  QKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVP 97
           ++S+  +  E ++L+G+H V  AL NP R+  +L+ T+NA A+L  DA        + + 
Sbjct: 44  EQSKKAASAETVWLFGLHAVRDALLNPKREKLRLMVTQNAEAKLA-DAIAQSGVETEVID 102

Query: 98  PQTIDKIVGKEAVHQGLALETAPLLSPTLDA-VRNSQL--LMVLDHVNDPHNIGAILRSA 154
           P+  +  + K++VHQG ALE  PL    LD     +++  +++LD V DPHN+GAILRSA
Sbjct: 103 PRKFNPPIDKQSVHQGAALEVKPLNWGGLDENCIGAEVPRVLLLDRVTDPHNVGAILRSA 162

Query: 155 VAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSS 214
                  +I T+  S  E+  LAK+ASGALE  PY+R+ NL D + ++   GF  +GL  
Sbjct: 163 EVLGASAVIGTRHNSAPETGALAKTASGALERQPYLRMRNLADTIVELQRMGFLVLGLDG 222

Query: 215 DSKKPLEQEI---KNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAV 271
           ++++ +E  +   K D +AL+LGAEG GLR KT+ET   +  +   G   +LNVSNAAA+
Sbjct: 223 EAEQTIEAVLDGRKGDPVALVLGAEGPGLRQKTKETVDHLVKIDAAGGFGSLNVSNAAAI 282

Query: 272 ALY 274
           ALY
Sbjct: 283 ALY 285


>gi|163738679|ref|ZP_02146093.1| RNA methyltransferase TrmH, group 3 [Phaeobacter gallaeciensis
           BS107]
 gi|161388007|gb|EDQ12362.1| RNA methyltransferase TrmH, group 3 [Phaeobacter gallaeciensis
           BS107]
          Length = 290

 Score =  177 bits (448), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 98/245 (40%), Positives = 149/245 (60%), Gaps = 7/245 (2%)

Query: 38  QKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVP 97
           ++S+  +  E ++L+G+H V  AL NP R+  +L+ T+NA A+L  DA        + + 
Sbjct: 44  EQSKKAASAETVWLFGLHAVRDALLNPKREKLRLMVTQNAEAKLA-DAIAQSGVEAEVID 102

Query: 98  PQTIDKIVGKEAVHQGLALETAPLLSPTLDA-VRNSQL--LMVLDHVNDPHNIGAILRSA 154
           P+  +  + K++VHQG ALE  PL    LD     +++  +++LD V DPHN+GAILRSA
Sbjct: 103 PRKFNPPIDKQSVHQGAALEVKPLNWGGLDENCIGAEVPRVLLLDRVTDPHNVGAILRSA 162

Query: 155 VAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSS 214
                  +I T+  S  E+  LAK+ASGALE  PY+R+ NL D + ++   GF  +GL  
Sbjct: 163 EVLGASAVIGTRHNSAPETGALAKTASGALERQPYLRMRNLADTIVELQRMGFLVLGLDG 222

Query: 215 DSKKPLEQEI---KNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAV 271
           ++++ +E  +   K D +AL+LGAEG GLR KT+ET   +  +   G   +LNVSNAAA+
Sbjct: 223 EAEQTIEAVLDGRKGDPVALVLGAEGPGLRQKTKETVDHLVKIDAAGGFGSLNVSNAAAI 282

Query: 272 ALYIT 276
           ALY +
Sbjct: 283 ALYAS 287


>gi|149186804|ref|ZP_01865114.1| rRNA methylase [Erythrobacter sp. SD-21]
 gi|148829471|gb|EDL47912.1| rRNA methylase [Erythrobacter sp. SD-21]
          Length = 263

 Score =  176 bits (446), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 93/220 (42%), Positives = 138/220 (62%), Gaps = 5/220 (2%)

Query: 51  LYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAV 110
           L+G H V AAL NP R+  +L AT+  +A LD    LP  FPV+    Q + ++V K+A 
Sbjct: 33  LWGRHAVEAALKNPDRQHRKLWATREGVASLD--GELPPDFPVEYADVQDLARLVAKDAP 90

Query: 111 HQGLALETAPLLSPTLDAVRN---SQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKR 167
           HQGL LE A L    LD V +   ++ ++VLD V DPHN+GAI+RSAVAF+   ++T  R
Sbjct: 91  HQGLVLECAALEDRFLDEVLDGDPARPIIVLDQVTDPHNVGAIMRSAVAFNAAALVTQDR 150

Query: 168 YSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKND 227
           ++P E  V+ KSASGALE +P+IR+ NL  A+++M   G+  IGL+  +     + +   
Sbjct: 151 HAPPEGGVIGKSASGALETLPWIRVVNLARAMEEMAEAGYWRIGLTGHTDTTFAEALPAG 210

Query: 228 KIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSN 267
            +A++LGAEG+G+R   +    ++A L +   I++LNVSN
Sbjct: 211 PVAIVLGAEGEGMRQNIETHCDALAKLPISNEIESLNVSN 250


>gi|241761486|ref|ZP_04759574.1| RNA methyltransferase, TrmH family, group 3 [Zymomonas mobilis
           subsp. mobilis ATCC 10988]
 gi|241374393|gb|EER63890.1| RNA methyltransferase, TrmH family, group 3 [Zymomonas mobilis
           subsp. mobilis ATCC 10988]
          Length = 249

 Score =  176 bits (445), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 100/234 (42%), Positives = 142/234 (60%), Gaps = 9/234 (3%)

Query: 39  KSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPP 98
           +SR+ + P +   +G H V AALNNP R I ++ AT+ ALA      N+    PV     
Sbjct: 3   RSRNKASPSHPRFWGRHAVEAALNNPERHIRRIWATREALAPY----NIDKSIPVTLSDV 58

Query: 99  QTIDKIVGKEAVHQGLALETAPL----LSPTLDAVR-NSQLLMVLDHVNDPHNIGAILRS 153
             + + V  +A HQG+ +E  PL    L+  LD    + + L+VLD V DPHN+GAILRS
Sbjct: 59  ADLGRFVPNDAPHQGIVIEVDPLPDIWLADLLDLPETDKRPLLVLDQVTDPHNVGAILRS 118

Query: 154 AVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLS 213
           A AF   GIIT  R++P ES  LA++ASGALE +P++R++NL  AL ++   G+  IGL+
Sbjct: 119 AAAFDALGIITQDRHAPPESGALARAASGALEVVPWVRVTNLARALDEIAEAGYWRIGLT 178

Query: 214 SDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSN 267
             S+  L Q + + K AL+LGAEG+GLR  T+     +A L +   I++LNVSN
Sbjct: 179 GHSEATLSQTLGSGKTALVLGAEGEGLRQNTEAHCDELAKLPISSKIESLNVSN 232


>gi|56551128|ref|YP_161967.1| RNA methyltransferase, TrmH family, group 3 [Zymomonas mobilis
           subsp. mobilis ZM4]
 gi|56542702|gb|AAV88856.1| RNA methyltransferase, TrmH family, group 3 [Zymomonas mobilis
           subsp. mobilis ZM4]
          Length = 249

 Score =  176 bits (445), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 100/234 (42%), Positives = 142/234 (60%), Gaps = 9/234 (3%)

Query: 39  KSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPP 98
           +SR+ + P +   +G H V AALNNP R I ++ AT+ ALA      N+    PV     
Sbjct: 3   RSRNKASPSHPRFWGRHAVEAALNNPERHIRRIWATREALAPY----NIDKSIPVTLSDV 58

Query: 99  QTIDKIVGKEAVHQGLALETAPL----LSPTLDAVR-NSQLLMVLDHVNDPHNIGAILRS 153
             + + V  +A HQG+ +E  PL    L+  LD    + + L+VLD V DPHN+GAILRS
Sbjct: 59  ADLGRFVPNDAPHQGIVIEVDPLPDIWLADLLDLPETDKRPLLVLDQVTDPHNVGAILRS 118

Query: 154 AVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLS 213
           A AF   GIIT  R++P ES  LA++ASGALE +P++R++NL  AL ++   G+  IGL+
Sbjct: 119 AAAFDALGIITQDRHAPPESGALARAASGALEVVPWVRVTNLARALDEIAEAGYWRIGLT 178

Query: 214 SDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSN 267
             S+  L Q + + K AL+LGAEG+GLR  T+     +A L +   I++LNVSN
Sbjct: 179 GHSEATLSQTLGSGKTALVLGAEGEGLRQNTEAHCDELAKLPISSKIESLNVSN 232


>gi|310816761|ref|YP_003964725.1| RNA methyltransferase, TrmH family, putative [Ketogulonicigenium
           vulgare Y25]
 gi|308755496|gb|ADO43425.1| RNA methyltransferase, TrmH family, putative [Ketogulonicigenium
           vulgare Y25]
          Length = 262

 Score =  176 bits (445), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 100/247 (40%), Positives = 147/247 (59%), Gaps = 11/247 (4%)

Query: 38  QKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVP 97
           +++R  S  E ++L+G+H V  AL NP R   +L+ T+NA  +L  DA       V+   
Sbjct: 11  EQARRVSAQETVWLFGLHAVRDALLNPERTRLRLVVTQNAADKLA-DAIAASGMEVELSD 69

Query: 98  PQTIDKIVGKEAVHQGLALETAPLLSPTLDAV-----RNSQ--LLMVLDHVNDPHNIGAI 150
           P+     +  E+VHQG ALE  PL   +L  V      N Q   L++LD V DPHN+GAI
Sbjct: 70  PRKFAAPIDPESVHQGAALEVKPLDWGSLADVALSLKDNGQPPRLVLLDRVTDPHNVGAI 129

Query: 151 LRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTI 210
           LRS+  F    ++  +R+S  E+  LAK+ASGALE  PYIR+ NL DA+ ++ + G+  +
Sbjct: 130 LRSSEVFGALAVVGVQRHSAPETGALAKTASGALERQPYIRVRNLGDAMDELRAMGYLLL 189

Query: 211 GLSSDSKKPLEQEIKNDK---IALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSN 267
           GL  + ++ +EQ I+  +   +A+++GAEG GLR KT+E    +  +   G   +LNVSN
Sbjct: 190 GLDGEGEQTIEQAIEGRRDRPVAIVMGAEGPGLREKTRELCDHLVRIPAAGGFASLNVSN 249

Query: 268 AAAVALY 274
           AAAVALY
Sbjct: 250 AAAVALY 256


>gi|85708105|ref|ZP_01039171.1| rRNA methylase [Erythrobacter sp. NAP1]
 gi|85689639|gb|EAQ29642.1| rRNA methylase [Erythrobacter sp. NAP1]
          Length = 265

 Score =  175 bits (443), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 95/220 (43%), Positives = 136/220 (61%), Gaps = 5/220 (2%)

Query: 51  LYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAV 110
           L+G H V AAL NP+R+  +L AT+  +  LD    LP  F V+      + ++V K+A 
Sbjct: 33  LWGRHPVEAALKNPARQHRKLWATREGIDSLD--GELPPDFAVEYAEVTDLARLVAKDAP 90

Query: 111 HQGLALETAPLLSPTLDAVRN---SQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKR 167
           HQGL LE  PL    LD V N   ++ ++VLD V DPHN+GAILRSA AF    I+T  R
Sbjct: 91  HQGLVLECEPLEDVFLDDVANGDPARPVVVLDQVTDPHNVGAILRSAAAFGAACIVTQDR 150

Query: 168 YSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKND 227
           ++P E  VLAKSASGALE +P++R+ NL  AL ++   G+  IGL+ +++  L   +   
Sbjct: 151 HAPPEGGVLAKSASGALETVPWVRVVNLARALDELADLGYWRIGLAGEAEATLSGSLTTG 210

Query: 228 KIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSN 267
            +AL+LGAEG+G+R    +   ++A L +   I++LNVSN
Sbjct: 211 ALALVLGAEGEGMRHNIAQHCDTLAKLPITSAIESLNVSN 250


>gi|126735336|ref|ZP_01751082.1| RNA methyltransferase, TrmH family, putative [Roseobacter sp. CCS2]
 gi|126715891|gb|EBA12756.1| RNA methyltransferase, TrmH family, putative [Roseobacter sp. CCS2]
          Length = 284

 Score =  175 bits (443), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 100/266 (37%), Positives = 152/266 (57%), Gaps = 10/266 (3%)

Query: 21  AKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALAR 80
           AK+    +  K + +  Q  R  +Q E ++L+G+H V  AL NP+R+  +L+ T+NAL R
Sbjct: 21  AKVGTQMKKPKWVIAKEQAKRQAAQ-ETVWLFGLHAVRDALENPARQKLRLVVTRNALER 79

Query: 81  LDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQ-----LL 135
           L  DA        +   P+     +  ++VHQG ALE  PL   +L+ V          +
Sbjct: 80  LG-DAVAQSGMEPEISDPRKFAAPLDPQSVHQGAALEVKPLDWGSLEDVALGDGPMPPRI 138

Query: 136 MVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNL 195
           ++LD V DPHN+GAILRSA  F    ++  +R+S  E+  LAK+ASGALE  PY+R+ NL
Sbjct: 139 VLLDRVTDPHNVGAILRSAEVFGARAVVAVQRHSAPETGALAKTASGALERQPYLRVRNL 198

Query: 196 TDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDK---IALILGAEGKGLRPKTQETATSMA 252
            DA++ +   G+  +GL  ++   +E  ++  +   +AL++GAEG GLR KT+ET   + 
Sbjct: 199 ADAMEALKGMGYLVLGLDGEADLTVEAAVEGKRDRPVALVMGAEGPGLREKTRETCNELV 258

Query: 253 HLHMPGIIKALNVSNAAAVALYITQN 278
            +       +LNVSNAAAVALY  + 
Sbjct: 259 KIDAAAGFGSLNVSNAAAVALYAVKG 284


>gi|260430943|ref|ZP_05784914.1| RNA methyltransferase, TrmH family, group 3 [Silicibacter
           lacuscaerulensis ITI-1157]
 gi|260414771|gb|EEX08030.1| RNA methyltransferase, TrmH family, group 3 [Silicibacter
           lacuscaerulensis ITI-1157]
          Length = 257

 Score =  175 bits (443), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 100/249 (40%), Positives = 149/249 (59%), Gaps = 9/249 (3%)

Query: 38  QKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVP 97
           +++R  +  E ++L+G+H V  AL NP R+  +L+ T+NA  +L  DA        + V 
Sbjct: 11  EQARKAAGSETVWLFGLHAVRDALMNPKRQKLRLIVTRNAQDKLA-DAIAASGIEPELVD 69

Query: 98  PQTIDKIVGKEAVHQGLALETAPL----LSPTLDAVRNSQLLMVLDHVNDPHNIGAILRS 153
            +     +   +VHQG+ALE  PL    L+       N ++L+ LD V DPHN+GAILRS
Sbjct: 70  ARRFTAPIDPGSVHQGVALEVKPLEWGGLAENCIGRENPRVLL-LDRVTDPHNVGAILRS 128

Query: 154 AVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLS 213
           A       +I T+ +S  E+  LAK+ASGALE  PY+R+ NL DA+ ++ + GF  +GL 
Sbjct: 129 AEVLGASAVIGTRHHSAPETGALAKTASGALERQPYLRVRNLADAIVELQNMGFLVLGLD 188

Query: 214 SDSKKPLEQEI--KNDK-IALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAA 270
            ++ + +E  +  K D+ +AL+LGAEG GLR KT+ET   +  +   G   +LNVSNAAA
Sbjct: 189 GEADQTIEAALDGKRDRPVALVLGAEGPGLRQKTKETVDQLVKIDAAGGFGSLNVSNAAA 248

Query: 271 VALYITQNH 279
           +ALY +Q H
Sbjct: 249 IALYASQPH 257


>gi|163746955|ref|ZP_02154312.1| RNA methyltransferase, TrmH family, putative [Oceanibulbus
           indolifex HEL-45]
 gi|161380069|gb|EDQ04481.1| RNA methyltransferase, TrmH family, putative [Oceanibulbus
           indolifex HEL-45]
          Length = 258

 Score =  174 bits (442), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 96/246 (39%), Positives = 146/246 (59%), Gaps = 7/246 (2%)

Query: 38  QKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVP 97
           ++ +     + ++L+G+H V  AL NP+R+  QL+ T NA A+L+ DA        + V 
Sbjct: 11  EQDKKADAAQTVWLFGLHAVRDALMNPNREKLQLMVTPNAQAKLE-DAIAEAGIAPEVVD 69

Query: 98  PQTIDKIVGKEAVHQGLALETAPLLSPTLDAV---RNSQLLMVLDHVNDPHNIGAILRSA 154
           P+     +   +VHQG  LE  PL    L+ V     +  L++LD V DPHN+GAILRSA
Sbjct: 70  PRKFRPPLDPNSVHQGAVLEVKPLNWGGLEDVAIGDTAPRLLLLDRVTDPHNVGAILRSA 129

Query: 155 VAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSS 214
                  +I TK +S  E+  LAK+ASGALE  PY+R+ NL DA++ +   G+  +GL  
Sbjct: 130 EVLGASAVIGTKHHSAPETGALAKTASGALERQPYLRVRNLADAIRALQGMGYLVLGLDG 189

Query: 215 DSKKPLEQEIKNDK---IALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAV 271
           ++ + +E  ++  +   +AL+LGAEG GLR KT+ET  ++  +   G   +LNVSNAAA+
Sbjct: 190 EATQTIETAVEGRRDRPVALVLGAEGPGLREKTRETVDALVRIDAAGGFGSLNVSNAAAI 249

Query: 272 ALYITQ 277
           ALY ++
Sbjct: 250 ALYASR 255


>gi|83951350|ref|ZP_00960082.1| RNA methyltransferase, TrmH family, group 3 [Roseovarius
           nubinhibens ISM]
 gi|83836356|gb|EAP75653.1| RNA methyltransferase, TrmH family, group 3 [Roseovarius
           nubinhibens ISM]
          Length = 259

 Score =  174 bits (442), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 96/250 (38%), Positives = 148/250 (59%), Gaps = 9/250 (3%)

Query: 38  QKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVP 97
           ++++  S  E ++L+G+H V  AL NP+R   +L+ TKNA  +L  DA        +   
Sbjct: 11  EQAKKASAAETVWLFGLHAVRDALMNPARDKLRLIVTKNACDKLQ-DAIDAAGITPEMAD 69

Query: 98  PQTIDKIVGKEAVHQGLALETAPLLSPTLDAVR-----NSQLLMVLDHVNDPHNIGAILR 152
           P+     +  ++VHQG ALE  PL   +L+ V       +  L++LD V DPHN+GAILR
Sbjct: 70  PRKFSAPIDPQSVHQGAALEVKPLNWGSLEDVALREGVGAPRLLLLDRVTDPHNVGAILR 129

Query: 153 SAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGL 212
           SA  F    +I  +  S  E+  LAK+ASGALE  PY+R+ NL DA+ ++ + GF  +GL
Sbjct: 130 SAEVFGAQAVIAPRHGSAPETGALAKTASGALERQPYLRVRNLADAISELQAMGFLVLGL 189

Query: 213 SSDSKKPLEQEI---KNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAA 269
           + +++  ++  +   ++  +AL+LGAEG GLR KT+ET   +  +   G   +LNVSNAA
Sbjct: 190 AGEAEDTIDAALDGMRDRPVALVLGAEGPGLRQKTRETCDKLVKIPFAGGFGSLNVSNAA 249

Query: 270 AVALYITQNH 279
           AV+LY ++  
Sbjct: 250 AVSLYASRER 259


>gi|254464985|ref|ZP_05078396.1| RNA methyltransferase, TrmH family, group 3 [Rhodobacterales
           bacterium Y4I]
 gi|206685893|gb|EDZ46375.1| RNA methyltransferase, TrmH family, group 3 [Rhodobacterales
           bacterium Y4I]
          Length = 258

 Score =  174 bits (441), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 94/243 (38%), Positives = 147/243 (60%), Gaps = 7/243 (2%)

Query: 38  QKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVP 97
           ++S+  +  E ++L+G+H V  AL NP R+  +L+ T+NA  +L  DA        + + 
Sbjct: 12  EQSKRAAAAETVWLFGLHAVRDALLNPKREKLRLMVTQNAQVKLA-DAIAESGIEAEVID 70

Query: 98  PQTIDKIVGKEAVHQGLALETAPLLSPTLDA---VRNSQLLMVLDHVNDPHNIGAILRSA 154
           P+  +  +  ++VHQG ALE  PL    L      R +  +++LD V DPHN+GAILRSA
Sbjct: 71  PRKFNPPIDAQSVHQGAALEVKPLNWGGLAENCIGREAPRVLLLDRVTDPHNVGAILRSA 130

Query: 155 VAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSS 214
                  +I T+ +S  E+  LAK+ASGALE  PY+R+ NL D + ++ + GF  +GL  
Sbjct: 131 EVLGASAVIGTRHHSAPETGALAKTASGALERQPYLRMRNLADTITELQNMGFIVLGLDG 190

Query: 215 DSKKPLEQEIKNDK---IALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAV 271
           ++++ +E  ++  +   +AL+LGAEG GLR KT+ET  ++  +   G   +LNVSNAAA+
Sbjct: 191 EAEQTIETALEGKQHLPVALVLGAEGPGLRQKTKETVDALVKIGAAGGFGSLNVSNAAAI 250

Query: 272 ALY 274
           ALY
Sbjct: 251 ALY 253


>gi|87199385|ref|YP_496642.1| RNA methyltransferase TrmH, group 3 [Novosphingobium
           aromaticivorans DSM 12444]
 gi|87135066|gb|ABD25808.1| RNA methyltransferase TrmH, group 3 [Novosphingobium
           aromaticivorans DSM 12444]
          Length = 271

 Score =  173 bits (439), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 97/224 (43%), Positives = 136/224 (60%), Gaps = 5/224 (2%)

Query: 49  LFLYGVHTVSAALNNPSRKIFQLLATKNALARL--DWDANLPHPFPVKTVPPQTIDKIVG 106
           + L+G H V AAL NP+R   +L  T+ A+  +  D DA LP   PV+      + ++V 
Sbjct: 34  IRLWGRHAVEAALTNPNRDAKKLWGTREAIQAMLDDHDAELPASLPVEYAQAADLGRLVA 93

Query: 107 KEAVHQGLALETAPLLSPTLDAVR---NSQLLMVLDHVNDPHNIGAILRSAVAFSCDGII 163
           K+A HQGL L+ APL    LD V      + ++VLD V DPHN+GAILRS  AF    ++
Sbjct: 94  KDAPHQGLVLDCAPLDDVVLDDVLDEAEGRTIVVLDSVTDPHNVGAILRSCAAFDVAALV 153

Query: 164 TTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQE 223
           T  R++P ES  LAKSASGALE +P++R+ NL+ AL++M   G+  IGL  D K      
Sbjct: 154 TQDRHAPPESGTLAKSASGALEIVPWVRVVNLSRALERMSEEGYWRIGLDGDGKAVFPAA 213

Query: 224 IKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSN 267
           + +  +AL+LGAEG+GLR    +   S+A L +   I++LNVSN
Sbjct: 214 LPSGPVALVLGAEGEGLRHNVAQHCDSIARLPIASAIESLNVSN 257


>gi|296116988|ref|ZP_06835589.1| RNA methyltransferase, TrmH family, group 3 [Gluconacetobacter
           hansenii ATCC 23769]
 gi|295976470|gb|EFG83247.1| RNA methyltransferase, TrmH family, group 3 [Gluconacetobacter
           hansenii ATCC 23769]
          Length = 306

 Score =  173 bits (438), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 104/239 (43%), Positives = 139/239 (58%), Gaps = 2/239 (0%)

Query: 38  QKSRHTSQPEN-LFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTV 96
           ++ R    P    +LYG H V AAL+NP R + QLL T  A A L+       P   + V
Sbjct: 61  ERGRAEVAPRGTCWLYGTHAVMAALSNPHRHLRQLLTTAEAQAALEERMGRALPIQPQRV 120

Query: 97  PPQTIDKIVGKEAVHQGLALETAPLLSPTL-DAVRNSQLLMVLDHVNDPHNIGAILRSAV 155
               ID I G++AVHQG+AL    L +P L D V     +++LD V DP NIGAILRSA 
Sbjct: 121 DRARIDSICGRDAVHQGIALLADLLDTPALEDIVERPGPVLLLDQVTDPRNIGAILRSAA 180

Query: 156 AFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSD 215
           AF    +I   R +P E+  LAK+ASGALE +P +R+ NL+  +  + S G  T+GL + 
Sbjct: 181 AFGAAAVIVQDRNAPEETGALAKAASGALEVVPLVRVVNLSRTIDALKSHGMWTVGLDAG 240

Query: 216 SKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
                    +  ++AL+LGAEG GLR  T+E    +A L M G +++LNVSNAAAVALY
Sbjct: 241 GGILDGASFRQRRVALVLGAEGAGLRRLTREHCDEIAGLAMSGDMESLNVSNAAAVALY 299


>gi|114797823|ref|YP_761366.1| RNA methyltransferase [Hyphomonas neptunium ATCC 15444]
 gi|114737997|gb|ABI76122.1| RNA methyltransferase, TrmH family, group 3 [Hyphomonas neptunium
           ATCC 15444]
          Length = 269

 Score =  172 bits (437), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 98/247 (39%), Positives = 147/247 (59%), Gaps = 19/247 (7%)

Query: 37  NQK-SRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKT 95
           NQ+ SR   +   ++L+G H V AAL NP+RK   LLAT+NA  +L          P   
Sbjct: 23  NQRFSRRDEEGGPVWLWGTHAVMAALANPARKFHTLLATENAAQKL----------PAGV 72

Query: 96  VPPQ-----TIDKIVGKEAVHQGLALETAPLLSPTLDAV--RNSQLLMVLDHVNDPHNIG 148
           + PQ      ID  +   AVHQG+AL   PL    L+ V    +  + VLD V+DPHN+G
Sbjct: 73  ISPQLATAKEIDNRLPPGAVHQGIALRADPLEEAILEDVIAAGATRIAVLDQVSDPHNLG 132

Query: 149 AILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQ 208
           AI RSA AF  +G++   R +P  + ++AKSA+GA+E +  IR  N+  AL+++    F 
Sbjct: 133 AIFRSAAAFGFEGLVLQTRNAPPITGIVAKSAAGAIETVTEIRAVNIARALEQLAEADFH 192

Query: 209 TIGLSSDSKKPLEQEIKN-DKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSN 267
           T+GL+ +S + L++ +K   K+A++LGAEG GLRP   +  + +A + +   +++LNVSN
Sbjct: 193 TVGLAGESTRSLDEAVKGAAKVAIVLGAEGSGLRPAVAKACSELARIPIAAQMESLNVSN 252

Query: 268 AAAVALY 274
           AAA+A Y
Sbjct: 253 AAAIAFY 259


>gi|254475163|ref|ZP_05088549.1| RNA methyltransferase, TrmH family, group 3 [Ruegeria sp. R11]
 gi|214029406|gb|EEB70241.1| RNA methyltransferase, TrmH family, group 3 [Ruegeria sp. R11]
          Length = 294

 Score =  172 bits (436), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 95/244 (38%), Positives = 144/244 (59%), Gaps = 9/244 (3%)

Query: 38  QKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVP 97
           ++++  +  E ++L+G+H V  AL NP+R+  +L+ T NA  +L  DA        + + 
Sbjct: 48  EQAKKAASAETVWLFGLHAVRDALLNPNREKLRLMVTPNAETKLS-DAIAQSGIEAEVID 106

Query: 98  PQTIDKIVGKEAVHQGLALETAPL----LSPTLDAVRNSQLLMVLDHVNDPHNIGAILRS 153
           P+  +  + K++VHQG  LE  PL    L+         ++L+ LD V DPHN+GAILRS
Sbjct: 107 PRKFNPPIDKQSVHQGAVLEVKPLNWGGLAENCIGAEAPRVLL-LDRVTDPHNVGAILRS 165

Query: 154 AVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLS 213
           A       +I T+  S  E+  LAK+ASGALE  PY+R+ NL D + ++   GF  +GL 
Sbjct: 166 AEVLGASAVIGTRHNSAPETGALAKTASGALERQPYLRMRNLADTIVELQRMGFLVLGLD 225

Query: 214 SDSKKPLEQEI---KNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAA 270
            ++++ +E  +   K D +AL+LGAEG GLR KT+ET   +  +   G   +LNVSNAAA
Sbjct: 226 GEAEQTIETVLEGRKGDPVALVLGAEGPGLRQKTKETVDHLVKIDFAGGFGSLNVSNAAA 285

Query: 271 VALY 274
           +ALY
Sbjct: 286 IALY 289


>gi|288957405|ref|YP_003447746.1| RNA methyltransferase [Azospirillum sp. B510]
 gi|288909713|dbj|BAI71202.1| RNA methyltransferase [Azospirillum sp. B510]
          Length = 311

 Score =  172 bits (436), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 103/288 (35%), Positives = 157/288 (54%), Gaps = 21/288 (7%)

Query: 5   SKKKSEKIFSL---KDSHYAKLRRNHRD-YKKMQSFNQKSRHTSQPENLFLYGVHTVSAA 60
           S++++E+  +    +  H A  R++  D   + +    K         + LYG+H V+AA
Sbjct: 20  SERQAERTGAKPQHQPQHGAASRQDQTDDAGRGRRGATKGGRAPAARGVLLYGLHPVAAA 79

Query: 61  LNNPSRKIFQLLATKNALARLD--------WDANLPHPFPVKTVPPQTIDKIVGKEAVHQ 112
             NP R+I +LL T +  A L+             P   P   V    +D+++   AVHQ
Sbjct: 80  WTNPERRIHRLLVTDSGRAALEPVIAEARARGLQRPEASPADRV---ELDRMLPPGAVHQ 136

Query: 113 GLALETAPLLSPTLDAVRN------SQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTK 166
           G+ ++ +PL    ++ + N      S +++ LD V DPHN+GAILRSA AF    ++ T+
Sbjct: 137 GIVIDASPLPELGIEDLCNELASEPSAVIVALDQVTDPHNVGAILRSAAAFGARAVVVTE 196

Query: 167 RYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKN 226
           R++P  + VLAKSASGALE +P +R++NL  AL  +   GF ++GL+      L +    
Sbjct: 197 RHAPETTGVLAKSASGALEAVPLVRVTNLARALTDLQQNGFWSVGLAESGPSTLAKLDLT 256

Query: 227 DKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
            K  L++GAEG GLR  T E   ++A L   G + +LNVSNAAAVALY
Sbjct: 257 GKTVLVMGAEGSGLRRLTMERCDAIARLPTGGPVGSLNVSNAAAVALY 304


>gi|254461438|ref|ZP_05074854.1| RNA methyltransferase, TrmH family, group 3 [Rhodobacterales
           bacterium HTCC2083]
 gi|206678027|gb|EDZ42514.1| RNA methyltransferase, TrmH family, group 3 [Rhodobacteraceae
           bacterium HTCC2083]
          Length = 259

 Score =  171 bits (434), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 97/245 (39%), Positives = 143/245 (58%), Gaps = 9/245 (3%)

Query: 38  QKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVP 97
           ++ +  +  E ++L+G+H V  AL NP R   +L+ T+NA+ +L          P +   
Sbjct: 11  EQDKKAADAETVWLFGLHAVRDALMNPERTKLKLVVTRNAMDKLSEAIAFSELEP-EMCE 69

Query: 98  PQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMV-----LDHVNDPHNIGAILR 152
           P+  +  +  ++VHQG ALE  PL    L+ V       V     LD V DPHN+GAILR
Sbjct: 70  PRKFNAPLDPQSVHQGAALEVKPLTWGRLEEVCIGGTAAVPRAVLLDRVTDPHNVGAILR 129

Query: 153 SAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGL 212
           SA  F    +I T R S  E+  LAK+ASGALE  PY+RI NL ++++ +   G+  IGL
Sbjct: 130 SAEVFGASAVIGTHRGSAPETGALAKTASGALERQPYLRIRNLAESIESLQKMGYLVIGL 189

Query: 213 SSDSKKPLEQ--EIKNDK-IALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAA 269
             ++++ ++   E K D+ IAL++GAEG GLR KT++T  ++  +   G   +LNVSNAA
Sbjct: 190 DGEAEQTIDAYLEGKRDRPIALVMGAEGPGLREKTKDTVDALVKVEFAGAFGSLNVSNAA 249

Query: 270 AVALY 274
           AVALY
Sbjct: 250 AVALY 254


>gi|254512223|ref|ZP_05124290.1| RNA methyltransferase, TrmH family, group 3 [Rhodobacteraceae
           bacterium KLH11]
 gi|221535934|gb|EEE38922.1| RNA methyltransferase, TrmH family, group 3 [Rhodobacteraceae
           bacterium KLH11]
          Length = 257

 Score =  171 bits (432), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 95/248 (38%), Positives = 142/248 (57%), Gaps = 7/248 (2%)

Query: 38  QKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVP 97
           +++R  +  E ++L+G+H V  AL NP R+  +L+ T+NA  +L          P +   
Sbjct: 11  EQARKVAAAETVWLFGLHAVRDALMNPKRQKLRLIVTRNAGDKLVEAIEFAGITP-EIAD 69

Query: 98  PQTIDKIVGKEAVHQGLALETAPLLSPTLDA---VRNSQLLMVLDHVNDPHNIGAILRSA 154
           P+     +   +VHQG ALE  PL    L      R    +++LD V DPHN+GAILRSA
Sbjct: 70  PRKFTAPIDPGSVHQGAALEVKPLEWGGLAENCIGREHPRVLLLDRVTDPHNVGAILRSA 129

Query: 155 VAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSS 214
                  +I T+ +S  E+  LAK+ASGALE  PY+R+ NL DA+ ++ + GF  +GL  
Sbjct: 130 EVLGASAVIGTRHHSAPETGALAKTASGALERQPYLRVRNLADAIVELQNMGFLVLGLDG 189

Query: 215 DSKKPLEQEIKNDK---IALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAV 271
           ++   +E  +  D+   +AL+LGAEG GLR KT+ET   +  +   G   +LNVSNAAA+
Sbjct: 190 EADDTIESSLGGDRDRPVALVLGAEGPGLRQKTKETVDQLVKIDAAGGFGSLNVSNAAAI 249

Query: 272 ALYITQNH 279
           ALY ++  
Sbjct: 250 ALYASKTR 257


>gi|296284720|ref|ZP_06862718.1| rRNA methylase [Citromicrobium bathyomarinum JL354]
          Length = 249

 Score =  171 bits (432), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 97/221 (43%), Positives = 136/221 (61%), Gaps = 6/221 (2%)

Query: 51  LYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAV 110
           L+G H V AAL NP RK  +L AT+  +  LD    LP  FPV+      +D++V ++A 
Sbjct: 17  LWGRHAVEAALLNPERKHRKLWATREGIESLD--GELPPDFPVEYADTPDLDRLVARDAP 74

Query: 111 HQGLALETAPL----LSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTK 166
           HQGL LE APL    L+  + +    + +++LD V DPHN+GAILRSA AF    I+T  
Sbjct: 75  HQGLVLECAPLEERDLAEVIQSGEPGRPIVLLDQVTDPHNVGAILRSAAAFDAAAIVTQD 134

Query: 167 RYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKN 226
           R++P ES V+AKSASGALE +P++R+ NL  AL  +   GF  IGL+ +++  L + I  
Sbjct: 135 RHAPPESGVVAKSASGALETVPWVRVVNLARALDDLAERGFWRIGLAGEAEMTLAEAIPT 194

Query: 227 DKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSN 267
             +AL+LGAEG GLR        ++A L +   I++LNVSN
Sbjct: 195 GPVALVLGAEGAGLRHNIAGHCDALAKLPISDAIESLNVSN 235


>gi|329114437|ref|ZP_08243199.1| 23S rRNA (guanosine-2'-O-)-methyltransferase RlmB [Acetobacter
           pomorum DM001]
 gi|326696513|gb|EGE48192.1| 23S rRNA (guanosine-2'-O-)-methyltransferase RlmB [Acetobacter
           pomorum DM001]
          Length = 318

 Score =  170 bits (431), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 109/269 (40%), Positives = 153/269 (56%), Gaps = 13/269 (4%)

Query: 12  IFSLKDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPEN-LFLYGVHTVSAALNNPSRKIFQ 70
           +F  +  H    RR      ++ S   +    S P    +L+G H V+AALNNP R   +
Sbjct: 37  VFMRQPRHGRSARR-----PRVSSAGGREGAPSAPAGTCWLFGTHAVAAALNNPRRVYER 91

Query: 71  LLATKN---ALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPT-L 126
           LL T+    AL             P + V  Q +D ++G +AVHQG+AL  A +L P  L
Sbjct: 92  LLVTEENHPALEEATRSGRNVRVTP-ELVQRQRLDDLLGPDAVHQGVAL-LARILPPMPL 149

Query: 127 D-AVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALE 185
           D A+     ++VLD V DP NIGAILRSA AF    ++   R +P E+AVLAK+ASGALE
Sbjct: 150 DEALERPGPVLVLDQVTDPRNIGAILRSAAAFGAACLVVQDRNAPEETAVLAKAASGALE 209

Query: 186 HIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQ 245
            +P +R  NL+ A++++   G  T+GL +             ++AL+LGAEGKGLR  T+
Sbjct: 210 TVPMVREVNLSRAIEQLQKAGCWTVGLDAGGTTLDGASFDGRRVALVLGAEGKGLRRLTR 269

Query: 246 ETATSMAHLHMPGIIKALNVSNAAAVALY 274
           E+   +A L+MPG +++LNVS AAAV LY
Sbjct: 270 ESCDEIAGLYMPGEMESLNVSVAAAVGLY 298


>gi|312113910|ref|YP_004011506.1| RNA methyltransferase, TrmH family, group 3 [Rhodomicrobium
           vannielii ATCC 17100]
 gi|311219039|gb|ADP70407.1| RNA methyltransferase, TrmH family, group 3 [Rhodomicrobium
           vannielii ATCC 17100]
          Length = 310

 Score =  170 bits (431), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 96/232 (41%), Positives = 131/232 (56%), Gaps = 11/232 (4%)

Query: 51  LYGVHTVSAALNNPSRKIFQLLATKNALARLD--WDANLPHPFPVKTVPPQTIDKIVGKE 108
           LYG+H+V AAL NP R+I     T+NA ARL    DA            P  +D + G  
Sbjct: 72  LYGLHSVEAALANPKRRIRHAWLTENAAARLAPLLDA---RKIAATLALPADLDALTGPG 128

Query: 109 AVHQGLALETAPLLSPTLDAVRNS-----QLLMVLDHVNDPHNIGAILRSAVAFSCDGII 163
           AVHQG  L+  PL  P LD   ++       +++LD V DPHN+GA+LRSA AF    +I
Sbjct: 129 AVHQGAVLQVEPLAQPGLDDFLDALGDAPATVVILDQVTDPHNVGAVLRSAAAFGIGALI 188

Query: 164 TTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQE 223
              R+SP  +A LAKSASG LEH+P I + NL   L+K+    F  IG  S+  +  +  
Sbjct: 189 VQDRHSPPLTAALAKSASGGLEHVPVIEVVNLARVLEKLKERDFLCIGFDSEGAQRFDAA 248

Query: 224 IKND-KIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
           +    ++A + GAE KGLR   +E   ++A L  PG IK+LN+SNAAA+  +
Sbjct: 249 LAGGRRVAFVFGAEDKGLRRLVREGCDAIAALSAPGPIKSLNISNAAAIVFH 300


>gi|258541781|ref|YP_003187214.1| ribosomal large subunit 23S rRNA methyltransferase SpoU
           [Acetobacter pasteurianus IFO 3283-01]
 gi|256632859|dbj|BAH98834.1| ribosomal large subunit 23S rRNA methyltransferase SpoU
           [Acetobacter pasteurianus IFO 3283-01]
 gi|256635916|dbj|BAI01885.1| ribosomal large subunit 23S rRNA methyltransferase SpoU
           [Acetobacter pasteurianus IFO 3283-03]
 gi|256638971|dbj|BAI04933.1| ribosomal large subunit 23S rRNA methyltransferase SpoU
           [Acetobacter pasteurianus IFO 3283-07]
 gi|256642025|dbj|BAI07980.1| ribosomal large subunit 23S rRNA methyltransferase SpoU
           [Acetobacter pasteurianus IFO 3283-22]
 gi|256645080|dbj|BAI11028.1| ribosomal large subunit 23S rRNA methyltransferase SpoU
           [Acetobacter pasteurianus IFO 3283-26]
 gi|256648135|dbj|BAI14076.1| ribosomal large subunit 23S rRNA methyltransferase SpoU
           [Acetobacter pasteurianus IFO 3283-32]
 gi|256651188|dbj|BAI17122.1| ribosomal large subunit 23S rRNA methyltransferase SpoU
           [Acetobacter pasteurianus IFO 3283-01-42C]
 gi|256654179|dbj|BAI20106.1| ribosomal large subunit 23S rRNA methyltransferase SpoU
           [Acetobacter pasteurianus IFO 3283-12]
          Length = 280

 Score =  170 bits (430), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 105/249 (42%), Positives = 147/249 (59%), Gaps = 8/249 (3%)

Query: 32  KMQSFNQKSRHTSQPEN-LFLYGVHTVSAALNNPSRKIFQLLATKN---ALARLDWDANL 87
           ++ S   +    S P    +L+G H V+AALNNP R   +LL T+    AL         
Sbjct: 14  RVSSAGGREGAPSAPAGTCWLFGTHAVAAALNNPRRVYERLLVTEENHPALEEATRSGRG 73

Query: 88  PHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPT-LD-AVRNSQLLMVLDHVNDPH 145
               P + V  Q +D ++G +AVHQG+AL  A +L P  LD A+     ++VLD V DP 
Sbjct: 74  VRVAP-ELVQRQRLDDLLGPDAVHQGVAL-LARVLPPMPLDEALERPGPVLVLDQVTDPR 131

Query: 146 NIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSW 205
           NIGAILRSA AF    ++   R +P E+AVLAK+ASGALE +P +R  NL+ A++++   
Sbjct: 132 NIGAILRSAAAFGAACLVVQDRNAPEETAVLAKAASGALETVPMVREVNLSRAIEQLQKS 191

Query: 206 GFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNV 265
           G  T+GL +             ++AL+LGAEGKGLR  T+E+   +A L+MPG +++LNV
Sbjct: 192 GCWTVGLDAGGTTLDGASFDGRRVALVLGAEGKGLRRLTRESCDEIAGLYMPGEMESLNV 251

Query: 266 SNAAAVALY 274
           S AAAV LY
Sbjct: 252 SVAAAVGLY 260


>gi|83955674|ref|ZP_00964254.1| RNA methyltransferase, TrmH family, group 3 [Sulfitobacter sp.
           NAS-14.1]
 gi|83839968|gb|EAP79144.1| RNA methyltransferase, TrmH family, group 3 [Sulfitobacter sp.
           NAS-14.1]
          Length = 258

 Score =  169 bits (429), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 94/239 (39%), Positives = 145/239 (60%), Gaps = 7/239 (2%)

Query: 47  ENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVG 106
           + ++L+G+H V  AL NP+R+  +L+ T NA  +L+ +A        + V P+     + 
Sbjct: 20  QTVWLFGLHAVRDALENPAREKIKLMVTPNAQIKLE-EAIAKAGIEPEVVDPRKFRPPLD 78

Query: 107 KEAVHQGLALETAPLLSPTLDAV---RNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGII 163
             +VHQG  LE  PL   TL  V     +  +++LD V DPHN+GAILRSA       ++
Sbjct: 79  PGSVHQGAVLEVKPLSWGTLKDVCIGAEAPRVLLLDRVTDPHNVGAILRSAEVLGASAVV 138

Query: 164 TTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQ- 222
             + ++  E+  LAK+ASGALE  PY+R+ NL DA++++ S G+  +GL  ++   +E  
Sbjct: 139 GMRHHAAPETGALAKTASGALERQPYLRVRNLADAIKELQSMGYLVLGLDGEADMTVESA 198

Query: 223 -EIKNDK-IALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNH 279
            E K D+ +AL+LGAEG GLR KT+ET  ++  +   G   +LNVSNAAA+ALY +++H
Sbjct: 199 LEGKRDRPVALVLGAEGPGLREKTKETVDALVRIDAGGGFGSLNVSNAAAIALYASRDH 257


>gi|58038971|ref|YP_190935.1| 23S rRNA methyltransferase [Gluconobacter oxydans 621H]
 gi|58001385|gb|AAW60279.1| 23S rRNA methyltransferase [Gluconobacter oxydans 621H]
          Length = 282

 Score =  169 bits (429), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 96/226 (42%), Positives = 138/226 (61%), Gaps = 6/226 (2%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEA 109
           ++YG H V AAL NP R I   LAT+ A A  +  +  P     + V  + +D++  ++A
Sbjct: 56  WIYGHHAVQAALANPERVIHDFLATREAAASFENASRKP-----QIVDRERLDRLCERDA 110

Query: 110 VHQGLALETAPLLSPTL-DAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRY 168
           VHQG+ L   PL +  + D V     ++VLD V DP NIGAILRSA AF    ++   R 
Sbjct: 111 VHQGVCLRVEPLETLAIPDIVERKGPVLVLDQVTDPRNIGAILRSAAAFGAAALLVQDRN 170

Query: 169 SPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDK 228
           +P ES  +AK+ASGAL+ +P +R  NL+ ALQ + +  F  +GL +   +   +     +
Sbjct: 171 APQESGAMAKAASGALDVVPILREVNLSRALQALQAENFWVVGLDAGGTRLDGKSFAGRR 230

Query: 229 IALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
           +AL+LGAEG GLR  T+ET   +A ++MPG +++LNVSNAAAVALY
Sbjct: 231 VALVLGAEGAGLRRLTRETCDEIASVYMPGDMESLNVSNAAAVALY 276


>gi|126725688|ref|ZP_01741530.1| RNA methyltransferase, TrmH family, group 3 [Rhodobacterales
           bacterium HTCC2150]
 gi|126704892|gb|EBA03983.1| RNA methyltransferase, TrmH family, group 3 [Rhodobacterales
           bacterium HTCC2150]
          Length = 266

 Score =  169 bits (429), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 100/248 (40%), Positives = 142/248 (57%), Gaps = 13/248 (5%)

Query: 38  QKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVP 97
           ++ +       ++L+G+H V  AL NP R++ +L+ TKNA  RL  DA        +   
Sbjct: 13  ERQKRAEDALTVWLFGIHAVRDALLNPKRELLKLVVTKNAADRLA-DAIEQSGITPEICE 71

Query: 98  PQTIDKIVGKEAVHQGLALETAPL-----LSPTLDAVRNSQLLMVLDHVNDPHNIGAILR 152
           P+     +   +VHQG ALE  PL      S  +DA  + +LL  LD V DPHN+GAILR
Sbjct: 72  PRKFSAPLDAGSVHQGAALEVKPLKWTDLQSIAIDAGPHGRLLF-LDRVTDPHNVGAILR 130

Query: 153 SAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGL 212
           SA       +I TKR +  E+  LAK+ASGALE  PY+RI NL D +++M + G+  +GL
Sbjct: 131 SAEVLGAAAVIATKRNAAPETGALAKTASGALERQPYVRIRNLADTMEEMKALGYILLGL 190

Query: 213 SSDSKKPLEQEIKND------KIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVS 266
             +++  +E  I +        IAL+LGAEG GLR KT+ T  ++  +   G   +LNVS
Sbjct: 191 DGEAEDTMETVIASTLANGPRPIALVLGAEGPGLRDKTKATCDALMRIDSAGAFGSLNVS 250

Query: 267 NAAAVALY 274
           NAAAV+LY
Sbjct: 251 NAAAVSLY 258


>gi|332187397|ref|ZP_08389135.1| RNA 2'-O ribose methyltransferase substrate binding family protein
           [Sphingomonas sp. S17]
 gi|332012558|gb|EGI54625.1| RNA 2'-O ribose methyltransferase substrate binding family protein
           [Sphingomonas sp. S17]
          Length = 247

 Score =  169 bits (428), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 99/249 (39%), Positives = 144/249 (57%), Gaps = 21/249 (8%)

Query: 24  RRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDW 83
           RR HR     Q+ + + R          +G H V+AAL NP+R + ++  T+ ALA LD 
Sbjct: 3   RRGHR---PSQASSNRPR---------FWGRHAVTAALANPNRTVRKIWGTREALAALD- 49

Query: 84  DANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPL----LSPTLDAVRNSQL-LMVL 138
              LP   P+       + ++V  +A HQGL  E  PL    L   L   ++ Q  L+VL
Sbjct: 50  ---LPPVVPITYADAADLGRLVPADAPHQGLVAEVDPLEDMWLGDLLHEGQDDQRPLVVL 106

Query: 139 DHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDA 198
           D V DPHN+GAILRSA AF   GI+T  R++P ES  +A+SASGALE +P+IR+ NL  A
Sbjct: 107 DQVTDPHNVGAILRSAAAFDALGIVTQDRHAPPESGTVARSASGALETVPWIRVVNLARA 166

Query: 199 LQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPG 258
           L+++   GF  IGL+  + + L Q +   +I ++LGAEG+G+R  T+     +A L +  
Sbjct: 167 LEEIAEAGFWRIGLTGHANQTLAQAMGTQRICIVLGAEGEGMRQNTEAHCDELAKLPISP 226

Query: 259 IIKALNVSN 267
            +++LNVSN
Sbjct: 227 KVESLNVSN 235


>gi|149914472|ref|ZP_01903003.1| tRNA/rRNA metyltransferase [Roseobacter sp. AzwK-3b]
 gi|149811991|gb|EDM71824.1| tRNA/rRNA metyltransferase [Roseobacter sp. AzwK-3b]
          Length = 275

 Score =  169 bits (428), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 94/240 (39%), Positives = 144/240 (60%), Gaps = 10/240 (4%)

Query: 48  NLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGK 107
            ++L+G+H V  AL NP+R   +L+ T+NA  RL  +A        +   P+     +  
Sbjct: 37  TVWLFGLHAVRDALMNPARVKLRLIVTRNAADRLG-EAIAVGGLEPEIADPRRFTAPLDP 95

Query: 108 EAVHQGLALETAPLLSPTLDAVRNSQ------LLMVLDHVNDPHNIGAILRSAVAFSCDG 161
           ++VHQG ALE  PL    L+ V  S        +++LD V+DPHN+GAILRSA  F    
Sbjct: 96  QSVHQGAALEVKPLDWGPLEGVCASAPGELPPRVLLLDRVSDPHNVGAILRSAEVFGACA 155

Query: 162 IITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLE 221
           +I   R+S  E+  LAK+ASGALE  PY+R++NL  A++ +   G+  +GL+ ++++ +E
Sbjct: 156 VIAPHRHSAPETGALAKTASGALERQPYLRVTNLGRAIEALQGMGYVVLGLAGEAERTIE 215

Query: 222 QEIKNDK---IALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQN 278
           + ++  +   +AL+LGAEG GLR KT+ET   +  +   G   +LNVSNAAAVALY ++ 
Sbjct: 216 EALEGRRSGPVALVLGAEGPGLREKTRETCDELVRIAFSGDFGSLNVSNAAAVALYASRR 275


>gi|260576862|ref|ZP_05844845.1| RNA methyltransferase, TrmH family, group 3 [Rhodobacter sp. SW2]
 gi|259020899|gb|EEW24212.1| RNA methyltransferase, TrmH family, group 3 [Rhodobacter sp. SW2]
          Length = 265

 Score =  169 bits (427), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 92/237 (38%), Positives = 142/237 (59%), Gaps = 8/237 (3%)

Query: 38  QKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVP 97
           ++++  +  E ++L+G+H V  AL NP+R+  +L+ TKNAL +L+ DA        + V 
Sbjct: 15  ERAKRAAASETVWLFGLHAVRDALLNPAREKLRLVLTKNALDKLE-DAVAACGMAPEVVE 73

Query: 98  PQTIDKIVGKEAVHQGLALETAPL----LSPTLDAVRNSQLLMVLDHVNDPHNIGAILRS 153
           P+  D  + + +VHQG AL+  PL    L+    +   + L+++LD V DPHN+GA+LRS
Sbjct: 74  PRQFDVPIDEGSVHQGAALQVRPLNWGKLADVCISGTGAPLVVLLDRVTDPHNVGAVLRS 133

Query: 154 AVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLS 213
           A  F    +I   R+S  E+  LAK+ASGALE  PY+R+ NL DA+Q++ + G+  +GL 
Sbjct: 134 AEVFGARAVIAPARHSAPETGALAKTASGALERQPYLRVVNLADAMQELQAMGYVLLGLD 193

Query: 214 SDSKKPLEQ---EIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSN 267
            +++  L Q   E     I L+LGAEG GLR +T+ET   +  +   G   +LNVSN
Sbjct: 194 GEAEVTLAQAVAEAGTRPIGLVLGAEGPGLRDRTRETCDRLVRIPAQGGFGSLNVSN 250


>gi|148555341|ref|YP_001262923.1| RNA methyltransferase [Sphingomonas wittichii RW1]
 gi|148500531|gb|ABQ68785.1| RNA methyltransferase, TrmH family, group 3 [Sphingomonas wittichii
           RW1]
          Length = 247

 Score =  169 bits (427), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 96/237 (40%), Positives = 141/237 (59%), Gaps = 11/237 (4%)

Query: 38  QKSRHTSQPEN--LFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKT 95
           +K    SQP       +G H V AAL NP R + +L  T+ A++ L+    LP   PV  
Sbjct: 2   RKGHRPSQPAQGRPRFWGRHAVIAALANPDRTVKRLWGTREAVSALE----LPPVIPVTY 57

Query: 96  VPPQTIDKIVGKEAVHQGLALETAPL----LSPTLDAVRNSQL-LMVLDHVNDPHNIGAI 150
                + ++V  +A HQGL +E  PL    L   L+A +  +  L+VLD V DPHN+GA+
Sbjct: 58  ADAADLGRLVPHDAPHQGLVIEVDPLPDIWLGDLLEAAQGDRRPLVVLDQVTDPHNVGAV 117

Query: 151 LRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTI 210
           LRSA AF   GI+T  R++P ES  LA+SASGALE +P++R+ NL  AL ++   GF  I
Sbjct: 118 LRSAAAFDAVGIVTQDRHAPPESGALARSASGALELVPWVRVVNLARALDEIAEAGFWRI 177

Query: 211 GLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSN 267
           GLS  ++  L Q + + +IA++LGAEG+G+R  T+     +A L +   +++LN+SN
Sbjct: 178 GLSGHARGTLAQVMGDSRIAIVLGAEGEGMRQNTEAHCDELAKLPISPKVESLNISN 234


>gi|326385529|ref|ZP_08207168.1| RNA methyltransferase TrmH, group 3 [Novosphingobium
           nitrogenifigens DSM 19370]
 gi|326210068|gb|EGD60846.1| RNA methyltransferase TrmH, group 3 [Novosphingobium
           nitrogenifigens DSM 19370]
          Length = 304

 Score =  168 bits (426), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 90/222 (40%), Positives = 133/222 (59%), Gaps = 5/222 (2%)

Query: 51  LYGVHTVSAALNNPSRKIFQLLATKNALARL--DWDANLPHPFPVKTVPPQTIDKIVGKE 108
           L+G H V AAL NP+R   +L  T+ A+  +  D +A LP   PV+      + ++V ++
Sbjct: 49  LWGRHAVEAALTNPARTAKKLWGTREAIQAMLDDHEAELPSSLPVEYAQAADLARLVARD 108

Query: 109 AVHQGLALETAPLLSPTLDAVRN---SQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITT 165
           A HQGL L+ +PL    LD V +    + L++LD V DPHN+GAILR+  AF    +IT 
Sbjct: 109 APHQGLVLDCSPLEDIALDEVLDEAEGRTLVILDQVTDPHNVGAILRTCAAFDVAAMITQ 168

Query: 166 KRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIK 225
            R++P ES  LAK+ASGALE +P++R+ NL+ AL+ +   G+  I L  + K      + 
Sbjct: 169 DRHAPPESGTLAKAASGALEVVPWVRVVNLSRALESIAEAGYWRIALDGEGKAEFPSALP 228

Query: 226 NDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSN 267
              +AL+LGAEG+GLR    +   S+A L +   I++LNVSN
Sbjct: 229 TGPVALVLGAEGEGLRHNVLQHCDSVARLPISRAIESLNVSN 270


>gi|255263708|ref|ZP_05343050.1| RNA methyltransferase, TrmH family, group 3 [Thalassiobium sp.
           R2A62]
 gi|255106043|gb|EET48717.1| RNA methyltransferase, TrmH family, group 3 [Thalassiobium sp.
           R2A62]
          Length = 260

 Score =  168 bits (426), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 95/249 (38%), Positives = 145/249 (58%), Gaps = 9/249 (3%)

Query: 38  QKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVP 97
           ++S+  +  E ++L+G+H V  AL NP R   +L+ TKNA  +L  D       P +   
Sbjct: 11  ERSKRAAAAETVWLFGLHAVRDALLNPKRVKLRLIVTKNAHDKLAEDIGASGMEP-EMSD 69

Query: 98  PQTIDKIVGKEAVHQGLALETAPLLSPTLDAV-----RNSQLLMVLDHVNDPHNIGAILR 152
           P+     +  ++VHQG ALE   L    L+ V       +  +++LD V DPHN+GA+LR
Sbjct: 70  PRKFAAPIDPQSVHQGAALEVKGLDWGKLEDVCLGEEGRAPRVVLLDRVTDPHNVGAVLR 129

Query: 153 SAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGL 212
           SA  F    ++   R++  E+  LAK+ASGALE  PY+R+ NL DA++ +   G+  +GL
Sbjct: 130 SAEVFGASAVVAMSRHAAPETGALAKTASGALERQPYVRVRNLADAMETLKGMGYIVLGL 189

Query: 213 SSDSKKPLEQ--EIKNDK-IALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAA 269
             +++  +    E K D+ +AL+LGAEG GLR KT+ET  ++  +   G   +LNVSNAA
Sbjct: 190 DGEAEGTIGAALEGKRDRPVALVLGAEGPGLREKTKETCDALVKIDFAGGFGSLNVSNAA 249

Query: 270 AVALYITQN 278
           AVALY ++ 
Sbjct: 250 AVALYASRE 258


>gi|85373568|ref|YP_457630.1| rRNA methylase [Erythrobacter litoralis HTCC2594]
 gi|84786651|gb|ABC62833.1| rRNA methylase [Erythrobacter litoralis HTCC2594]
          Length = 262

 Score =  168 bits (425), Expect = 9e-40,   Method: Compositional matrix adjust.
 Identities = 97/237 (40%), Positives = 143/237 (60%), Gaps = 5/237 (2%)

Query: 32  KMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPF 91
           +MQ      R T  P ++ L+G H V AAL NP+R   +L AT+  +A LD    LP  F
Sbjct: 16  RMQGGRGSGRAT--PGHVRLWGRHAVEAALLNPARVHRKLWATREGVASLD--GELPPDF 71

Query: 92  PVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAV-RNSQLLMVLDHVNDPHNIGAI 150
           PV+      + ++V ++A HQGL LE   L    +D V    + +++LD V DPHN+GAI
Sbjct: 72  PVEYADVTDLARLVARDAPHQGLVLECEQLKDVYIDDVLEEGRPVVILDQVTDPHNVGAI 131

Query: 151 LRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTI 210
           LRSA AF    I+T  R++P ES V+AKSASGALE +P++R+ NL  AL  +   G+  I
Sbjct: 132 LRSAAAFDAAAIVTQDRHAPPESGVVAKSASGALETVPWVRVVNLARALDTLAERGYWRI 191

Query: 211 GLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSN 267
           GL+ +++  L + +    +AL+LGAEG+G+R   +    ++A L +   I++LNVSN
Sbjct: 192 GLTGNTEATLAEALPAGPVALVLGAEGEGMRHNIEAHCDALARLPISNAIESLNVSN 248


>gi|126740104|ref|ZP_01755794.1| RNA methyltransferase, TrmH family, group 3 [Roseobacter sp.
           SK209-2-6]
 gi|126718923|gb|EBA15635.1| RNA methyltransferase, TrmH family, group 3 [Roseobacter sp.
           SK209-2-6]
          Length = 262

 Score =  166 bits (421), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 94/237 (39%), Positives = 146/237 (61%), Gaps = 7/237 (2%)

Query: 47  ENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVG 106
           +N++L+G+H V  AL NP+R+  +L+ T NA  +L+ DA        + V P+  +  + 
Sbjct: 24  DNVWLFGLHAVRDALMNPNREKLRLIVTLNAQNKLE-DAIAAAGITPEVVDPRRFNAPLD 82

Query: 107 KEAVHQGLALETAPLLSPTL-DAVRNSQL--LMVLDHVNDPHNIGAILRSAVAFSCDGII 163
             +VHQG ALE  PL   +L +    +++  +++LD V DPHN+GAILRSA       +I
Sbjct: 83  PNSVHQGAALEVKPLNWGSLAENCIGAEVPRVILLDRVTDPHNVGAILRSAEVLGASAVI 142

Query: 164 TTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQE 223
            T+ +S  E+  LAK+ASGALE  PY+R+ NL D + ++ + GF  +GL  +++  +E  
Sbjct: 143 GTRHHSAPETGALAKTASGALERQPYLRMRNLADTITELQNMGFVVLGLDGEAEDTIESC 202

Query: 224 IKNDK---IALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQ 277
           ++  K   +AL+LGAEG GLR KT+ET   +  +   G   +LNVSNAAA+ALY ++
Sbjct: 203 LQGRKDLPVALVLGAEGPGLRQKTKETVDHLVKIDASGGFGSLNVSNAAAIALYASK 259


>gi|83942841|ref|ZP_00955302.1| RNA methyltransferase, TrmH family protein, group 3 [Sulfitobacter
           sp. EE-36]
 gi|83846934|gb|EAP84810.1| RNA methyltransferase, TrmH family protein, group 3 [Sulfitobacter
           sp. EE-36]
          Length = 258

 Score =  166 bits (421), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 92/248 (37%), Positives = 147/248 (59%), Gaps = 7/248 (2%)

Query: 38  QKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVP 97
           ++ +     + ++L+G+H V  AL NP+R+  +L+ T NA  +L+ +A        + V 
Sbjct: 11  EQEKKADANQTVWLFGLHAVRDALENPAREKIKLMVTPNAQIKLE-EAIARAGIEPEVVD 69

Query: 98  PQTIDKIVGKEAVHQGLALETAPLLSPTLDAV---RNSQLLMVLDHVNDPHNIGAILRSA 154
           P+     +   +VHQG  LE  PL    L  V     +  +++LD V DPHN+GAILRSA
Sbjct: 70  PRKFRPPLDPGSVHQGAVLEVKPLSWGALKDVCIGAEAPRVLLLDRVTDPHNVGAILRSA 129

Query: 155 VAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSS 214
                  ++  + ++  E+  LAK+ASGALE  PY+R+ NL DA++++ S G+  +GL  
Sbjct: 130 EVLGASAVVGMRHHAAPETGALAKTASGALERQPYLRVRNLADAIKELQSMGYLVLGLDG 189

Query: 215 DSKKPLEQEI--KNDK-IALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAV 271
           ++   +E  +  K D+ +AL+LGAEG GLR KT+ET  ++  +   G   +LNVSNAAA+
Sbjct: 190 EADMTVESALVGKRDRPVALVLGAEGPGLREKTKETVDALVRIDAGGGFGSLNVSNAAAI 249

Query: 272 ALYITQNH 279
           ALY +++H
Sbjct: 250 ALYASRDH 257


>gi|56696046|ref|YP_166400.1| RNA methyltransferase [Ruegeria pomeroyi DSS-3]
 gi|56677783|gb|AAV94449.1| RNA methyltransferase, TrmH family, group 3 [Ruegeria pomeroyi
           DSS-3]
          Length = 257

 Score =  165 bits (418), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 95/254 (37%), Positives = 145/254 (57%), Gaps = 19/254 (7%)

Query: 38  QKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVP 97
           ++++  S  E ++L+G+H V  AL NP R+  +L+ T NA  +L              + 
Sbjct: 11  EQAKKASAAETVWLFGLHAVRDALMNPKREKLRLIVTLNAREKL------AEAIDAAGIE 64

Query: 98  PQTIDKI-----VGKEAVHQGLALETAPL----LSPTLDAVRNSQLLMVLDHVNDPHNIG 148
           P+  D       +   +VHQG ALE  PL    L+       N ++++ LD V DPHN+G
Sbjct: 65  PELADARRFSAPIDPGSVHQGAALEVKPLNWGSLAEVAIGAENPRVIL-LDRVTDPHNVG 123

Query: 149 AILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQ 208
           AILRSA       +I T+ +S  E+  LAK+ASGALE  PY+R+ NL DA+ ++   G+ 
Sbjct: 124 AILRSAEVLGASAVIGTRHHSAPETGALAKTASGALERQPYLRMRNLADAITELQGMGYL 183

Query: 209 TIGLSSDSKKPLEQEI--KNDK-IALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNV 265
            +GL  ++ + +E  +  + D+ +AL+LGAEG GLR KT+ET   +  +   G   +LNV
Sbjct: 184 VLGLDGEASETIEAALAGQTDRPVALVLGAEGPGLRQKTKETVDKLVKIDAAGGFGSLNV 243

Query: 266 SNAAAVALYITQNH 279
           SNAAA+ALY ++ H
Sbjct: 244 SNAAAIALYASKAH 257


>gi|332557678|ref|ZP_08412000.1| RNA methyltransferase [Rhodobacter sphaeroides WS8N]
 gi|332275390|gb|EGJ20705.1| RNA methyltransferase [Rhodobacter sphaeroides WS8N]
          Length = 261

 Score =  165 bits (418), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 93/237 (39%), Positives = 139/237 (58%), Gaps = 8/237 (3%)

Query: 38  QKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVP 97
           ++SR  +  E ++L+G+H V  AL NP R+  +L+ TKNA  RL  DA        + V 
Sbjct: 14  ERSRRAAAQETVWLFGIHAVRDALANPLRQKLRLVLTKNAADRLG-DAIAESGLEPEIVD 72

Query: 98  PQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQ----LLMVLDHVNDPHNIGAILRS 153
           P+     + + +VHQG ALE  PL   +L+ +  S     LL++LD V DPHN+GA+LRS
Sbjct: 73  PRKFSVPIDEGSVHQGAALEVKPLDWGSLEDLAASGAGQPLLVLLDRVTDPHNVGAVLRS 132

Query: 154 AVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLS 213
           A  F    +I   R+S  E+  LAK+ASGALE  PY+R+ NL + ++K+ + G+  +GL 
Sbjct: 133 AEVFGARAVIAPHRHSAPETGALAKTASGALERQPYLRVGNLGETMEKLKAMGYILVGLE 192

Query: 214 SDSKKPLEQEIKNDK---IALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSN 267
            ++   L + ++      +AL+LGAEG GLR KT+ET   +  +   G   +LNVSN
Sbjct: 193 GEAAMTLAEGLEGTAGRPVALVLGAEGPGLREKTRETCDRLVRIPAAGEFGSLNVSN 249


>gi|86137721|ref|ZP_01056297.1| RNA methyltransferase, TrmH family, group 3 [Roseobacter sp.
           MED193]
 gi|85825313|gb|EAQ45512.1| RNA methyltransferase, TrmH family, group 3 [Roseobacter sp.
           MED193]
          Length = 263

 Score =  165 bits (418), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 93/244 (38%), Positives = 145/244 (59%), Gaps = 9/244 (3%)

Query: 38  QKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVP 97
           ++++     E ++L+G+H V  AL NP R+  +L+ T NA  +L+ +A        + V 
Sbjct: 16  EQNKKAGGAETVWLFGLHAVRDALMNPQREKLRLIVTLNAQNKLE-EAIAASGVEPELVE 74

Query: 98  PQTIDKIVGKEAVHQGLALETAPL----LSPTLDAVRNSQLLMVLDHVNDPHNIGAILRS 153
           P+  +  +   +VHQG ALE  PL    LS         ++++ LD V DPHN+GAILRS
Sbjct: 75  PRKFNAPLDPNSVHQGAALEVKPLNWGSLSENCIGAEIPRVIL-LDRVTDPHNVGAILRS 133

Query: 154 AVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLS 213
           A  F    +I T+ +S  E+  LAK+ASGALE  PY+R+ NL D + ++ + G+  +GL 
Sbjct: 134 AEVFGASAVIGTRHHSAPETGALAKTASGALERQPYLRMRNLADTITELQNMGYVVLGLD 193

Query: 214 SDSKKPLEQEIKNDK---IALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAA 270
            ++++ +E  ++  +   +AL+LGAEG GLR KT+ET   +  +   G   +LNVSNAAA
Sbjct: 194 GEAEQTIESCLEGRRDLPVALVLGAEGPGLRQKTKETVDHLVKIDAAGGFGSLNVSNAAA 253

Query: 271 VALY 274
           +ALY
Sbjct: 254 IALY 257


>gi|89069652|ref|ZP_01156989.1| tRNA/rRNA metyltransferase [Oceanicola granulosus HTCC2516]
 gi|89044732|gb|EAR50838.1| tRNA/rRNA metyltransferase [Oceanicola granulosus HTCC2516]
          Length = 259

 Score =  165 bits (418), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 99/239 (41%), Positives = 143/239 (59%), Gaps = 9/239 (3%)

Query: 48  NLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGK 107
            L+L+G+H V  AL NP R   +L+ TKNAL RL  DA        +   P+     +  
Sbjct: 21  TLWLFGLHAVRDALENPRRDKRRLVVTKNALDRLG-DAVGQAGLEPEISDPRKFAAPLDP 79

Query: 108 EAVHQGLALETAPLLSPTLDAV--RNSQL---LMVLDHVNDPHNIGAILRSAVAFSCDGI 162
            +VHQG ALE  PL   +L  V    S L   +++LD V+DPHN+GAILRSA  F    +
Sbjct: 80  GSVHQGAALEVRPLDWGSLADVCTAGSDLPPRVVLLDRVSDPHNVGAILRSAEVFGARAV 139

Query: 163 ITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSK---KP 219
           I  +R+S  E+  LAK+ASGALE  PY+R++NL  A++++   G+   GL+ +++   +P
Sbjct: 140 IGVQRHSAPETGALAKAASGALERQPYLRVTNLARAMEELKDMGYLVAGLAGEAETDIRP 199

Query: 220 LEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQN 278
                ++  +AL+LGAEG GLR KT+ET   +  +   G   +LNVSNAAAVALY +++
Sbjct: 200 ALDGHRDRPVALVLGAEGPGLRDKTRETCDVLVRIDAAGGFGSLNVSNAAAVALYASRS 258


>gi|182678319|ref|YP_001832465.1| RNA methyltransferase [Beijerinckia indica subsp. indica ATCC 9039]
 gi|182634202|gb|ACB94976.1| RNA methyltransferase, TrmH family, group 3 [Beijerinckia indica
           subsp. indica ATCC 9039]
          Length = 293

 Score =  165 bits (418), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 95/243 (39%), Positives = 137/243 (56%), Gaps = 2/243 (0%)

Query: 34  QSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPV 93
           Q  N      S P+ + L+G H V  AL +  R    L AT+ A  +L  D+      P 
Sbjct: 48  QEKNPSPFRQSSPDVILLHGFHAVREALRSDQRTCLALYATEAAAEKLAPDSKAAGLAP- 106

Query: 94  KTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAV-RNSQLLMVLDHVNDPHNIGAILR 152
             V  + + + +G + VHQG+ LE  PL    +  +   S +++VLD + DPHN+GAI+R
Sbjct: 107 HIVTAEDLSRRLGSQTVHQGVLLEARPLEPLDITEIPTRSGVVLVLDQITDPHNVGAIVR 166

Query: 153 SAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGL 212
           +A AF  D I+TT+R++P+   VLAK+ASG LEH+  + + NL  AL+ +    +  +GL
Sbjct: 167 TAAAFDVDAIVTTERHAPALGGVLAKAASGGLEHVQIVPVVNLARALETLGRLNYLRVGL 226

Query: 213 SSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVA 272
            S ++    Q      IAL+LG EG GLR  T+E    +A L MPG IK+LNVSNA AV 
Sbjct: 227 DSAAEADFTQLPLQRPIALVLGGEGTGLRRLTREKCDFLARLDMPGKIKSLNVSNACAVV 286

Query: 273 LYI 275
           L +
Sbjct: 287 LTL 289


>gi|114771679|ref|ZP_01449083.1| RNA methyltransferase, TrmH family, group 3 [alpha proteobacterium
           HTCC2255]
 gi|114547751|gb|EAU50641.1| RNA methyltransferase, TrmH family, group 3 [alpha proteobacterium
           HTCC2255]
          Length = 264

 Score =  164 bits (416), Expect = 9e-39,   Method: Compositional matrix adjust.
 Identities = 100/261 (38%), Positives = 150/261 (57%), Gaps = 13/261 (4%)

Query: 28  RDYKKMQSFNQKSRHTS--QPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDA 85
           R  KK     +K R  S    + ++L+G+H V  AL NP R+  +L+ TKNA  +L   +
Sbjct: 4   RSKKKPLWIVEKERQKSAGSADTVWLFGLHAVRDALENPLRERIRLMVTKNASDKLS-SS 62

Query: 86  NLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPL----LSPTLDAVRNSQ--LLMVLD 139
            +      + + P+  +  +  ++VHQG ALE  PL    +S T+ A RN +   L++LD
Sbjct: 63  IITSGIDAEIIDPRKFNPPIDPQSVHQGAALEVMPLDWGNMS-TVCAPRNDKKARLVILD 121

Query: 140 HVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDAL 199
            V DPHN+GAILRSA  F    +I T R S  E+  LAK+ASGALE  PY+R+ NL  ++
Sbjct: 122 RVTDPHNVGAILRSAEVFGARAVIATARNSAPETGALAKTASGALERQPYLRVRNLATSI 181

Query: 200 QKMHSWGFQTIGLSSDSKKPLEQ--EI-KNDKIALILGAEGKGLRPKTQETATSMAHLHM 256
           + +   G+  +GL   +K  ++   E+ +N  +A++LGAEG GLR  T++T   +  +  
Sbjct: 182 KSLQEMGYYVVGLDGTAKNSIDDIAELHQNSPLAIVLGAEGPGLRELTKQTCDELVKIDY 241

Query: 257 PGIIKALNVSNAAAVALYITQ 277
                +LNVSNA AVALY T+
Sbjct: 242 AATFGSLNVSNATAVALYATK 262


>gi|126729168|ref|ZP_01744982.1| RNA methyltransferase, TrmH family, group 3 [Sagittula stellata
           E-37]
 gi|126710158|gb|EBA09210.1| RNA methyltransferase, TrmH family, group 3 [Sagittula stellata
           E-37]
          Length = 274

 Score =  164 bits (416), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 96/247 (38%), Positives = 141/247 (57%), Gaps = 8/247 (3%)

Query: 38  QKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVP 97
           ++++  S  E ++L+G H V  AL NP R   +L+ T NA  +L  DA        +   
Sbjct: 28  EQAKRASAAETVWLFGHHAVRDALLNPRRVKLRLILTPNAAEKLG-DAVAEAGMEPEISD 86

Query: 98  PQTIDKIVGKEAVHQGLALETAPLLSPTLDAV----RNSQLLMVLDHVNDPHNIGAILRS 153
           P+     +  ++VHQG ALE  PL    L+ V      +  L++LD V DPHN+GAILRS
Sbjct: 87  PRRFAAPLDPQSVHQGAALEVKPLDWGKLEDVALSGEGALRLVLLDRVTDPHNVGAILRS 146

Query: 154 AVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLS 213
           A  F    +I T+ ++  E+  LAK+ASGALE  PY+R  NL D +  +   G+  +GL 
Sbjct: 147 AEVFGAQAVIGTRHHAAPETGALAKTASGALERQPYLRERNLADTITALQGIGYIVLGLD 206

Query: 214 SDSKKPLEQEIKNDK---IALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAA 270
            +++  +E  ++  +   IAL+LGAEG GLRPKT+ET  ++  +       +LNVSNAAA
Sbjct: 207 GEAETTIEDAVEGKRDRPIALVLGAEGPGLRPKTRETVDALVKIPFAREFGSLNVSNAAA 266

Query: 271 VALYITQ 277
           VALY  +
Sbjct: 267 VALYAVR 273


>gi|84687814|ref|ZP_01015684.1| tRNA/rRNA metyltransferase [Maritimibacter alkaliphilus HTCC2654]
 gi|84664186|gb|EAQ10680.1| tRNA/rRNA metyltransferase [Rhodobacterales bacterium HTCC2654]
          Length = 267

 Score =  164 bits (415), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 97/254 (38%), Positives = 141/254 (55%), Gaps = 27/254 (10%)

Query: 38  QKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARL---------DWDANLP 88
           +KS+  +  E ++L+G+H V  AL NP R   +L+ TKNA  +L         + +   P
Sbjct: 12  EKSKRAAAAETVWLFGLHAVRDALVNPRRDKLRLVVTKNAADKLADAIATGGIEPEVADP 71

Query: 89  HPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQ-----LLMVLDHVND 143
             FPV   P           +VHQG ALE  PL    L+ V         ++++LD V D
Sbjct: 72  RKFPVPLDP----------GSVHQGAALEVKPLDWGRLEEVCMGDGDRPPVVVLLDRVTD 121

Query: 144 PHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMH 203
           PHN+GAILRSA  F    +I TK +S  E+  LAK+ASGALE  PY+R++NL DA+  + 
Sbjct: 122 PHNVGAILRSAEVFGARAVIGTKHHSAPETGALAKTASGALERQPYLRVTNLADAMGTLK 181

Query: 204 SWGFQTIGLSSDSKKPLEQE---IKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGII 260
             G+  +GL+ ++   +      +    +AL++GAEG GLR KT+ET  ++  +      
Sbjct: 182 DMGYTVLGLAGEADDDIADALSPLSGHAVALVMGAEGPGLRQKTRETCDALVKIPFAAEF 241

Query: 261 KALNVSNAAAVALY 274
            +LNVSNAAAV+LY
Sbjct: 242 GSLNVSNAAAVSLY 255


>gi|254486509|ref|ZP_05099714.1| RNA methyltransferase, TrmH family, group 3 [Roseobacter sp.
           GAI101]
 gi|214043378|gb|EEB84016.1| RNA methyltransferase, TrmH family, group 3 [Roseobacter sp.
           GAI101]
          Length = 264

 Score =  164 bits (415), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 93/248 (37%), Positives = 147/248 (59%), Gaps = 7/248 (2%)

Query: 38  QKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVP 97
           ++ +     + ++L+G+H V  AL NP+R+  +L+ T NA  +L+         P + V 
Sbjct: 17  EQEKKVEANQTVWLFGLHAVRDALENPAREKLRLMVTPNAQIKLEAAIAQAGITP-EVVD 75

Query: 98  PQTIDKIVGKEAVHQGLALETAPLLSPTLDAV---RNSQLLMVLDHVNDPHNIGAILRSA 154
           P+     + + +VHQG  LE  PL   +L  V     +  +++LD V DPHN+GAILRSA
Sbjct: 76  PRKFRPPLDQGSVHQGAVLEVKPLSWGSLAEVCIGAEAPRVLLLDRVTDPHNVGAILRSA 135

Query: 155 VAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSS 214
                  +I  + ++  E+  LAKSASGALE  PY+R+ NL D+++++ + G+  +GL  
Sbjct: 136 EVLGASAVIGMRHHAAPETGSLAKSASGALERQPYLRVRNLADSIKELQNMGYLVLGLDG 195

Query: 215 DSKKPLEQ--EIKNDK-IALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAV 271
           +++  +E   E K D+ +AL+LGAEG GLR KT+ET   +  +   G   +LNVSNAAA+
Sbjct: 196 EAEITVEAALEGKRDRPVALVLGAEGPGLREKTKETVDVLVRIDAEGGFGSLNVSNAAAI 255

Query: 272 ALYITQNH 279
           ALY ++ H
Sbjct: 256 ALYASRPH 263


>gi|77462791|ref|YP_352295.1| tRNA/rRNA metyltransferase [Rhodobacter sphaeroides 2.4.1]
 gi|77387209|gb|ABA78394.1| tRNA/rRNA metyltransferase [Rhodobacter sphaeroides 2.4.1]
          Length = 261

 Score =  164 bits (414), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 92/237 (38%), Positives = 139/237 (58%), Gaps = 8/237 (3%)

Query: 38  QKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVP 97
           ++SR  +  E ++L+G+H V  AL NP R+  +L+ TKNA  RL  +A        + V 
Sbjct: 14  ERSRRAAAQETVWLFGIHAVRDALANPLRQKLRLVLTKNAADRLG-EAIAESGLEPEIVD 72

Query: 98  PQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQ----LLMVLDHVNDPHNIGAILRS 153
           P+     + + +VHQG ALE  PL   +L+ +  S     LL++LD V DPHN+GA+LRS
Sbjct: 73  PRKFSVPIDEGSVHQGAALEVKPLDWGSLEDLAASGAGQPLLVLLDRVTDPHNVGAVLRS 132

Query: 154 AVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLS 213
           A  F    +I   R+S  E+  LAK+ASGALE  PY+R+ NL + ++K+ + G+  +GL 
Sbjct: 133 AEVFGARAVIAPHRHSAPETGALAKTASGALERQPYLRVGNLGETMEKLKAMGYILVGLE 192

Query: 214 SDSKKPLEQEIKNDK---IALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSN 267
            ++   L + ++      +AL+LGAEG GLR KT+ET   +  +   G   +LNVSN
Sbjct: 193 GEASMTLAEGLEGTAGRPVALVLGAEGPGLREKTRETCDRLVRIPAAGGFGSLNVSN 249


>gi|221638657|ref|YP_002524919.1| RNA methyltransferase, TrmH family, group 3 [Rhodobacter
           sphaeroides KD131]
 gi|221159438|gb|ACM00418.1| RNA methyltransferase, TrmH family, group 3 [Rhodobacter
           sphaeroides KD131]
          Length = 261

 Score =  164 bits (414), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 92/237 (38%), Positives = 139/237 (58%), Gaps = 8/237 (3%)

Query: 38  QKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVP 97
           ++SR  +  E ++L+G+H V  AL NP R+  +L+ TKNA  RL  +A        + V 
Sbjct: 14  ERSRRAAAQETVWLFGIHAVRDALANPLRQKLRLVLTKNAADRLG-EAIAESGLEPEIVD 72

Query: 98  PQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQ----LLMVLDHVNDPHNIGAILRS 153
           P+     + + +VHQG ALE  PL   +L+ +  S     LL++LD V DPHN+GA+LRS
Sbjct: 73  PRKFSVPIDEGSVHQGAALEVKPLDWGSLEDLAASGAGQPLLVLLDRVTDPHNVGAVLRS 132

Query: 154 AVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLS 213
           A  F    +I   R+S  E+  LAK+ASGALE  PY+R+ NL + ++K+ + G+  +GL 
Sbjct: 133 AEVFGARAVIAPHRHSAPETGALAKTASGALERQPYLRVGNLGETMEKLKAMGYILVGLE 192

Query: 214 SDSKKPLEQEIKNDK---IALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSN 267
            ++   L + ++      +AL+LGAEG GLR KT+ET   +  +   G   +LNVSN
Sbjct: 193 GEAAMTLAEGLQGTAGRPVALVLGAEGPGLREKTRETCDRLVRIPAAGGFGSLNVSN 249


>gi|89055292|ref|YP_510743.1| RNA methyltransferase TrmH, group 3 [Jannaschia sp. CCS1]
 gi|88864841|gb|ABD55718.1| RNA methyltransferase TrmH group 3 [Jannaschia sp. CCS1]
          Length = 260

 Score =  164 bits (414), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 92/245 (37%), Positives = 139/245 (56%), Gaps = 9/245 (3%)

Query: 38  QKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVP 97
           ++ +  +  E ++L+G+H V  AL NP R++ +L+ + NA  +L  DA        +   
Sbjct: 12  ERGKRAAAAETIWLFGLHAVRDALANPDRQVLRLVVSLNAQTKLA-DAIAARGLEAEIAD 70

Query: 98  PQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQ-----LLMVLDHVNDPHNIGAILR 152
           P+     +   +VHQG A+E  PL      A+         ++++LD V+DPHN+GAILR
Sbjct: 71  PRKFPVPLDPGSVHQGAAVEVKPLDWGDWRALARGDGAERSVVVLLDRVSDPHNVGAILR 130

Query: 153 SAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGL 212
           SA  F    +I   R+S  E+  LAK+ASGALE +PY RI NL DA++ + + GF  +GL
Sbjct: 131 SAEVFGARAVIAPARHSAPETGALAKTASGALERMPYARIGNLGDAMEALKADGFWMVGL 190

Query: 213 SSDSKKPLEQEIK---NDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAA 269
           + +   P++       +  IAL+LGAEG GLR +T+     +A +       +LNVSNAA
Sbjct: 191 AEEGAAPIDAVAARHTDSNIALVLGAEGPGLRERTRGLCDELAKIPFARDFGSLNVSNAA 250

Query: 270 AVALY 274
           AVALY
Sbjct: 251 AVALY 255


>gi|126461683|ref|YP_001042797.1| RNA methyltransferase [Rhodobacter sphaeroides ATCC 17029]
 gi|126103347|gb|ABN76025.1| RNA methyltransferase, TrmH family, group 3 [Rhodobacter
           sphaeroides ATCC 17029]
          Length = 261

 Score =  164 bits (414), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 92/237 (38%), Positives = 139/237 (58%), Gaps = 8/237 (3%)

Query: 38  QKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVP 97
           ++SR  +  E ++L+G+H V  AL NP R+  +L+ TKNA  RL  +A        + V 
Sbjct: 14  ERSRRAAAQETVWLFGIHAVRDALANPLRQKLRLVLTKNAADRLG-EAIAESGLEPEIVD 72

Query: 98  PQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQ----LLMVLDHVNDPHNIGAILRS 153
           P+     + + +VHQG ALE  PL   +L+ +  S     LL++LD V DPHN+GA+LRS
Sbjct: 73  PRKFSVPIDEGSVHQGAALEVKPLDWGSLEDLAASGAGQPLLVLLDRVTDPHNVGAVLRS 132

Query: 154 AVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLS 213
           A  F    +I   R+S  E+  LAK+ASGALE  PY+R+ NL + ++K+ + G+  +GL 
Sbjct: 133 AEVFGARAVIAPHRHSAPETGALAKTASGALERQPYLRVGNLGETMEKLKAMGYILVGLE 192

Query: 214 SDSKKPLEQEIKNDK---IALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSN 267
            ++   L + ++      +AL+LGAEG GLR KT+ET   +  +   G   +LNVSN
Sbjct: 193 GEAAMTLAEGLEGTAGRPVALVLGAEGPGLREKTRETCDRLVRIPAAGGFGSLNVSN 249


>gi|217976553|ref|YP_002360700.1| RNA methyltransferase, TrmH family, group 3 [Methylocella
           silvestris BL2]
 gi|217501929|gb|ACK49338.1| RNA methyltransferase, TrmH family, group 3 [Methylocella
           silvestris BL2]
          Length = 293

 Score =  163 bits (413), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 90/219 (41%), Positives = 129/219 (58%), Gaps = 2/219 (0%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEA 109
            LYG H V  AL    RK+F + AT+ A  +L  +         + V  + + + +G  A
Sbjct: 61  VLYGFHAVREALRAGKRKMFDIYATEAAAQKLAPEIAAAG-LTARLVAAEDLSRRLGPAA 119

Query: 110 VHQGLALETAPLLSPTL-DAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRY 168
           VHQG+ LE  P  +  + D    S +++VLD + DPHN+GAI R+A AF  D ++ T+R+
Sbjct: 120 VHQGVMLEARPFEALDISDIAPESGVVLVLDQITDPHNVGAIARTAAAFRVDALVMTERH 179

Query: 169 SPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDK 228
           +P  + VLAK+ASG LEH+P I + NL  AL+ +   G+  +GL S+ +  L     +  
Sbjct: 180 APELTGVLAKAASGGLEHVPIIHVVNLARALRALKDQGYLRVGLDSEGESTLTDAPLSRP 239

Query: 229 IALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSN 267
           +ALILG EGKGLR  T+E    +A L MPG IK+LNVSN
Sbjct: 240 LALILGGEGKGLRRLTRENCDLVARLDMPGPIKSLNVSN 278


>gi|304321685|ref|YP_003855328.1| rRNA methylase [Parvularcula bermudensis HTCC2503]
 gi|303300587|gb|ADM10186.1| rRNA methylase [Parvularcula bermudensis HTCC2503]
          Length = 243

 Score =  163 bits (412), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 94/231 (40%), Positives = 132/231 (57%), Gaps = 6/231 (2%)

Query: 47  ENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVG 106
           E L+LYG HTV AAL NP R   +LLAT+NAL    W         +  V P+ IDK + 
Sbjct: 10  EPLWLYGRHTVEAALGNPQRHQVKLLATRNALG---WLKERGRTITIDPVTPKDIDKALP 66

Query: 107 KEAVHQGLALETAPLLSPTL-DAVRNSQL--LMVLDHVNDPHNIGAILRSAVAFSCDGII 163
             AVHQGLA+   PL SP+L + + N +   L+VLD + DP NIGA+ R A AFS   +I
Sbjct: 67  PGAVHQGLAMLANPLPSPSLAEILENGETGPLLVLDQITDPQNIGALFRLAAAFSAKAVI 126

Query: 164 TTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQE 223
              R +P     LAK+A+GA+E +P+I + N++ AL+ +        GL+ +    L   
Sbjct: 127 AQDRRTPPLGGPLAKAATGAVECVPFIPVVNISRALEAIREKHIPIFGLAGEGALSLRDT 186

Query: 224 IKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
                 AL+LGAEGKGLRP  +     +  + +   I++LNV+ AAA++LY
Sbjct: 187 APTRTCALVLGAEGKGLRPGVRAVCDQLVAIPIDPQIESLNVATAAAISLY 237


>gi|330991641|ref|ZP_08315592.1| Putative tRNA/rRNA methyltransferase [Gluconacetobacter sp. SXCC-1]
 gi|329761660|gb|EGG78153.1| Putative tRNA/rRNA methyltransferase [Gluconacetobacter sp. SXCC-1]
          Length = 263

 Score =  162 bits (411), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 102/235 (43%), Positives = 135/235 (57%), Gaps = 5/235 (2%)

Query: 48  NLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQ--TIDKIV 105
             +LYG H V AAL NP+RK+ QLL T  A   L   + L   FP++ V  +   +D + 
Sbjct: 30  TCWLYGQHAVQAALENPARKLRQLLVTAEAQETLA--SRLEGGFPIQPVRTERAALDTLC 87

Query: 106 GKEAVHQGLALETAPLLSPTLDAV-RNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIIT 164
           G +AVHQG+AL    L  P LD V      ++VLD V DP NIGAILRSA AF    ++ 
Sbjct: 88  GPDAVHQGMALLVDVLAQPDLDTVLEQPGPVLVLDQVTDPRNIGAILRSAAAFGAVAVVM 147

Query: 165 TKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEI 224
             R +P E+  LA++ASGALE +P IR+ NL+  L  + S G   +GL +          
Sbjct: 148 QDRNAPEETGTLARAASGALEIVPLIRVVNLSRVLDALKSRGLWVVGLDAGGGVLDGAAF 207

Query: 225 KNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNH 279
              ++AL+LGAEG GLR  T+E    +A L M   +++LNVSNAAAVALY    H
Sbjct: 208 HQRRVALVLGAEGAGLRRLTREHCDEIAGLAMSSRMESLNVSNAAAVALYEMFRH 262


>gi|294010791|ref|YP_003544251.1| RNA methyltransferase [Sphingobium japonicum UT26S]
 gi|292674121|dbj|BAI95639.1| RNA methyltransferase [Sphingobium japonicum UT26S]
          Length = 246

 Score =  162 bits (411), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 93/237 (39%), Positives = 140/237 (59%), Gaps = 11/237 (4%)

Query: 38  QKSRHTSQPENLF--LYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKT 95
           ++   T + +  F   YG H V AAL NP R + ++  T+ AL  LD    LP   P+  
Sbjct: 2   KRGNRTGKAKGTFPRFYGRHAVIAALANPDRVVRKIWGTREALNALD----LPPVLPIVY 57

Query: 96  VPPQTIDKIVGKEAVHQGLALETAPL----LSPTLDAVRNSQL-LMVLDHVNDPHNIGAI 150
                + ++V  +A HQG+  E  PL    L   L+A ++ +  ++VLD V DPHN+GAI
Sbjct: 58  ADGADLGRMVPSDAPHQGIVAEVEPLDDVWLGDVLEAGQDDKRPVLVLDQVTDPHNVGAI 117

Query: 151 LRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTI 210
           LRSA AF    I+T  R++P ES VLA+SASGALE +P++R+ NL  AL ++   G+  I
Sbjct: 118 LRSAAAFDALCIVTQDRHAPPESGVLARSASGALEIVPWVRVVNLARALDEIAEAGYWRI 177

Query: 211 GLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSN 267
           GL  ++++ L + I   ++AL+LGAEG+GLR  +      +A L +   +++LNVSN
Sbjct: 178 GLDGEAEQTLGEAIGTSRVALVLGAEGEGLRHNSMAHCDILAKLPISPRMESLNVSN 234


>gi|84500909|ref|ZP_00999144.1| RNA methyltransferase, TrmH family, group 3 [Oceanicola batsensis
           HTCC2597]
 gi|84390976|gb|EAQ03394.1| RNA methyltransferase, TrmH family, group 3 [Oceanicola batsensis
           HTCC2597]
          Length = 265

 Score =  162 bits (411), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 90/239 (37%), Positives = 140/239 (58%), Gaps = 11/239 (4%)

Query: 38  QKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVP 97
           ++ R  +  E ++L+G+H V  AL NP+R+  +L+ TKNA  +L  DA        +   
Sbjct: 13  ERGRKAAAEETVWLFGLHAVRDALMNPAREKLRLIVTKNAADKLA-DAIAAGGIEPEMAD 71

Query: 98  PQTIDKIVGKEAVHQGLALETAPLLSPTL------DAVRNSQLLMVLDHVNDPHNIGAIL 151
           P+     +  ++VHQG ALE  PL   ++      D VR  ++++ LD V DPHN+GAIL
Sbjct: 72  PRRFTAPLDPQSVHQGAALEVRPLDWGSVAERCLGDGVRPPRVVL-LDRVTDPHNVGAIL 130

Query: 152 RSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIG 211
           RSA  F    +I  + ++  E+  LAK+ASGALE  PY+R+ NL D + ++ S G+  +G
Sbjct: 131 RSAEVFGALAVIGMRHHAAPETGALAKTASGALERQPYLRVRNLADTIVELQSMGYLVLG 190

Query: 212 LSSDSKKPLE---QEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSN 267
           L  ++   LE   + +++  +AL+LGAEG GLRPKT++T   +  +   G   +LNVSN
Sbjct: 191 LDGEAGTELEDAVEGLRDRPVALVLGAEGPGLRPKTRDTCDRLVRIAFAGSFGSLNVSN 249


>gi|84516419|ref|ZP_01003778.1| RNA methyltransferase, TrmH family, group 3 [Loktanella
           vestfoldensis SKA53]
 gi|84509455|gb|EAQ05913.1| RNA methyltransferase, TrmH family, group 3 [Loktanella
           vestfoldensis SKA53]
          Length = 258

 Score =  162 bits (409), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 89/238 (37%), Positives = 143/238 (60%), Gaps = 9/238 (3%)

Query: 38  QKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVP 97
           ++++  +  E ++L+G+H V  AL NP+R+  +L+ T+NAL RL  DA        +   
Sbjct: 11  EQAKRVASQETVWLFGLHAVRDALENPAREKLRLIVTRNALERLG-DAVATGGIEPEISD 69

Query: 98  PQTIDKIVGKEAVHQGLALETAPLLSPTLD--AVRNSQL---LMVLDHVNDPHNIGAILR 152
           P+     +  ++VHQG ALE  PL   +L   A+R   +   +++LD V DPHN+GAILR
Sbjct: 70  PRKFAAPLDPQSVHQGAALEVKPLDWGSLQDVALREGPMPPRIVLLDRVTDPHNVGAILR 129

Query: 153 SAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGL 212
           SA  F    ++  +R++  E+  LAK+ASGALE  PY+R+ NL D++ ++   G+  +GL
Sbjct: 130 SAEVFGARAVVAMQRHAAPETGALAKTASGALERQPYLRVRNLADSIVELQQMGYLVLGL 189

Query: 213 SSDSKKPLEQ--EIKNDK-IALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSN 267
             +++  +E+  E K D+ +AL++GAEG GLR KT+ET   +  +       +LNVSN
Sbjct: 190 DGEAETTIEEAVEGKRDRAVALVMGAEGPGLRDKTRETCDILVRIDASADFGSLNVSN 247


>gi|94495845|ref|ZP_01302424.1| rRNA methylase [Sphingomonas sp. SKA58]
 gi|94424537|gb|EAT09559.1| rRNA methylase [Sphingomonas sp. SKA58]
          Length = 249

 Score =  161 bits (408), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 91/237 (38%), Positives = 140/237 (59%), Gaps = 11/237 (4%)

Query: 38  QKSRHTSQPENLF--LYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKT 95
           +K+  +++P+  F   YG H V+AAL NP+R + ++  T+ AL  LD    LP   P+  
Sbjct: 2   KKTHRSAKPKGAFPRFYGRHAVTAALANPNRTVRKIWGTREALGALD----LPPVLPIVY 57

Query: 96  VPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAV-----RNSQLLMVLDHVNDPHNIGAI 150
                + ++V  +A HQG+  E  PL    L  V      + + ++VLD V DPHN+GAI
Sbjct: 58  SDVADMGRMVPSDAPHQGIVAEVEPLDDVWLGDVLEEGQDDKRPILVLDQVTDPHNVGAI 117

Query: 151 LRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTI 210
           LRSA AF    I+T  R++P ES VLA++ASGALE +P++R+ NL  AL ++   G+  I
Sbjct: 118 LRSAAAFDALCIVTQDRHAPPESGVLARAASGALEIVPWVRVVNLARALDEIAEAGYWRI 177

Query: 211 GLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSN 267
           GL  ++   + + I   ++AL+LGAEG+GLR  +      +A L +   +++LNVSN
Sbjct: 178 GLDGEADTTIGEAIGQSRVALVLGAEGEGLRHNSIAHCDIIAKLPISPRMESLNVSN 234


>gi|307294636|ref|ZP_07574478.1| RNA methyltransferase, TrmH family, group 3 [Sphingobium
           chlorophenolicum L-1]
 gi|306879110|gb|EFN10328.1| RNA methyltransferase, TrmH family, group 3 [Sphingobium
           chlorophenolicum L-1]
          Length = 246

 Score =  161 bits (408), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 93/237 (39%), Positives = 141/237 (59%), Gaps = 11/237 (4%)

Query: 38  QKSRHTSQPENLF--LYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKT 95
           ++   T + +  F   YG H V AAL NP R + ++  T++AL  LD    LP   P+  
Sbjct: 2   KRGNRTGKAKGQFPRFYGRHAVIAALANPDRVVRKIWGTRDALNALD----LPPVLPIVY 57

Query: 96  VPPQTIDKIVGKEAVHQGLALETAPL----LSPTLDAVRNSQL-LMVLDHVNDPHNIGAI 150
                + ++V  +A HQG+  E  PL    L   L+A ++ +  ++VLD V DPHN+GAI
Sbjct: 58  SDVADLGRMVPSDAPHQGIVAEVEPLDDVWLGNVLEAGQDDKRPVLVLDQVTDPHNVGAI 117

Query: 151 LRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTI 210
           LRSA AF    I+T  R++P ES VLA+SASGALE +P++R+ NL  AL ++   G+  I
Sbjct: 118 LRSAAAFDALCIVTQDRHAPPESGVLARSASGALEIVPWVRVVNLARALDEIAEAGYWRI 177

Query: 211 GLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSN 267
           GL  ++++ L + I   ++AL+LGAEG+GLR  +      +A L +   +++LNVSN
Sbjct: 178 GLDGEAEQTLGEAIGTSRVALVLGAEGEGLRHNSMAHCDILAKLPISPRMESLNVSN 234


>gi|209544876|ref|YP_002277105.1| TrmH family RNA methyltransferase [Gluconacetobacter diazotrophicus
           PAl 5]
 gi|209532553|gb|ACI52490.1| RNA methyltransferase, TrmH family, group 3 [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 321

 Score =  161 bits (408), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 96/226 (42%), Positives = 133/226 (58%), Gaps = 1/226 (0%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEA 109
           +LYG+H   AAL NP R+I Q+LAT++  A L    N P P          ++ + G++A
Sbjct: 88  WLYGLHPALAALGNPERRIRQILATEDGEAALRERLNAPLPMQPHRTDRARLESLCGRDA 147

Query: 110 VHQGLALETAPLLSPTL-DAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRY 168
           VHQG+A+    L S  + D       L++LD V DP N+GAILRSA AF    ++  +R 
Sbjct: 148 VHQGIAVLADALPSLAIEDMTGRPGPLLLLDQVTDPRNVGAILRSAAAFGAAAVVVMERN 207

Query: 169 SPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDK 228
           +P E+  LAK+ASGALE +P +R+ NL   L  + S  F  +GL +             +
Sbjct: 208 APDETGALAKAASGALEIVPLVRVVNLARTLDALKSLDFWVVGLDAGGGILDGTSFGQRR 267

Query: 229 IALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
           +AL+LGAEG GLR  T+E    +A L MPG +++LNVSNAAAVALY
Sbjct: 268 VALVLGAEGDGLRRLTREHCDEIAGLAMPGDMESLNVSNAAAVALY 313


>gi|146278291|ref|YP_001168450.1| RNA methyltransferase [Rhodobacter sphaeroides ATCC 17025]
 gi|145556532|gb|ABP71145.1| RNA methyltransferase, TrmH family, group 3 [Rhodobacter
           sphaeroides ATCC 17025]
          Length = 261

 Score =  161 bits (407), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 89/237 (37%), Positives = 140/237 (59%), Gaps = 8/237 (3%)

Query: 38  QKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVP 97
           +++R T+  E ++L+G+H V  AL NPSR+  +L+ TKNA  RL  +A        + V 
Sbjct: 14  ERARRTTAQETVWLFGIHAVRDALINPSREKLRLVLTKNAADRLG-EAVAAGGIEPEIVD 72

Query: 98  PQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQ----LLMVLDHVNDPHNIGAILRS 153
           P+     + + +VHQG ALE  PL   +L+ +  S     L+++LD V DPHN+GA+LRS
Sbjct: 73  PRKFSAPIDEGSVHQGAALEVRPLDWGSLEDLAASGEGEPLVVLLDRVTDPHNVGAVLRS 132

Query: 154 AVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLS 213
           A  F    ++   R+S  E+  LAK+ASGALE  PY+R+ NL + ++++ + G+  +GL 
Sbjct: 133 AEVFGARAVVAPHRHSAPETGALAKTASGALERQPYLRVGNLAETMERLKAIGYMLLGLD 192

Query: 214 SDSKKPLEQEI---KNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSN 267
           S++   L + +       + L+LGAEG GLR KT++T   +  +   G   +LNVSN
Sbjct: 193 SEAPATLAEGLAIAGKRPVGLVLGAEGPGLRDKTRDTCDVLVRIPAAGGFGSLNVSN 249


>gi|103486336|ref|YP_615897.1| RNA methyltransferase TrmH, group 3 [Sphingopyxis alaskensis
           RB2256]
 gi|98976413|gb|ABF52564.1| RNA methyltransferase TrmH, group 3 [Sphingopyxis alaskensis
           RB2256]
          Length = 272

 Score =  160 bits (404), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 94/252 (37%), Positives = 145/252 (57%), Gaps = 19/252 (7%)

Query: 30  YKKMQSFNQKSRH------TSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDW 83
           + K  +  Q SRH        + + +  +G H V AAL NP R + ++  T+ AL +LD 
Sbjct: 12  HGKGAAMRQFSRHRRPSGGNQRGQTVRFWGRHAVLAALANPDRAVRRIWGTREALGQLD- 70

Query: 84  DANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPL--------LSPTLDAVRNSQLL 135
              LP   P+       + ++V ++A HQGL +E  PL        L   +DA  + + L
Sbjct: 71  ---LPPVIPISYADVADLARLVARDAPHQGLVIEVDPLDGVHLGDLLQEEVDA-ESRRPL 126

Query: 136 MVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNL 195
           ++LD V DPHNIGA+LRSA AF    I+T  R+SP ES V+A+SASGALE +P++R+ NL
Sbjct: 127 VILDQVTDPHNIGAVLRSAAAFDAAAIVTQDRHSPPESGVIARSASGALETVPWVRVVNL 186

Query: 196 TDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLH 255
           + AL+++    +  IGL  D++  L + +   K+AL+LG+EG G+R    E    +A L 
Sbjct: 187 SRALEEIAEAQYWRIGLMGDTETTLGETLDGSKVALVLGSEGDGMRHNVMEHCDVLARLP 246

Query: 256 MPGIIKALNVSN 267
           +   +++LN+SN
Sbjct: 247 ISPRMESLNISN 258


>gi|159045111|ref|YP_001533905.1| RNA methyltransferase [Dinoroseobacter shibae DFL 12]
 gi|157912871|gb|ABV94304.1| RNA methyltransferase [Dinoroseobacter shibae DFL 12]
          Length = 263

 Score =  160 bits (404), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 92/242 (38%), Positives = 138/242 (57%), Gaps = 10/242 (4%)

Query: 47  ENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVG 106
           + ++L+G+H V  AL NP+R   +L+ T+NA  +L          P +   P+     + 
Sbjct: 22  QTVWLFGLHAVRDALENPARTKLRLVVTRNAADKLAEAIAGAGIAP-EIADPRRFPAPLD 80

Query: 107 KEAVHQGLALETAPL-LSPTLDAVRNSQ-----LLMVLDHVNDPHNIGAILRSAVAFSCD 160
             +VHQG ALE  PL   P  + V         L+++LD V DPHN+GAILRSA  F   
Sbjct: 81  PGSVHQGAALEVKPLAWGPLAETVLTGPADRPPLVVLLDRVTDPHNVGAILRSAEVFGAA 140

Query: 161 GIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPL 220
            +I+T R +  E+  LAK+ASGALE  PY+R+ NL + ++++ + GF  +GL   ++  +
Sbjct: 141 AVISTARSAAPETGALAKTASGALERQPYLRVRNLAETMEELRAMGFVLLGLDGTAEDTI 200

Query: 221 E---QEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQ 277
               +++ +  IAL+LGAEG GLR KT+ET   +  +       +LNVSNAAAVALY  +
Sbjct: 201 GTALRDLTDRPIALVLGAEGPGLRDKTKETCNRLVKIPFARDFGSLNVSNAAAVALYACR 260

Query: 278 NH 279
             
Sbjct: 261 GE 262


>gi|119386533|ref|YP_917588.1| RNA methyltransferase [Paracoccus denitrificans PD1222]
 gi|119377128|gb|ABL71892.1| RNA methyltransferase, TrmH family, group 3 [Paracoccus
           denitrificans PD1222]
          Length = 265

 Score =  159 bits (403), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 95/230 (41%), Positives = 133/230 (57%), Gaps = 12/230 (5%)

Query: 47  ENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVG 106
           E ++L+G+H V  AL NP R+  +L+ T+NAL RL     LP     + V  +T D+ V 
Sbjct: 27  ETVWLFGLHAVRDALANPRREKLRLVVTRNALDRL---GPLPPDLAHEIVDARTFDRAVP 83

Query: 107 --KEAVHQGLALETAPLLSPTLDAVRNSQ----LLMVLDHVNDPHNIGAILRSAVAFSCD 160
              E+VHQG ALE  PL   +L  +  S     LL+ LD V DPHN+GAILRSA  F   
Sbjct: 84  LPAESVHQGAALEVRPLKWGSLVDLALSGPGRPLLVALDRVTDPHNVGAILRSAEVFGAR 143

Query: 161 GIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPL 220
            +I   R+S  E+  LAK+ASGALE  PY+R++NL D L ++ S G+  +GL     + L
Sbjct: 144 AVIAPARHSAPETGALAKTASGALERQPYLRVTNLADTLIELQSMGYTVLGLDGTGDELL 203

Query: 221 EQEIKN---DKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSN 267
            + +++     I L+LGAEG GLR +T+ET   +  +       +LNVSN
Sbjct: 204 PEALRDLSGRAICLVLGAEGPGLRERTRETCDRILRIPFAADFGSLNVSN 253


>gi|85707218|ref|ZP_01038304.1| RNA methyltransferase, TrmH family, group 3 [Roseovarius sp. 217]
 gi|85668272|gb|EAQ23147.1| RNA methyltransferase, TrmH family, group 3 [Roseovarius sp. 217]
          Length = 258

 Score =  159 bits (401), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 89/238 (37%), Positives = 141/238 (59%), Gaps = 9/238 (3%)

Query: 38  QKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVP 97
           ++++  S  E ++L+G+H V  AL NPSR+  +L+ TKNA  +L+         P + V 
Sbjct: 11  EQAKRASASETVWLFGLHAVRDALENPSREKLRLIVTKNAADKLEAAIAASGITP-EEVD 69

Query: 98  PQTIDKIVGKEAVHQGLALETAPL-LSP----TLDAVRNSQLLMVLDHVNDPHNIGAILR 152
           P+  +  +   +VHQG ALE  PL   P     L   R +  +++LD V DPHN+GAILR
Sbjct: 70  PRKFNAPLDPGSVHQGAALEVKPLDWGPIGEVCLGDGRTAPRVVLLDRVTDPHNVGAILR 129

Query: 153 SAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGL 212
           SA  F    +I  + ++  E+  LAK+ASGALE  PY+R+ NL DA+ ++ + G+  +GL
Sbjct: 130 SAEVFGARAVIAPRHHAAPETGALAKTASGALERQPYLRVRNLADAIIELQAMGYLVLGL 189

Query: 213 SSDSKKPLE--QEIKNDK-IALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSN 267
           + +++  +E   E + D+ +AL+LGAEG GLR +T+E   ++  +       +LNVSN
Sbjct: 190 AGEAEMTIEAAMEGRRDRPVALVLGAEGPGLRERTREVCDALVRIEFASDFGSLNVSN 247


>gi|99081889|ref|YP_614043.1| RNA methyltransferase TrmH, group 3 [Ruegeria sp. TM1040]
 gi|99038169|gb|ABF64781.1| RNA methyltransferase TrmH group 3 [Ruegeria sp. TM1040]
          Length = 262

 Score =  158 bits (400), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 92/234 (39%), Positives = 139/234 (59%), Gaps = 7/234 (2%)

Query: 47  ENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVG 106
           E ++L+G+H V  AL NP R+  +L+ T NA  +L+ DA        + V P+     + 
Sbjct: 25  ETVWLFGLHAVRDALLNPKREKLRLVVTLNAQNKLE-DAIATSGITPEVVDPRKFSVPID 83

Query: 107 KEAVHQGLALETAPLLSPTL-DAVRNSQL--LMVLDHVNDPHNIGAILRSAVAFSCDGII 163
             +VHQG ALE  PL    L D    +++  +++LD V DPHN+GAILRSA       +I
Sbjct: 84  PGSVHQGAALEVKPLNWGGLEDNCIGAEVPRVILLDRVTDPHNVGAILRSAEVLGASAVI 143

Query: 164 TTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQE 223
            T+ +S  E+  LAK+ASGALE  PY+R+ NL+D +  +   G+  +GL  ++++ +E+ 
Sbjct: 144 GTRHHSAPETGALAKTASGALERQPYLRMRNLSDTIVALQQMGYLVLGLDGEAEETIEEA 203

Query: 224 IKN---DKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
           +     + IAL+LGAEG GLR KT+ET   +  +       +LNVSNAAA++LY
Sbjct: 204 VAGRTKEPIALVLGAEGPGLRQKTKETVDKLVKIDAARGFGSLNVSNAAALSLY 257


>gi|149201824|ref|ZP_01878798.1| RNA methyltransferase, TrmH family, group 3 [Roseovarius sp.
           TM1035]
 gi|149144872|gb|EDM32901.1| RNA methyltransferase, TrmH family, group 3 [Roseovarius sp.
           TM1035]
          Length = 258

 Score =  157 bits (397), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 87/238 (36%), Positives = 141/238 (59%), Gaps = 9/238 (3%)

Query: 38  QKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVP 97
           ++++  +  E ++L+G+H V  AL NP+R+  +L+ TKNA  +L+         P + V 
Sbjct: 11  EQAKRAAASETVWLFGLHAVRDALENPAREKLRLIVTKNAADKLEAAIAASGITP-EEVD 69

Query: 98  PQTIDKIVGKEAVHQGLALETAPL-LSPTLDAV----RNSQLLMVLDHVNDPHNIGAILR 152
           P+  +  +   +VHQG ALE  PL   P  +      R +  +++LD V DPHN+GAILR
Sbjct: 70  PRKFNAPLDPGSVHQGAALEVKPLDWGPMAEVCLGDGRTAPRVVLLDRVTDPHNVGAILR 129

Query: 153 SAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGL 212
           SA  F    +I  + ++  E+  LAK+ASGALE  PY+R+ NL DA+ ++ + G+  +GL
Sbjct: 130 SAEVFGARAVIAPRHHAAPETGALAKTASGALERQPYLRVRNLADAIIELQAMGYTVLGL 189

Query: 213 SSDSKKPLEQ--EIKNDK-IALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSN 267
           + +++  +E   E K D+ +AL+LGAEG GLR +T+E   ++  +       +LNVSN
Sbjct: 190 AGEAELTIEAALEGKRDRPVALVLGAEGPGLRERTREVCDALVRIEFASDFGSLNVSN 247


>gi|259416208|ref|ZP_05740128.1| RNA methyltransferase, TrmH family, group 3 [Silicibacter sp.
           TrichCH4B]
 gi|259347647|gb|EEW59424.1| RNA methyltransferase, TrmH family, group 3 [Silicibacter sp.
           TrichCH4B]
          Length = 262

 Score =  156 bits (394), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 91/232 (39%), Positives = 138/232 (59%), Gaps = 7/232 (3%)

Query: 49  LFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKE 108
           ++L+G+H V  AL NP R+  +L+ T NA  +L+ DA        + V P+     +   
Sbjct: 27  VWLFGLHAVRDALLNPKREKLRLVVTLNAHNKLE-DAITTSGITPEVVDPRKFSVPIDPG 85

Query: 109 AVHQGLALETAPLLSPTLDA-VRNSQL--LMVLDHVNDPHNIGAILRSAVAFSCDGIITT 165
           +VHQG ALE  PL    LD     +++  +++LD V DPHN+GAILRSA       +I T
Sbjct: 86  SVHQGAALEVKPLNWGGLDENCIGAEIPRVILLDRVTDPHNVGAILRSAEVLGASAVIGT 145

Query: 166 KRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIK 225
           + +S  E+  LAK+ASGALE  PY+R+ NL+D +  +   G+  +GL  ++++ +E+ + 
Sbjct: 146 RHHSAPETGALAKTASGALERQPYLRMRNLSDTIVALQQMGYLVLGLDGEAEETIEEAVA 205

Query: 226 N---DKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
               + IAL+LGAEG GLR KT+ET   +  +       +LNVSNAAA++LY
Sbjct: 206 GRTKEPIALVLGAEGPGLRQKTKETVDKLVKIDAARGFGSLNVSNAAALSLY 257


>gi|162149380|ref|YP_001603841.1| 23S rRNA (guanosine-2'-O-)-methyltransferase rlmB
           [Gluconacetobacter diazotrophicus PAl 5]
 gi|161787957|emb|CAP57557.1| putative 23S rRNA (guanosine-2'-O-)-methyltransferase rlmB
           [Gluconacetobacter diazotrophicus PAl 5]
          Length = 233

 Score =  155 bits (392), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 94/225 (41%), Positives = 130/225 (57%), Gaps = 1/225 (0%)

Query: 51  LYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAV 110
           +YG+H   AAL NP R+I Q+LAT++  A L    N P P          ++ + G++AV
Sbjct: 1   MYGLHPALAALGNPERRIRQILATEDGEAALRERLNAPLPMQPHRTDRARLESLCGRDAV 60

Query: 111 HQGLALETAPLLSPTL-DAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYS 169
           HQG+A+    L S  + D       L++LD V DP N+GAILRSA AF    ++  +R +
Sbjct: 61  HQGIAVLADALPSLAIEDVTGRPGPLLLLDQVTDPRNVGAILRSAAAFGAAAVVVMERNA 120

Query: 170 PSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKI 229
           P E+  LAK+ASGALE +P   + NL   L  + S  F  +GL +             ++
Sbjct: 121 PDETGALAKAASGALEIVPLGAVVNLARTLDALKSLDFWVVGLDAGGGILDGTSFGQRRV 180

Query: 230 ALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
           AL+LGAEG GLR  T+E    +A L MPG +++LNVSNAAAVALY
Sbjct: 181 ALVLGAEGDGLRRLTREHCDEIAGLAMPGDMESLNVSNAAAVALY 225


>gi|83594035|ref|YP_427787.1| RNA methyltransferase TrmH, group 3 [Rhodospirillum rubrum ATCC
           11170]
 gi|83576949|gb|ABC23500.1| RNA methyltransferase TrmH, group 3 [Rhodospirillum rubrum ATCC
           11170]
          Length = 348

 Score =  155 bits (392), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 94/233 (40%), Positives = 131/233 (56%), Gaps = 14/233 (6%)

Query: 48  NLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPP---QTIDKI 104
            L+L+G H V AAL NP RK  +LLA   A            P    TV P   + I+ +
Sbjct: 115 GLWLFGRHAVEAALQNPERKALRLLALAGAAEG--------LPKGGPTVEPADREAIEAV 166

Query: 105 VGKEAVHQGLALETAPLLSPTLDAVR---NSQLLMVLDHVNDPHNIGAILRSAVAFSCDG 161
           V   AVHQGLAL+ APL  PT++ +       ++ +LD V+DPHNIGA+LRSA AF    
Sbjct: 167 VPPGAVHQGLALKVAPLSQPTVEEIARIPGPSVVAILDQVSDPHNIGAVLRSAAAFGIRA 226

Query: 162 IITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLE 221
           ++   R+SP E+  LAKSASG LE +P +R  NL+ AL      GF   GL + ++  L 
Sbjct: 227 VVVQDRHSPEETGTLAKSASGTLERVPLVRAINLSQALDTFKEHGFWCAGLDASAETTLA 286

Query: 222 QEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
           +    ++  ++LG+EG GLR   ++    +  L M   +++LNVSNAAAV  Y
Sbjct: 287 EAALPERCVVVLGSEGAGLRRLVRDHCDLLVKLAMDSGVESLNVSNAAAVTFY 339


>gi|302382701|ref|YP_003818524.1| RNA methyltransferase, TrmH family, group 3 [Brevundimonas
           subvibrioides ATCC 15264]
 gi|302193329|gb|ADL00901.1| RNA methyltransferase, TrmH family, group 3 [Brevundimonas
           subvibrioides ATCC 15264]
          Length = 304

 Score =  155 bits (391), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 89/228 (39%), Positives = 147/228 (64%), Gaps = 4/228 (1%)

Query: 50  FLYGVHTVSAALNNPSRK-IFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKE 108
           FL+G H V AAL NP+RK + +LLAT++  A ++ +    +   ++ +  QT+++++   
Sbjct: 71  FLWGRHPVLAALANPARKGMGRLLATEDRAAEIEREGTA-NGHKIEVMDAQTLERMLPAG 129

Query: 109 AVHQGLALETAPLLSPTLDAVRN--SQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTK 166
           AVHQG+A +  PL   +L+ + +    ++++LD + DP N+GAI RSA+AF   GI+   
Sbjct: 130 AVHQGMAFKVQPLEGVSLEDLGDPAEGIIVMLDQLTDPQNVGAIFRSALAFGARGIVVQD 189

Query: 167 RYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKN 226
           R+SP  +  LAK+A+GA E +P  R++NL+ AL+++   G++ +GL  DS++ LE  + +
Sbjct: 190 RHSPVLAGALAKAAAGATERLPCARVTNLSRALERLADLGWRAVGLDGDSEELLENALDH 249

Query: 227 DKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
               L++G+EG G+R    E    +A + MPG  ++LNVSNAAAVALY
Sbjct: 250 RPTVLVMGSEGDGIRRLVAEHCDVLAKIPMPGGFESLNVSNAAAVALY 297


>gi|58584746|ref|YP_198319.1| rRNA methylase [Wolbachia endosymbiont strain TRS of Brugia malayi]
 gi|58419062|gb|AAW71077.1| rRNA methylases [Wolbachia endosymbiont strain TRS of Brugia
           malayi]
          Length = 258

 Score =  154 bits (390), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 83/238 (34%), Positives = 140/238 (58%), Gaps = 11/238 (4%)

Query: 47  ENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANL---PHPFPVKTVPPQTIDK 103
           +N +LYG HT   AL N +R   +LL T+N+    + +           V+ V  + + +
Sbjct: 8   KNFWLYGKHTCMLALKNKNRLCIELLVTENSYREYEKEIRQCVDSKGIKVQLVKNKILSE 67

Query: 104 IVGKEAVHQGLALETAPLL-----SPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFS 158
           ++ K A HQG+AL+ AP+L         ++  +S  +++LD V D HNIG+ILR++  F+
Sbjct: 68  VLSKSANHQGIALKVAPILHSLSIKEIAESSSDSSTIVILDQVTDTHNIGSILRTSACFN 127

Query: 159 CDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKK 218
            D ++    +SPSE+A +AK+ASG L+ +P I ++N+   ++ +   G+   G  S++K+
Sbjct: 128 VDALVLPYNHSPSENASIAKAASGTLDIVPLIHVTNVVKTMEYLKKVGYWCYGFDSNAKE 187

Query: 219 PLEQEIKN--DKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
            ++ EIK+   KI +I G+EGKG+R   +E    +  + M  +I +LNVSNAAA+ LY
Sbjct: 188 NID-EIKSFGKKIVIIFGSEGKGMRRLVKENCDYLLKIPMSNVIDSLNVSNAAAIGLY 244


>gi|260425256|ref|ZP_05779236.1| RNA methyltransferase, TrmH family, group 3 [Citreicella sp. SE45]
 gi|260423196|gb|EEX16446.1| RNA methyltransferase, TrmH family, group 3 [Citreicella sp. SE45]
          Length = 278

 Score =  153 bits (387), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 88/238 (36%), Positives = 134/238 (56%), Gaps = 9/238 (3%)

Query: 38  QKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVP 97
           ++S+     E ++L+G+H V  AL NP R+  +L+ T NA A+L+ DA        +   
Sbjct: 31  EQSKKARAAETVWLFGLHAVRDALMNPRREKLRLIVTLNAQAKLE-DAIAAGGIEPEIHD 89

Query: 98  PQTIDKIVGKEAVHQGLALETAPLLSPTLDAV-----RNSQLLMVLDHVNDPHNIGAILR 152
           P+     +  ++VHQG ALE  PL    L+ V          L++LD V DPHN+GAILR
Sbjct: 90  PRKFGAPLDPQSVHQGAALEVKPLDWGRLEDVAMGDGETPPRLVLLDRVTDPHNVGAILR 149

Query: 153 SAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGL 212
           SA  F    +I T+ ++  E+  LAK+ASGALE  PY+R  NL D ++ +   G+  +GL
Sbjct: 150 SAEVFGAQAVIGTQHHAAPETGALAKTASGALERQPYLRERNLADTIRALQEMGYLVLGL 209

Query: 213 SSDSKKPLE---QEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSN 267
             ++   +E   + +++  +AL+LGAEG GLR KT+ET   +  +       +LNVSN
Sbjct: 210 DGEADTTIETALEGMRDRAVALVLGAEGPGLREKTKETVDRLVRIEFARSFGSLNVSN 267


>gi|294678305|ref|YP_003578920.1| TrmH family RNA methyltransferase [Rhodobacter capsulatus SB 1003]
 gi|294477125|gb|ADE86513.1| RNA methyltransferase, TrmH family, group 3 [Rhodobacter capsulatus
           SB 1003]
          Length = 264

 Score =  152 bits (385), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 91/229 (39%), Positives = 133/229 (58%), Gaps = 10/229 (4%)

Query: 48  NLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIV-- 105
            L+L+G+H V  AL NP+R   +L+ TKNA  +L  +A        + V P+  D  V  
Sbjct: 21  TLWLFGLHAVRDALMNPARVKLRLVLTKNAADKLA-EAIAAGGLAPEIVDPRKFDAHVPL 79

Query: 106 GKEAVHQGLALETAPLLSPTLDAVRNSQ----LLMVLDHVNDPHNIGAILRSAVAFSCDG 161
           G + VHQG ALE  PL    L  V  +     L+++LD V DPHN+GAILRSA  F    
Sbjct: 80  GPDQVHQGAALEVKPLDWGKLADVALTGAGLPLVVMLDRVTDPHNVGAILRSAEVFGARA 139

Query: 162 IITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLE 221
           ++   R+S  E+  LAK+ASGALE  PY+R++NL++A+  +   G+  IGL+ +++  L 
Sbjct: 140 VVAPARHSAPETGALAKTASGALERQPYLRVTNLSEAMGALRDMGYVLIGLAGEAEMTLA 199

Query: 222 Q---EIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSN 267
           +   E+    +A++LGAEG GLR KT+ T   +  +   G   +LNVSN
Sbjct: 200 EGLAEVGTRPVAIVLGAEGPGLREKTRATCDHLVRIPFAGAFGSLNVSN 248


>gi|321472938|gb|EFX83907.1| hypothetical protein DAPPUDRAFT_315299 [Daphnia pulex]
          Length = 250

 Score =  152 bits (384), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 95/231 (41%), Positives = 138/231 (59%), Gaps = 7/231 (3%)

Query: 49  LFLYGVHTVSAALNNPSRKIFQLLATKNALARLD-WDANLPHPFPVKTVPPQTIDKIVGK 107
            +L+G H+V AAL N  R+  QLL T++AL  ++ + A  P   P K +P   +++++  
Sbjct: 18  FWLWGTHSVIAALENTQRECHQLLCTRDALKDVEPFLAKRPKLSP-KILPRDELNRLL-P 75

Query: 108 EAVHQGLALETAPL----LSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGII 163
           + VHQG+AL+ +PL    L+  L     ++ L++LD + DP N+GAILRSA AF  DG++
Sbjct: 76  QTVHQGVALQVSPLPELFLNTFLARSPAAKRLVILDQITDPQNVGAILRSACAFGFDGVL 135

Query: 164 TTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQE 223
            T+R+SP    V+ KSASGALE IP +  +N+   L+ + + GF   GLS +   PL Q 
Sbjct: 136 MTERHSPPLEGVVGKSASGALEKIPLLMTANVAQGLRLLKTEGFWCWGLSEEGTLPLSQL 195

Query: 224 IKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
                +AL+LGAEGKGLRP T +    +  L        LNV+ AAAVA Y
Sbjct: 196 PCEGSLALVLGAEGKGLRPLTAQLCDGLVRLPTSPDFPTLNVAAAAAVAFY 246


>gi|51473842|ref|YP_067599.1| tRNA/rRNA methyltransferase [Rickettsia typhi str. Wilmington]
 gi|51460154|gb|AAU04117.1| tRNA/rRNA methyltransferase [Rickettsia typhi str. Wilmington]
          Length = 248

 Score =  151 bits (382), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 86/246 (34%), Positives = 141/246 (57%), Gaps = 8/246 (3%)

Query: 33  MQSFNQ-KSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPF 91
           M  FN+ +++  +   + ++YG H V +A+NNP R+I  +L T+      D +  L    
Sbjct: 1   MMVFNKMQNKQLNYQNSYYMYGKHPVFSAINNPKRQIENILCTREIF---DINKKLIGTR 57

Query: 92  PVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAV--RNSQL-LMVLDHVNDPHNIG 148
           P + V    I K++ K   HQG+A +  P+ S  LD +   N Q  +++LD + D  NIG
Sbjct: 58  PYEIVNNYIISKLL-KHQTHQGIAAKVRPIFSYNLDDIDINNPQCKIVILDQITDTQNIG 116

Query: 149 AILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQ 208
           AI+RSA AF  + II  +  SP+ES  +AK+A G LE IP I+++NL   +  +   GF 
Sbjct: 117 AIIRSAAAFYINAIILPQDNSPNESGSIAKAACGTLELIPIIKVTNLCSYMNYLKKRGFW 176

Query: 209 TIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNA 268
            IG++  + +    +  +DKIAL+ GAE KG+R   +ET   +A + +   +++LNV+NA
Sbjct: 177 IIGVTGYANEYFTDKFISDKIALVFGAEDKGMRRLVKETCDYLAKIPISKSVESLNVANA 236

Query: 269 AAVALY 274
           A++  +
Sbjct: 237 ASIIFH 242


>gi|99034724|ref|ZP_01314656.1| hypothetical protein Wendoof_01000527 [Wolbachia endosymbiont of
           Drosophila willistoni TSC#14030-0811.24]
          Length = 254

 Score =  151 bits (381), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 86/239 (35%), Positives = 139/239 (58%), Gaps = 13/239 (5%)

Query: 47  ENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWD----ANLPHPFPVKTVPPQTID 102
           EN +LYG HT  +AL N +R+  +LL T+N     + +    AN      V+ V  + ++
Sbjct: 8   ENFWLYGKHTCMSALKNKNRRCIELLVTENFYREHEKEIKQYAN-SKGIKVRLVENKILN 66

Query: 103 KIVGKEAVHQGLALETAPLL-----SPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAF 157
            ++ K A HQG+AL  AP+L         ++  +S  +++LD V D HNIG+ILR++  F
Sbjct: 67  DVLPKGANHQGIALNVAPILYNLSIEEVAESSNDSSTIVILDQVTDTHNIGSILRTSACF 126

Query: 158 SCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSK 217
           + D ++    +SPSE+A +AK+ASGAL+ IP I ++N+   +Q +   G+   G   ++K
Sbjct: 127 NVDALVLPHNHSPSENASIAKAASGALDIIPLIYVTNIVKTMQYLKKVGYWCYGFDCNAK 186

Query: 218 KPLEQEIKN--DKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
           + ++ EIK+   K  +I G+E KG+R   +E    +  + M   I +LNVSNAAA+ LY
Sbjct: 187 ENID-EIKSFEKKRVIIFGSEEKGMRRLVKENCDYLLKIPMSNAINSLNVSNAAAIGLY 244


>gi|163796067|ref|ZP_02190029.1| RNA methyltransferase TrmH, group 3 [alpha proteobacterium BAL199]
 gi|159178526|gb|EDP63066.1| RNA methyltransferase TrmH, group 3 [alpha proteobacterium BAL199]
          Length = 289

 Score =  150 bits (380), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 101/260 (38%), Positives = 140/260 (53%), Gaps = 14/260 (5%)

Query: 29  DYKKMQSFNQKSRHT--SQPENLFLYGVHTVSAALNNPSRKIFQLLATKNAL-ARLDWDA 85
           D +  +SF+  +R T  +  +   +YG H V AAL+N  R +  +  T  A  A   + +
Sbjct: 13  DRQTERSFDGSTRSTEPAVDDPTLVYGRHAVRAALHNDRRHVVAIRHTVGAGDAMAVFLS 72

Query: 86  NLPHPFPVKTVPPQTIDKI-----VGKEAVHQGLALETAPLLSPTLDAV------RNSQL 134
            LP P       PQ +D       +   AVHQGL L+  PL  P L  +      R   +
Sbjct: 73  ELPEPRRRSLPAPQPVDATELDASLPDGAVHQGLVLKVTPLPDPNLSDLIVAWEGRTDIV 132

Query: 135 LMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISN 194
           L+VLD V DPHN+GA+LRSA AF    ++   R+ P  + VLAK ASGAL+ +P +R+ N
Sbjct: 133 LVVLDQVTDPHNVGAVLRSAAAFGASAVVLQDRHGPPVTGVLAKIASGALDVVPLVRVVN 192

Query: 195 LTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHL 254
           L  AL+ +   GF   GL+ D    L +     + A++LGAEG GLR  T+ET  ++A L
Sbjct: 193 LARALRDLQENGFWCTGLAEDGSVDLGRVDLGGRCAIVLGAEGAGLRRLTRETCDALARL 252

Query: 255 HMPGIIKALNVSNAAAVALY 274
                I +LNVS AAAVALY
Sbjct: 253 PTCPPIGSLNVSAAAAVALY 272


>gi|225630621|ref|YP_002727412.1| RNA methyltransferase, TrmH family, group 3 [Wolbachia sp. wRi]
 gi|225592602|gb|ACN95621.1| RNA methyltransferase, TrmH family, group 3 [Wolbachia sp. wRi]
          Length = 254

 Score =  150 bits (380), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 86/241 (35%), Positives = 139/241 (57%), Gaps = 17/241 (7%)

Query: 47  ENLFLYGVHTVSAALNNPSRKIFQLLATKNAL------ARLDWDANLPHPFPVKTVPPQT 100
           EN +LYG HT  +AL N +R+  +LLAT+N         R   D+       V+ V  + 
Sbjct: 8   ENFWLYGKHTCMSALKNKNRRCIELLATENFYREHKKEIRQCVDS---KGIKVRLVESKI 64

Query: 101 IDKIVGKEAVHQGLALETAPLL-----SPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAV 155
           ++ ++ K A HQG+AL  AP+L         ++  +S  +++LD V D HNIG+ILR++ 
Sbjct: 65  LNDVLPKGANHQGIALNVAPILYNLSIEEIAESSNDSSTIVILDQVTDTHNIGSILRTSA 124

Query: 156 AFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSD 215
            F+ D ++    +SPSE+A +AK+ASGAL+ +P I ++N+   +Q +   G+   G   +
Sbjct: 125 CFNVDALVLPHNHSPSENASIAKAASGALDIVPLIYVTNIVKTMQYLKKVGYWCYGFDCN 184

Query: 216 SKKPLEQEIKN--DKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVAL 273
           +K+ ++ EIK+   K  +I G+E KG+R   +E    +  + M   I +LNVSNAAA+ L
Sbjct: 185 TKENID-EIKSFEKKRVIIFGSEEKGVRRLVKENCDYLLKIPMSNAINSLNVSNAAAIGL 243

Query: 274 Y 274
           Y
Sbjct: 244 Y 244


>gi|42520767|ref|NP_966682.1| RNA methyltransferase [Wolbachia endosymbiont of Drosophila
           melanogaster]
 gi|42410507|gb|AAS14616.1| RNA methyltransferase, TrmH family, group 3 [Wolbachia endosymbiont
           of Drosophila melanogaster]
          Length = 254

 Score =  150 bits (379), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 85/239 (35%), Positives = 139/239 (58%), Gaps = 13/239 (5%)

Query: 47  ENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWD----ANLPHPFPVKTVPPQTID 102
           EN +LYG HT  +AL N +R+  +LL T+N     + +    AN      V+ V  + ++
Sbjct: 8   ENFWLYGKHTCMSALKNKNRRCIELLVTENFYREHEKEIKQYAN-SKGIKVRLVENKILN 66

Query: 103 KIVGKEAVHQGLALETAPLL-----SPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAF 157
            ++ K A HQG+AL  AP+L         ++  +S  +++LD V D HNIG+ILR++  F
Sbjct: 67  DVLPKGANHQGIALNAAPILYNLSIEEVAESSNDSSTIVILDQVTDTHNIGSILRTSACF 126

Query: 158 SCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSK 217
           + D ++    +SPSE+A +AK+ASGAL+ +P I ++N+   +Q +   G+   G   ++K
Sbjct: 127 NVDALVLPHNHSPSENASIAKAASGALDIVPLIYVTNIVKTMQYLKKVGYWCYGFDCNAK 186

Query: 218 KPLEQEIKN--DKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
           + ++ EIK+   K  +I G+E KG+R   +E    +  + M   I +LNVSNAAA+ LY
Sbjct: 187 ENID-EIKSFEKKRVIIFGSEEKGMRRLVKENCDYLLKIPMSNAINSLNVSNAAAIGLY 244


>gi|91205880|ref|YP_538235.1| tRNA/rRNA methyltransferase [Rickettsia bellii RML369-C]
 gi|157826761|ref|YP_001495825.1| tRNA/rRNA methyltransferase [Rickettsia bellii OSU 85-389]
 gi|91069424|gb|ABE05146.1| tRNA/rRNA methyltransferase [Rickettsia bellii RML369-C]
 gi|157802065|gb|ABV78788.1| tRNA/rRNA methyltransferase [Rickettsia bellii OSU 85-389]
          Length = 241

 Score =  150 bits (378), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 85/235 (36%), Positives = 137/235 (58%), Gaps = 11/235 (4%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDAN--LPHPFPVKTVPPQTIDKIVGK 107
           ++YG H V +ALNNP R+I  +L T     ++ +DAN  L    P K V    + K++  
Sbjct: 13  YIYGKHPVFSALNNPKRQIEDILCT-----QMIFDANKKLISSKPYKIVNNDVLSKLLEN 67

Query: 108 EAVHQGLALETAPLLSPTLDAV--RNSQL-LMVLDHVNDPHNIGAILRSAVAFSCDGIIT 164
           +  HQG+A +  P+ S  ++ +  +N +  + +LD + DP NIGAI+RSA AF+ D II 
Sbjct: 68  QT-HQGIAAKVKPIFSHNIEDINIKNPKCKIAILDQITDPQNIGAIIRSAAAFNIDAIIL 126

Query: 165 TKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEI 224
               SP+E+  +AK+A G LE I  I+++NL   +  +   GF  IGL+ ++      ++
Sbjct: 127 PLDNSPNENGTIAKAACGTLELIKIIKVTNLNSCINYLKKHGFWVIGLTGEANDYFTDKL 186

Query: 225 KNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNH 279
            +DKIALI G+E KG+R   QE    +A + +   +++LNVSNAA++  +   +H
Sbjct: 187 ISDKIALIFGSEDKGMRRLVQENCDYLAKIPISDKVESLNVSNAASIIFHSLWDH 241


>gi|294085941|ref|YP_003552701.1| TrmH family RNA methyltransferase [Candidatus Puniceispirillum
           marinum IMCC1322]
 gi|292665516|gb|ADE40617.1| RNA methyltransferase, TrmH family, group 3 [Candidatus
           Puniceispirillum marinum IMCC1322]
          Length = 312

 Score =  149 bits (377), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 90/235 (38%), Positives = 133/235 (56%), Gaps = 22/235 (9%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLATKNALARLD--WD-------ANLPHPFPVKTVPPQT 100
           FL+G H V+AAL NP R+I  L  T ++    D  W        A LP   P++    + 
Sbjct: 70  FLWGRHAVAAALVNPDRRIAALYVTDDSRDSFDEMWQTLAMDRQAELPDARPIER---RR 126

Query: 101 IDKIVGKEA---VHQGLALETAPLLSPTLD------AVRNSQLLMVLDHVNDPHNIGAIL 151
           +D I G ++   VHQG+A    PL +P LD      A +  +++M LD ++DP N+GAIL
Sbjct: 127 LDGIGGHDSEKVVHQGMAAAVWPLDAPHLDDFIADIADKPVRIIM-LDQISDPRNVGAIL 185

Query: 152 RSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIG 211
           RSA AF CD IITT+R++P E+  LA++A+GALEHIP IR+ NL  A++ +        G
Sbjct: 186 RSARAFGCDAIITTQRHAPEENGALARTATGALEHIPIIRVVNLARAVESLQDHDITVAG 245

Query: 212 LSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVS 266
           L+ D    +       ++A++LGAEG GLR  ++E    +  + +     +LNVS
Sbjct: 246 LAGDGTMDVGALADFPRLAIMLGAEGPGLRRLSREHCDHLVRIDIAPDADSLNVS 300


>gi|114766067|ref|ZP_01445077.1| RNA methyltransferase, TrmH family, group 3 [Pelagibaca bermudensis
           HTCC2601]
 gi|114541702|gb|EAU44742.1| RNA methyltransferase, TrmH family, group 3 [Roseovarius sp.
           HTCC2601]
          Length = 259

 Score =  149 bits (377), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 89/238 (37%), Positives = 135/238 (56%), Gaps = 9/238 (3%)

Query: 38  QKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVP 97
           ++++     E ++L+G+H V  AL NP R+  +L+ T NA A+L  DA        +   
Sbjct: 12  EQAKKARSAETVWLFGLHAVRDALLNPRREKLRLILTPNAEAKLA-DAVAEAGIAPEIHD 70

Query: 98  PQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQL-----LMVLDHVNDPHNIGAILR 152
           P+     +  ++VHQG ALE  PL    LD V          L++LD V+DPHN+GAILR
Sbjct: 71  PRKFGAPLDPQSVHQGAALEVKPLDWGRLDDVAVRDDDRPARLVLLDRVSDPHNVGAILR 130

Query: 153 SAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGL 212
           SA  F    +I  + +S  E+  LAK+ASGALE  PY+R  NL D ++ + + G+  +GL
Sbjct: 131 SAEVFGAQAVIGVQHHSAPETGALAKTASGALERQPYLRERNLADTIRTLQTMGYLVLGL 190

Query: 213 SSDSKKPLEQE---IKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSN 267
             +++  +EQ    +++  +AL+LGAEG GLR KT+ T   +  +   G   +LNVSN
Sbjct: 191 DGEAEGTIEQALEGLRDRPVALVLGAEGPGLREKTKTTVDKLVRIDFAGGFGSLNVSN 248


>gi|15604508|ref|NP_221026.1| hypothetical protein RP664 [Rickettsia prowazekii str. Madrid E]
 gi|3861202|emb|CAA15102.1| unknown [Rickettsia prowazekii]
          Length = 248

 Score =  149 bits (377), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 85/252 (33%), Positives = 142/252 (56%), Gaps = 8/252 (3%)

Query: 33  MQSFNQ-KSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPF 91
           M  FN+ +++      + ++YG H V +A+NNP R+I  +L TK      D +  L    
Sbjct: 1   MTVFNKMQNKQLDYKNSYYMYGKHPVLSAINNPKRQIENILCTKEFF---DINKKLIGTR 57

Query: 92  PVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAV---RNSQLLMVLDHVNDPHNIG 148
             + V    + K++ K   HQG+A +  P+ S  LD +   +    +++LD + D  NIG
Sbjct: 58  SYEIVNNYILSKLL-KHQTHQGIAAKVRPIFSYNLDDIDINKPQCKIVILDQITDTQNIG 116

Query: 149 AILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQ 208
           AI+RSA AF  + II  +  SP+ES  +AK+A G LE IP I+++NL   +  +   GF 
Sbjct: 117 AIIRSAAAFYINAIILPQDNSPNESGSIAKAACGTLELIPIIKVTNLCSYMNYLKKRGFW 176

Query: 209 TIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNA 268
            IG++  +K+    ++ +DKIAL+ GAE KG+R   +ET   +A + +   +++LNV+NA
Sbjct: 177 IIGVTGYAKEYFTDKLISDKIALVFGAEDKGMRRLVKETCDYLAKIPISKSVESLNVANA 236

Query: 269 AAVALYITQNHF 280
           A++  +    +F
Sbjct: 237 ASIIFHSLHKYF 248


>gi|254796645|ref|YP_003081481.1| RNA methyltransferase, TrmH family, group 3 [Neorickettsia risticii
           str. Illinois]
 gi|254589882|gb|ACT69244.1| RNA methyltransferase, TrmH family, group 3 [Neorickettsia risticii
           str. Illinois]
          Length = 243

 Score =  148 bits (374), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 87/239 (36%), Positives = 138/239 (57%), Gaps = 12/239 (5%)

Query: 45  QPENLFLYGVHTVSAALNNPSRKIFQLLATKNALAR---LDWDANLPHPFPVKTVPPQTI 101
           Q E + ++G H   AA+ NP R I  +   +   A    L   + LP+   +       I
Sbjct: 2   QQEKIVIFGKHAAVAAIKNPERNILSIFIAREKKAVYLPLLERSRLPN---ISFCENTQI 58

Query: 102 DKIVGKEAVHQGLALETAPLLSPTL-DAVRNSQ---LLMVLDHVNDPHNIGAILRSAVAF 157
            KI G++A+HQG+A+ T  L  P L D ++N+    L+M+LD + DP N+G ILRS+ AF
Sbjct: 59  AKICGRDALHQGIAVITEKLSQPELRDVLKNTNKRSLVMILDSITDPFNVGNILRSSKAF 118

Query: 158 SCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSK 217
             D I+  +R+SPSE++V+AK+ASGALE IP   I+NLT+A++ +   G+    +   + 
Sbjct: 119 GVDAIVVKQRHSPSETSVIAKTASGALESIPVCTIANLTNAIKILQENGYFCYAMDGGAS 178

Query: 218 KPLEQEIKNDKIALILGAEGKGLR--PKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
             L +    +K+A +LG+EGKG+    KT+   T    ++      ++NVSNAAA+A++
Sbjct: 179 SKLTEIRFPNKVAFVLGSEGKGISHLLKTRCDQTLSIPMYADKNFDSINVSNAAAIAMF 237


>gi|190571500|ref|YP_001975858.1| RNA methyltransferase, TrmH family, group 3 [Wolbachia endosymbiont
           of Culex quinquefasciatus Pel]
 gi|213018903|ref|ZP_03334711.1| RNA methyltransferase, TrmH family, group 3 [Wolbachia endosymbiont
           of Culex quinquefasciatus JHB]
 gi|190357772|emb|CAQ55226.1| RNA methyltransferase, TrmH family, group 3 [Wolbachia endosymbiont
           of Culex quinquefasciatus Pel]
 gi|212995854|gb|EEB56494.1| RNA methyltransferase, TrmH family, group 3 [Wolbachia endosymbiont
           of Culex quinquefasciatus JHB]
          Length = 255

 Score =  148 bits (374), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 79/240 (32%), Positives = 140/240 (58%), Gaps = 15/240 (6%)

Query: 47  ENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDK--- 103
           EN ++YG HT  +AL N +R+  +LL T+N     +++  +      K + P+ ++    
Sbjct: 8   ENCWIYGKHTCISALRNKNRRCIELLVTENFYR--EFEKEIKQCADSKGIKPRLVENKMF 65

Query: 104 --IVGKEAVHQGLALETAPL-----LSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVA 156
             ++ K   HQG+AL+ AP+     +    +   +S  +++LD + D HNIG+ILR++  
Sbjct: 66  NDVLPKGVNHQGIALKVAPIFHSLNIEEIAEGSGDSSTIVILDQITDTHNIGSILRTSAC 125

Query: 157 FSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDS 216
           F+ D ++    +SPSE+A +AK+ASGAL+ +P I ++N+   ++ +   G+   G   ++
Sbjct: 126 FNIDALVLPHHHSPSENASIAKAASGALDIVPLIYVTNIVKTMESLKKIGYWCYGFDCNA 185

Query: 217 KKPLEQEIKN--DKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
           K+ ++ EIKN   K  +I G+E KG+R   +E+   +  + M  +I +LNVSNAAA+ LY
Sbjct: 186 KENID-EIKNFGQKRVIIFGSEEKGMRRLVKESCDYLLKIPMSNVIDSLNVSNAAAIGLY 244


>gi|218463384|ref|ZP_03503475.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Rhizobium etli Kim 5]
          Length = 179

 Score =  147 bits (372), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 81/166 (48%), Positives = 108/166 (65%), Gaps = 16/166 (9%)

Query: 14  SLKDSHYAKLRRNHRDYKKMQS-----FNQKSRHTSQ--------PENLFLYGVHTVSAA 60
           S KD+HYA LRR HRD K+ +        QK +   +        P+ ++LYG+HTV AA
Sbjct: 16  SAKDTHYANLRRAHRDAKRERGEIPTPLPQKRKRGPEDWKPPALAPDQVYLYGLHTVRAA 75

Query: 61  LNNPSRKIFQLLATKNALARLDWDAN-LPHPFPVKTVPPQTIDKIVGKEAVHQGLALETA 119
           L+NP RK  +L  T+NALARL+ D   L   F +  V P  IDK++G EA+HQG+ LET 
Sbjct: 76  LDNPERKKIKLSVTQNALARLEIDVETLGIAFEI--VSPHEIDKVLGPEAIHQGVMLETL 133

Query: 120 PLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITT 165
           PL    L+A+++S LL+VLD V DPHN+GAI+RSAVAF+   +ITT
Sbjct: 134 PLPVRRLEALKDSPLLLVLDQVTDPHNVGAIMRSAVAFNAGAVITT 179


>gi|292572291|gb|ADE30206.1| tRNA/rRNA methyltransferase [Rickettsia prowazekii Rp22]
          Length = 242

 Score =  147 bits (371), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 82/234 (35%), Positives = 134/234 (57%), Gaps = 7/234 (2%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEA 109
           ++YG H V +A+NNP R+I  +L TK      D +  L      + V    + K++ K  
Sbjct: 13  YMYGKHPVLSAINNPKRQIENILCTKEFF---DINKKLIGTRSYEIVNNYILSKLL-KHQ 68

Query: 110 VHQGLALETAPLLSPTLDAV---RNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTK 166
            HQG+A +  P+ S  LD +   +    +++LD + D  NIGAI+RSA AF  + II  +
Sbjct: 69  THQGIAAKVRPIFSYNLDDIDINKPQCKIVILDQITDTQNIGAIIRSAAAFYINAIILPQ 128

Query: 167 RYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKN 226
             SP+ES  +AK+A G LE IP I+++NL   +  +   GF  IG++  +K+    ++ +
Sbjct: 129 DNSPNESGSIAKAACGTLELIPIIKVTNLCSYMNYLKKRGFWIIGVTGYAKEYFTDKLIS 188

Query: 227 DKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
           DKIAL+ GAE KG+R   +ET   +A + +   +++LNV+NAA++  +    +F
Sbjct: 189 DKIALVFGAEDKGMRRLVKETCDYLAKIPISKSVESLNVANAASIIFHSLHKYF 242


>gi|88608166|ref|YP_506155.1| RNA methyltransferase [Neorickettsia sennetsu str. Miyayama]
 gi|88600335|gb|ABD45803.1| RNA methyltransferase, TrmH family, group 3 [Neorickettsia sennetsu
           str. Miyayama]
          Length = 243

 Score =  146 bits (368), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 87/239 (36%), Positives = 136/239 (56%), Gaps = 12/239 (5%)

Query: 45  QPENLFLYGVHTVSAALNNPSRKIFQLLATKNALAR---LDWDANLPHPFPVKTVPPQTI 101
           Q E + ++G H   AA+ NP R I  +   +   A    L   + LP+   +       I
Sbjct: 2   QQEKVVIFGKHAAVAAIKNPERNILSIFIAREKKAVYLPLLERSRLPN---ISFCENTQI 58

Query: 102 DKIVGKEAVHQGLALETAPLLSPTLDAVRNS----QLLMVLDHVNDPHNIGAILRSAVAF 157
            KI G++A+HQG+A+ T  L  P L  V  S     L+++LD + DP NIG ILRS+ AF
Sbjct: 59  AKICGRDALHQGIAVVTEKLSQPELRDVLKSTSKRSLVIILDSITDPFNIGNILRSSKAF 118

Query: 158 SCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSK 217
             D ++  +R+SPSE++V+AK+ASGALE IP   I+NLT+A++ +   G+    L   ++
Sbjct: 119 GVDALVVKERHSPSETSVIAKTASGALESIPVCTIANLTNAVKILQENGYFCYALDGGAR 178

Query: 218 KPLEQEIKNDKIALILGAEGKGLR--PKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
             L +    +K+A +LG+EGKG+    KT+   T    ++      ++NVSNAAA+A++
Sbjct: 179 SKLTEIRFPNKVAFVLGSEGKGISHLLKTRCDQTLSIPMYSDKNFDSINVSNAAAIAMF 237


>gi|114327047|ref|YP_744204.1| 23S rRNA Gm2251 methyltransferase [Granulibacter bethesdensis
           CGDNIH1]
 gi|114315221|gb|ABI61281.1| 23S rRNA Gm2251 methyltransferase [Granulibacter bethesdensis
           CGDNIH1]
          Length = 441

 Score =  145 bits (367), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 92/237 (38%), Positives = 144/237 (60%), Gaps = 11/237 (4%)

Query: 49  LFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQT----IDKI 104
           ++L+G+H V AAL NP+R++ +LL T+ A A L     LP P+ +  V  +T    +D++
Sbjct: 208 VWLHGLHAVEAALRNPARRLRRLLLTEEAEATLA--ERLPPPWAL--VAERTERAHMDQL 263

Query: 105 VGKEAVHQGLALETAPLLSPTLDAV--RNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGI 162
           +G E+VHQG+AL    L SP L  +  +    ++VLD V+DP N+GAILRSA AF    +
Sbjct: 264 LGTESVHQGIALLADKLPSPPLGEILAQRPGPVLVLDQVSDPRNVGAILRSAAAFQACCV 323

Query: 163 ITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQ 222
           I   R +P ES  +AK+ASGAL+ +P +R+ N+   L  + +     +GL ++       
Sbjct: 324 IVQDRNAPEESGTMAKAASGALDRLPMLRVVNIARTLAALKAADLWVVGLDAEGAPLSGP 383

Query: 223 EIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY-ITQN 278
            +   ++AL++GAEG GLR  T+E+   +  L M   +++LNVS A A+ALY I++N
Sbjct: 384 ALGKRRVALVMGAEGDGLRRLTRESCDEIVSLAMAEGMESLNVSVATAIALYEISRN 440


>gi|157826066|ref|YP_001493786.1| tRNA/rRNA methyltransferase [Rickettsia akari str. Hartford]
 gi|157800024|gb|ABV75278.1| tRNA/rRNA methyltransferase [Rickettsia akari str. Hartford]
          Length = 244

 Score =  145 bits (365), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 84/248 (33%), Positives = 139/248 (56%), Gaps = 12/248 (4%)

Query: 30  YKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPH 89
           + KMQ+    S++       ++YG H V +ALNNP R+I  +L T+  L   D +  L  
Sbjct: 3   FNKMQNKKLDSKNC-----YYMYGKHPVFSALNNPKRQIENILCTREIL---DTNKKLIG 54

Query: 90  PFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLD--AVRNSQL-LMVLDHVNDPHN 146
               + V    + K++G +  HQG+  +  P+ S  L+   ++N +  + +LD + D  N
Sbjct: 55  TRSYEIVNNDILSKLLGNQT-HQGIVAKVRPIFSYNLENLDIKNQKCKIAILDQITDTQN 113

Query: 147 IGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWG 206
           IGAI+RSA AF  + II  K  SP+ES  +AK+A G LE I  I+++NL   +  +   G
Sbjct: 114 IGAIIRSAAAFDINAIILPKDNSPNESGGIAKAACGTLELISIIKVTNLRSCMNYLKKHG 173

Query: 207 FQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVS 266
           F  IGL+  +      ++ +DK+AL+ G+E KG+R   +ET   +A + +   +++LNVS
Sbjct: 174 FWIIGLTGSAHDYFSDKLISDKMALVFGSEDKGIRRLIEETCDYLAKIPISKRVESLNVS 233

Query: 267 NAAAVALY 274
           NAA++  +
Sbjct: 234 NAASIIFH 241


>gi|239948322|ref|ZP_04700075.1| RNA methyltransferase, TrmH family, group 3 [Rickettsia
           endosymbiont of Ixodes scapularis]
 gi|239922598|gb|EER22622.1| RNA methyltransferase, TrmH family, group 3 [Rickettsia
           endosymbiont of Ixodes scapularis]
          Length = 240

 Score =  144 bits (364), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 80/228 (35%), Positives = 132/228 (57%), Gaps = 7/228 (3%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEA 109
           ++YG H V +ALNNP R+I  +L T+      D +  L      + V    + K++ +  
Sbjct: 13  YMYGKHPVFSALNNPKRQIENILCTREIF---DTNKKLIGTRSYEIVNNDILSKLL-ENQ 68

Query: 110 VHQGLALETAPLLSPTLD--AVRNSQL-LMVLDHVNDPHNIGAILRSAVAFSCDGIITTK 166
           +HQG+A +  P+ S  L+   ++N +  + +LD + D  NIGAI+RSA AF  + II  +
Sbjct: 69  IHQGIAAKVRPIFSYNLENIDIKNPKCKIAILDQITDTQNIGAIIRSAAAFDINAIILPQ 128

Query: 167 RYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKN 226
             SP+ES  +AK+A G LE IP I+++NL   +  +   GF  IGL+  +      ++ +
Sbjct: 129 DNSPNESGGIAKAACGTLELIPIIKVTNLRSCMNYLKKHGFWIIGLTGSANDYFTDKLIS 188

Query: 227 DKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
           DKIAL+ G+E KG+R   +ET   +A + +   +++LNVSNAA++  +
Sbjct: 189 DKIALVFGSEDKGMRRLVEETCDYLAKIPISKRVESLNVSNAASIIFH 236


>gi|197104675|ref|YP_002130052.1| spoU rRNA methylase family protein [Phenylobacterium zucineum HLK1]
 gi|196478095|gb|ACG77623.1| spoU rRNA methylase family protein [Phenylobacterium zucineum HLK1]
          Length = 265

 Score =  144 bits (363), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 94/256 (36%), Positives = 144/256 (56%), Gaps = 9/256 (3%)

Query: 24  RRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKI-FQLLATKNALARLD 82
           R + R  KK +  +   +    P + +++G H V AAL NP R    +LLAT     +++
Sbjct: 7   RNDARRGKKFRPQSGFRKPREAPSDEWIWGWHAVEAALANPRRGAPLRLLATPEKAKQIE 66

Query: 83  WDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAV----RNSQLLMVL 138
             A       ++      I + + + AVHQG+AL  APL  P  D      R   +L++L
Sbjct: 67  --ARFGRLKALEPADNHAIAQALPQGAVHQGVALRPAPL--PEADLADFEPRPGAVLLML 122

Query: 139 DHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDA 198
           D V DP N+GAILRSA AF   G+I   R++P  +  LAK+A+GA+E  P   + NL+ A
Sbjct: 123 DQVTDPQNVGAILRSAAAFGAAGLILQDRHAPKLTGALAKAAAGAVERTPVAHVVNLSRA 182

Query: 199 LQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPG 258
           L ++   G++T+GL+   ++ L + +    + L+LG+EG+GLR    E    +A + MPG
Sbjct: 183 LDELIDAGWRTVGLAGGGERSLGEVLDGSPVVLVLGSEGEGLRRLVAERCDELARIPMPG 242

Query: 259 IIKALNVSNAAAVALY 274
             ++LNVSNAAA+ALY
Sbjct: 243 GFESLNVSNAAAIALY 258


>gi|67458667|ref|YP_246291.1| tRNA/rRNA methyltransferase [Rickettsia felis URRWXCal2]
 gi|67004200|gb|AAY61126.1| tRNA/rRNA methyltransferase [Rickettsia felis URRWXCal2]
          Length = 240

 Score =  144 bits (363), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 80/228 (35%), Positives = 131/228 (57%), Gaps = 7/228 (3%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEA 109
           ++YG H V +ALNNP R+I  +L T+      D +  L      + V    + K++  + 
Sbjct: 13  YMYGKHPVFSALNNPKRQIENILCTREIF---DTNKKLIGTRSYEIVNNDILSKLLENQT 69

Query: 110 VHQGLALETAPLLSPTLDAV--RNSQL-LMVLDHVNDPHNIGAILRSAVAFSCDGIITTK 166
            HQG+A +  P+ S  L+ V  +N +  + +LD + D  NIGAI+RS+ AF  D II  +
Sbjct: 70  -HQGIAAKVRPIFSYNLEDVDIKNPKCKIAILDQITDTQNIGAIIRSSAAFDIDAIILPQ 128

Query: 167 RYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKN 226
             SP+ES  +AK+A G LE IP I+++NL   +  +   GF  IGL+  +      ++ +
Sbjct: 129 DNSPNESGSIAKAACGTLELIPIIKVTNLRSCMNYLKKHGFWIIGLTGSANDYFTDKLIS 188

Query: 227 DKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
           DK+AL+ G+E KG+R   +ET   +A + +   +++LNVSNAA++  +
Sbjct: 189 DKMALVFGSEDKGIRRLVEETCDYLAKILISKRVESLNVSNAASIIFH 236


>gi|241563421|ref|XP_002401697.1| rRNA methylase, putative [Ixodes scapularis]
 gi|215501889|gb|EEC11383.1| rRNA methylase, putative [Ixodes scapularis]
          Length = 229

 Score =  144 bits (363), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 80/228 (35%), Positives = 132/228 (57%), Gaps = 7/228 (3%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEA 109
           ++YG H V +ALNNP R+I  +L T+      D +  L      + V    + K++ +  
Sbjct: 2   YMYGKHPVFSALNNPKRQIENILCTREIF---DTNKKLIGTRSYEIVNNDILSKLL-ENQ 57

Query: 110 VHQGLALETAPLLSPTLD--AVRNSQL-LMVLDHVNDPHNIGAILRSAVAFSCDGIITTK 166
           +HQG+A +  P+ S  L+   ++N +  + +LD + D  NIGAI+RSA AF  + II  +
Sbjct: 58  IHQGIAAKVRPIFSYNLENIDIKNPKCKIAILDQITDTQNIGAIIRSAAAFDINAIILPQ 117

Query: 167 RYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKN 226
             SP+ES  +AK+A G LE IP I+++NL   +  +   GF  IGL+  +      ++ +
Sbjct: 118 DNSPNESGGIAKAACGTLELIPIIKVTNLRSCMNYLKKHGFWIIGLTGSANDYFTDKLIS 177

Query: 227 DKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
           DKIAL+ G+E KG+R   +ET   +A + +   +++LNVSNAA++  +
Sbjct: 178 DKIALVFGSEDKGMRRLVEETCDYLAKIPISKRVESLNVSNAASIIFH 225


>gi|16125488|ref|NP_420052.1| spoU rRNA methylase family protein [Caulobacter crescentus CB15]
 gi|221234234|ref|YP_002516670.1| 23S rRNA Gm2251 methyltransferase [Caulobacter crescentus NA1000]
 gi|13422566|gb|AAK23220.1| spoU rRNA methylase family protein [Caulobacter crescentus CB15]
 gi|220963406|gb|ACL94762.1| 23S rRNA Gm2251 methyltransferase [Caulobacter crescentus NA1000]
          Length = 278

 Score =  144 bits (362), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 96/252 (38%), Positives = 147/252 (58%), Gaps = 9/252 (3%)

Query: 28  RDYK-KMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKI-FQLLATKNALARLDWDA 85
           RD++ K +  N  SR     ++ +++G H V AAL NP R    +LLAT +   RL    
Sbjct: 18  RDFRSKPRKQNDFSRGQGDAKD-WIWGTHAVEAALANPRRPAPKRLLATPDRAKRLA--P 74

Query: 86  NLPHPFPVKTVPPQTIDKIVGKEAVHQGLAL---ETAPLLSPTLDAVRNSQLLMVLDHVN 142
           +L     ++ +  Q I K + + AVHQGLAL   E  PL    L       L+M LD + 
Sbjct: 75  HLQKLTCLQVMEGQEIAKQLPQGAVHQGLALKIDEPEPLTIAELGTPAKGFLVM-LDQIT 133

Query: 143 DPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKM 202
           DP NIGAI RSA AF   G+I   R++P+ S VLAK+A GA++  PY R+ NL+ AL+++
Sbjct: 134 DPQNIGAIFRSAAAFGAKGVILQDRHAPALSGVLAKTAVGAVDKAPYARVVNLSRALEEL 193

Query: 203 HSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKA 262
              G++ + L+ ++++ L+  + +    L+LG+EG+G+R    E   ++  + MPG  ++
Sbjct: 194 ADLGWRAVALAGEAEQSLDAVLDSQPTVLVLGSEGEGVRRLVAEHCDALGKIPMPGGFES 253

Query: 263 LNVSNAAAVALY 274
           LNVS AAA+ALY
Sbjct: 254 LNVSAAAAIALY 265


>gi|88607795|ref|YP_504889.1| RNA methyltransferase [Anaplasma phagocytophilum HZ]
 gi|88598858|gb|ABD44328.1| RNA methyltransferase, TrmH family, group 3 [Anaplasma
           phagocytophilum HZ]
          Length = 258

 Score =  144 bits (362), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 82/240 (34%), Positives = 132/240 (55%), Gaps = 14/240 (5%)

Query: 49  LFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLP--HPFPVKTVPPQTIDKIVG 106
           L++YG H   +AL NP+R   +LL T   + + D    L       ++ V    ID +VG
Sbjct: 10  LWIYGKHACLSALKNPNRVCIELLITHKFIDKNDPVIKLAKNRKIGIRDVEIAKIDSLVG 69

Query: 107 KEAVHQGLALETAPLLSPTL-------DAVRNSQ-----LLMVLDHVNDPHNIGAILRSA 154
            +A+HQG+ L+  PL            D V  ++      ++VLD V D HN+GA+LR+A
Sbjct: 70  SKAIHQGMLLKVLPLFGRNASSLIRIEDIVAQTEAAPTSTILVLDEVTDVHNVGAVLRTA 129

Query: 155 VAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSS 214
             F+ D ++ T+  SPSES  +AK++SGA++ +P + I NL   L+ +    +   G  +
Sbjct: 130 ACFNVDAVVLTEHNSPSESCGMAKASSGAIDIVPVVCIGNLVKTLEYLKQKNYWCYGFDA 189

Query: 215 DSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
                L Q   +++  +ILGAEGKG+R  T++    +  + M   +++LNVSNAAA+A+Y
Sbjct: 190 SGGTCLHQVEFSERRVVILGAEGKGMRHLTKKHCDHLVKIPMSEKMESLNVSNAAAIAMY 249


>gi|295688896|ref|YP_003592589.1| RNA methyltransferase, TrmH family, group 3 [Caulobacter segnis
           ATCC 21756]
 gi|295430799|gb|ADG09971.1| RNA methyltransferase, TrmH family, group 3 [Caulobacter segnis
           ATCC 21756]
          Length = 276

 Score =  143 bits (361), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 94/251 (37%), Positives = 147/251 (58%), Gaps = 7/251 (2%)

Query: 28  RDYK-KMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKI-FQLLATKNALARLDWDA 85
           RD++ K +  N  S+     ++ +++G H V AAL+NP R    +LLAT +   RL    
Sbjct: 18  RDFRSKPRKPNDFSKGQGDAKD-WIWGTHAVEAALSNPHRPAPKRLLATPDRAKRLA--P 74

Query: 86  NLPHPFPVKTVPPQTIDKIVGKEAVHQGLAL--ETAPLLSPTLDAVRNSQLLMVLDHVND 143
            L     ++ +  Q I K + + AVHQGLAL  +    LS    A  N   L++LD + D
Sbjct: 75  ALQKLSCLQVMEGQEIAKHLPQGAVHQGLALKIDEPESLSIAELAASNDGFLVMLDQITD 134

Query: 144 PHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMH 203
           P NIGAI RSA AF   G+I   R++P  S VLAK+A GA++ +PY R+ NL+ AL+++ 
Sbjct: 135 PQNIGAIFRSAAAFGAKGVILQDRHAPVLSGVLAKTAVGAVDKVPYARVVNLSRALEELA 194

Query: 204 SWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKAL 263
             G++ + L+ ++++ L++ +      L+LG+EG+G+R    E    +  + MPG  ++L
Sbjct: 195 DLGWRAVALAGEAEQTLDEVLDGAPTVLVLGSEGEGVRRLVAEHCDVLGKIPMPGGFESL 254

Query: 264 NVSNAAAVALY 274
           NVS AAA+ALY
Sbjct: 255 NVSAAAAIALY 265


>gi|167645570|ref|YP_001683233.1| RNA methyltransferase [Caulobacter sp. K31]
 gi|167348000|gb|ABZ70735.1| RNA methyltransferase, TrmH family, group 3 [Caulobacter sp. K31]
          Length = 278

 Score =  143 bits (360), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 95/251 (37%), Positives = 145/251 (57%), Gaps = 7/251 (2%)

Query: 28  RDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKI-FQLLATKNALARLDWDAN 86
           RD++     N K          +++G H V AAL+NP+R    +LLAT +   RL    N
Sbjct: 18  RDFRSKPRENNKFSKGQGDAKDWIWGTHAVEAALSNPARPAPKRLLATADRAKRLA--PN 75

Query: 87  LPH-PFPVKTVPPQTIDKIVGKEAVHQGLALET-APLLSPTLDAVRNSQ-LLMVLDHVND 143
           L   PF +  +    I + +   AVHQG+AL+   P      D    +Q LL++LD + D
Sbjct: 76  LAKAPF-LTIMEGAEIARQLPTGAVHQGVALKIDEPEALSVYDLGTPAQGLLVMLDQITD 134

Query: 144 PHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMH 203
           P NIGAI RSA AF   G+I   R++P+ + VLAK+A GA++ I Y R+ NL+ AL+++ 
Sbjct: 135 PQNIGAIFRSAAAFGARGVILQDRHAPALTGVLAKTAVGAVDKIAYARVVNLSRALEELA 194

Query: 204 SWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKAL 263
             G++ + L+ ++++ L+Q +      L+LG+EG+G+R    E   +M  + MPG  ++L
Sbjct: 195 DLGWRAVALAGEAQQTLDQVLDGRPTVLVLGSEGEGVRRLVSEHCDAMGKIAMPGGFESL 254

Query: 264 NVSNAAAVALY 274
           NVS AAAVALY
Sbjct: 255 NVSAAAAVALY 265


>gi|254294464|ref|YP_003060487.1| RNA methyltransferase, TrmH family, group 3 [Hirschia baltica ATCC
           49814]
 gi|254042995|gb|ACT59790.1| RNA methyltransferase, TrmH family, group 3 [Hirschia baltica ATCC
           49814]
          Length = 272

 Score =  142 bits (359), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 86/257 (33%), Positives = 145/257 (56%), Gaps = 8/257 (3%)

Query: 24  RRNHRDYKKMQSFNQKSRHTSQ-PEN-LFLYGVHTVSAALNNPSRKIFQLLATKNALARL 81
           +++  D  K    NQK     Q PE  ++++GVH V++AL N SRK  +   T+N   +L
Sbjct: 7   KQSFADNTKKNYKNQKKPTYQQLPEGEVWIWGVHAVASALKNNSRKKIRAFFTRNGAQKL 66

Query: 82  DWDAN-LPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTL-DAVRNSQL-LMVL 138
             DA  LPH    +   P+ IDK+V  ++VHQG+ L    L      D + N +  +++L
Sbjct: 67  GLDAEHLPHY--AQLADPKDIDKLVPPDSVHQGVVLHARELDGVDFEDVLANGEGPIVIL 124

Query: 139 DHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDA 198
           D V DP N+GA+ RS  AF    +I   R SP+    LAK+A GA++ IP + + N++ A
Sbjct: 125 DQVTDPQNVGAVFRSCAAFGAKAVIMQTRNSPNLGGALAKAAVGAIDIIPEVAVVNISRA 184

Query: 199 LQKMHSWGFQTIGLSSDSKKPLEQEIKNDK-IALILGAEGKGLRPKTQETATSMAHLHMP 257
           +  +   G+  +G+  +++  + Q       +A+++GAEG G+RP   +  + +A + + 
Sbjct: 185 VTALSDAGWWVVGMDGNTEIDIAQAFDTPAPLAIVMGAEGSGIRPLIAKGCSQLAKISIS 244

Query: 258 GIIKALNVSNAAAVALY 274
             +++LNVS+AA++ALY
Sbjct: 245 PQMESLNVSSAASIALY 261


>gi|225631081|ref|ZP_03787814.1| RNA methyltransferase, TrmH family, group 3 [Wolbachia endosymbiont
           of Muscidifurax uniraptor]
 gi|225591226|gb|EEH12375.1| RNA methyltransferase, TrmH family, group 3 [Wolbachia endosymbiont
           of Muscidifurax uniraptor]
          Length = 257

 Score =  142 bits (357), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 84/244 (34%), Positives = 139/244 (56%), Gaps = 20/244 (8%)

Query: 47  ENLFLYGV---HTVSAALNNPSRKIFQLLATKNAL------ARLDWDANLPHPFPVKTVP 97
           EN +LY     HT  +AL N +R+  +LLAT+N         R   D+       V+ V 
Sbjct: 8   ENFWLYXXXXXHTCMSALKNKNRRCIELLATENFYREHKKEIRQCVDS---KGIKVRLVE 64

Query: 98  PQTIDKIVGKEAVHQGLALETAPLL-----SPTLDAVRNSQLLMVLDHVNDPHNIGAILR 152
            + ++ +V K A HQG+AL  AP+L         ++  +S  +++LD V D HNIG+ILR
Sbjct: 65  NKILNDVVPKGANHQGIALNVAPILYNLSVEEIAESSNDSSTIVILDQVTDTHNIGSILR 124

Query: 153 SAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGL 212
           ++  F+ + ++    +SPSE+A +AK+ASGAL+ +P I ++N+   +Q +   G+   G 
Sbjct: 125 TSACFNVNALVLPHNHSPSENASIAKAASGALDIVPLIYVTNIVKTMQYLKKVGYWCYGF 184

Query: 213 SSDSKKPLEQEIKN--DKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAA 270
             ++K+ ++ EIK+   K  +I G+E KG+R   +E    +  + +  +I +LNVSNAAA
Sbjct: 185 DCNAKENID-EIKSLEKKRVIIFGSEEKGMRRLVKENCDYLLKIPISNVIDSLNVSNAAA 243

Query: 271 VALY 274
           + LY
Sbjct: 244 IGLY 247


>gi|157964809|ref|YP_001499633.1| tRNA/rRNA methyltransferase [Rickettsia massiliae MTU5]
 gi|157844585|gb|ABV85086.1| tRNA/rRNA methyltransferase [Rickettsia massiliae MTU5]
          Length = 256

 Score =  142 bits (357), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 84/252 (33%), Positives = 136/252 (53%), Gaps = 12/252 (4%)

Query: 30  YKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPH 89
           + KMQ+    S+H       ++YG H V +ALNNP R+I  +L T+      D +  L  
Sbjct: 13  FNKMQNKKLDSKHC-----YYMYGKHPVFSALNNPKRQIDNILCTREIF---DTNKKLIG 64

Query: 90  PFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQ---LLMVLDHVNDPHN 146
               + V    + K++ +   HQG+A +  P+ S  L+ +  +     + +LD + D  N
Sbjct: 65  TRSYEIVNNDILSKLL-ENHTHQGIAAKIRPIFSYNLEDIDITNPKCKIAILDQITDTQN 123

Query: 147 IGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWG 206
           IGAI+RSA AF  + II  +  SP+ES  +AK+A G LE IP I+++NL   +  +   G
Sbjct: 124 IGAIIRSAAAFDINAIILPQDNSPNESGGIAKAACGTLELIPIIKVTNLRSCMNYLKKHG 183

Query: 207 FQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVS 266
           F  IGL+  +      ++ +DKI L+ G+E KG+R    ET   +A + +   +++LNVS
Sbjct: 184 FWIIGLTGSANDYFTDKLISDKIVLVFGSEDKGIRRLVAETCDYLAKIPISQRVESLNVS 243

Query: 267 NAAAVALYITQN 278
           NAA++  +   N
Sbjct: 244 NAASIIFHSLHN 255


>gi|315499721|ref|YP_004088524.1| RNA methyltransferase, trmh family, group 3 [Asticcacaulis
           excentricus CB 48]
 gi|315417733|gb|ADU14373.1| RNA methyltransferase, TrmH family, group 3 [Asticcacaulis
           excentricus CB 48]
          Length = 322

 Score =  141 bits (356), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 93/299 (31%), Positives = 155/299 (51%), Gaps = 26/299 (8%)

Query: 2   NLISKKKSEKIFSLKDSHYAKLR-RNHRDYKKMQSFNQKSRHTSQP---------ENLFL 51
           N   K  S+  FS +   YAK + R+   Y   Q+   +++  +Q          E+ ++
Sbjct: 17  NGPKKSGSKAAFSGQSKPYAKDKPRDKGGYAPAQTARSQTQTHAQARPKPPVRVSEDGWI 76

Query: 52  YGVHTVSAALNNPSR-KIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAV 110
           +G+H V AAL N SR    +L  T +    L+  A       V+          + + AV
Sbjct: 77  WGLHAVEAALKNQSRLGPIRLYVTPDRQKALEQVAPKRGDLHVRLTEMAEFSGFLPQGAV 136

Query: 111 HQGLALETAPLLSPTLDAVRNSQL------LMVLDHVNDPHNIGAILRSAVAFSCDGIIT 164
           HQG+AL   PL    L+ +    L      L++LD V DP NIGAILR+  AF   G+I 
Sbjct: 137 HQGVALNGPPLEGDDLNGLMEGALRQERPVLVMLDQVTDPQNIGAILRTCAAFGAAGLIM 196

Query: 165 TKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEI 224
             R+SP    VLAK+A+GA++ +P+ R++NL+ AL+ +   GF ++G++ +++  L+  +
Sbjct: 197 QDRHSPVMQGVLAKTAAGAMDRVPFARVTNLSRALESLTENGFVSLGMAGEAEHSLQAVL 256

Query: 225 KNDK---------IALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
           +            + +++G+EG+GLR    E    +  + MPG  ++LNVS+A ++ALY
Sbjct: 257 EQQGWRQAGSPRALVIVMGSEGEGLRRLVAEHCDHLVKIPMPGGFESLNVSHATSIALY 315


>gi|88658569|ref|YP_507224.1| RNA methyltransferase [Ehrlichia chaffeensis str. Arkansas]
 gi|88600026|gb|ABD45495.1| RNA methyltransferase, TrmH family, group 3 [Ehrlichia chaffeensis
           str. Arkansas]
          Length = 252

 Score =  140 bits (352), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 82/239 (34%), Positives = 136/239 (56%), Gaps = 17/239 (7%)

Query: 49  LFLYGVHTVSAALNNPSRKIFQLLATKN---------ALARLDWDANLPHPFPVKTVPPQ 99
           +++YG H  +AAL N +RK  +LL T+N          + RL    N+     +K V P 
Sbjct: 6   IWIYGKHPCTAALQNKNRKCHELLVTENFMKNNNEISKILRLCKQKNIN----LKQVNPN 61

Query: 100 TIDKIVGKEAVHQGLALETAPLLSPTLDAVRN----SQLLMVLDHVNDPHNIGAILRSAV 155
            I+ ++   + HQG+AL+ + + S T++ V N    S  +++LD V D HN+G+I+RSAV
Sbjct: 62  YINSVLPHNSNHQGIALKASVIDSTTVEEVLNTSKESSTIILLDQVTDIHNVGSIIRSAV 121

Query: 156 AFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSD 215
            F+ D II     SPSE+  ++K++SGA++ IP + + N+ + ++ +   G+   G  + 
Sbjct: 122 CFNVDAIILPYHNSPSENCGMSKTSSGAVDMIPIVYVINIVNTIKLLKKAGYWCYGFDAK 181

Query: 216 SKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
             + L +   + K  +I G+E KG+R  T+E    +  + +   I +LNVSNAAAVALY
Sbjct: 182 EGEFLHKTKLDSKKLIIFGSEDKGMRKLTKENCDFLLKIAISKKIDSLNVSNAAAVALY 240


>gi|269958581|ref|YP_003328368.1| RNA methyltransferase [Anaplasma centrale str. Israel]
 gi|269848410|gb|ACZ49054.1| RNA methyltransferase [Anaplasma centrale str. Israel]
          Length = 262

 Score =  139 bits (350), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 81/248 (32%), Positives = 130/248 (52%), Gaps = 13/248 (5%)

Query: 40  SRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPVK--TVP 97
            R  +  E +++ G H   +AL NP+R   +LL T   L +    A +     ++   V 
Sbjct: 2   GRTRNHEECMWICGRHVCISALQNPNRVCRELLVTGEFLKKHPEVARMAQNKGIRPRRVA 61

Query: 98  PQTIDKIVG-KEAVHQGLALETAPLLSPTLDAVR----------NSQLLMVLDHVNDPHN 146
            + I KI G    VHQG+AL    L     D +R           +  +++LD V D +N
Sbjct: 62  AEEIGKIWGHGRTVHQGIALRVGKLFGRDGDKLRVEDIVSGSAFTASTVVLLDQVTDINN 121

Query: 147 IGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWG 206
           +GAI+RSA  F  D +I  + +SPSE+ ++ + +SGA + +P +R+ NL   ++ +   G
Sbjct: 122 VGAIVRSAACFDVDAVILPEHHSPSENCIITRVSSGAADLVPVVRVGNLVKTMEYLKQNG 181

Query: 207 FQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVS 266
           +   G+  D  K L +    ++ A+ILG+EGKG+R  T+E    +  + M   I +LNVS
Sbjct: 182 YWCYGMDVDGDKALHEISFCERRAIILGSEGKGIRRLTREHCDHLVKIPMSARINSLNVS 241

Query: 267 NAAAVALY 274
           NAAA+ LY
Sbjct: 242 NAAAIVLY 249


>gi|254419282|ref|ZP_05033006.1| RNA methyltransferase, TrmH family, group 3 [Brevundimonas sp.
           BAL3]
 gi|196185459|gb|EDX80435.1| RNA methyltransferase, TrmH family, group 3 [Brevundimonas sp.
           BAL3]
          Length = 294

 Score =  137 bits (346), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 86/232 (37%), Positives = 140/232 (60%), Gaps = 5/232 (2%)

Query: 41  RHTSQPENLFLYGVHTVSAALNNPSRK-IFQLLATKNALARLDWDANLPHPFPVKTVPPQ 99
           R  S  +N FL+G H V AAL NP+R+ + +LLAT    A ++    L H   ++ V  Q
Sbjct: 52  RSKSDADN-FLWGRHPVLAALANPARRGMGRLLATAERAAEIE-QGQLAHGHKIEVVEVQ 109

Query: 100 TIDKIVGKEAVHQGLALETAPLLSPTLDAVRN--SQLLMVLDHVNDPHNIGAILRSAVAF 157
            + +++   AVHQGLA +  PL   +L+ +      ++++LD + DP N+GAI RSA+AF
Sbjct: 110 ALTRMLPAGAVHQGLAFKVQPLEGVSLEELAEPAQGVIVMLDQLTDPQNVGAIFRSALAF 169

Query: 158 SCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSK 217
              GI+   R++P+ +  LAK+A GA E +P+ R++NL+ AL+++   G++ +GL    +
Sbjct: 170 GARGIVVQDRHAPALAGALAKAAVGATERLPHARVTNLSRALERLADLGWRAVGLDGTGE 229

Query: 218 KPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAA 269
           + LE+ +      L++G+EG G+R    E    +A + MPG  ++LNVSNAA
Sbjct: 230 QTLEEALDRQPTVLVMGSEGDGIRRLVAEHCDVLAKIPMPGGFESLNVSNAA 281


>gi|15892932|ref|NP_360646.1| tRNA/rRNA methyltransferase [Rickettsia conorii str. Malish 7]
 gi|15620124|gb|AAL03547.1| tRNA/rRNA methyltransferase [Rickettsia conorii str. Malish 7]
          Length = 240

 Score =  137 bits (345), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 81/245 (33%), Positives = 133/245 (54%), Gaps = 12/245 (4%)

Query: 33  MQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFP 92
           MQ+    S+H       ++YG H V +ALNNP R+I  +L T+      + +  L     
Sbjct: 1   MQNKKLDSKHC-----YYMYGKHPVFSALNNPKRQIDNILCTREIF---ETNKKLIGTRA 52

Query: 93  VKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQ---LLMVLDHVNDPHNIGA 149
            + V    + K++  +  HQG+A +  P+ S  L+ +  +     + +LD + D  NIGA
Sbjct: 53  YEIVNNDILSKLLENQT-HQGIAAKIRPIFSYNLEDIDITNPKCKIAILDQITDTQNIGA 111

Query: 150 ILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQT 209
           I+RSA AF  + II  +  SP+ES  +AK+A G LE IP I+++NL   +  +   GF  
Sbjct: 112 IIRSAAAFDINAIILPQDNSPNESGSIAKAACGTLELIPIIKVTNLRSCMNYLKKHGFWI 171

Query: 210 IGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAA 269
           IGL+  +      ++ +DKI L+ G+E KG+R    ET   +A + +   +++LNVSNAA
Sbjct: 172 IGLTGSANDYFTNKLISDKIVLVFGSEDKGIRRLVVETCDYLAKIPISQRVESLNVSNAA 231

Query: 270 AVALY 274
           ++  +
Sbjct: 232 SIIFH 236


>gi|157804038|ref|YP_001492587.1| elongation factor Tu [Rickettsia canadensis str. McKiel]
 gi|157785301|gb|ABV73802.1| elongation factor Tu [Rickettsia canadensis str. McKiel]
          Length = 239

 Score =  137 bits (345), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 76/229 (33%), Positives = 130/229 (56%), Gaps = 7/229 (3%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEA 109
           ++YG H V +ALNNP R+I  +L T+      D +  L      + V    + K++  + 
Sbjct: 13  YMYGKHPVFSALNNPKRQIENVLCTREIF---DANKKLIGTRSYEIVNNDILSKLLENQT 69

Query: 110 VHQGLALETAPLLSPTLDAV--RNSQL-LMVLDHVNDPHNIGAILRSAVAFSCDGIITTK 166
            HQG+A +  P+ S  L+ +  +N +  + +LD + D  NIGAI+RSA AF  + I+  +
Sbjct: 70  -HQGIAAKVRPIFSYNLEDIDIKNPKCKITILDQITDTQNIGAIIRSAAAFDINAILLPQ 128

Query: 167 RYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKN 226
             +P+ES  +AK+A G LE IP I+++NL   +  +   GF  IGL+  +      +   
Sbjct: 129 DNAPNESGGIAKAACGTLELIPIIKVTNLRSCMNYLKKHGFWIIGLTGSANDYFTNKFIT 188

Query: 227 DKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYI 275
           +KIAL+ G+E KG+R   ++T   +A + +   +++LNVSNAA++  ++
Sbjct: 189 NKIALVFGSEDKGMRKLVEKTCDYLAKIPISKRVESLNVSNAASIIFHL 237


>gi|229587012|ref|YP_002845513.1| tRNA/rRNA methyltransferase [Rickettsia africae ESF-5]
 gi|228022062|gb|ACP53770.1| tRNA/rRNA methyltransferase [Rickettsia africae ESF-5]
          Length = 240

 Score =  136 bits (343), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 81/245 (33%), Positives = 132/245 (53%), Gaps = 12/245 (4%)

Query: 33  MQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFP 92
           MQ+    S+H       ++YG H V +ALNNP R+I  +L T+      + +  L     
Sbjct: 1   MQNKKLDSKHC-----YYMYGKHPVFSALNNPKRQIDNILCTREIF---ETNKKLIGTRA 52

Query: 93  VKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQ---LLMVLDHVNDPHNIGA 149
            + V    + K++  +  HQG+A +  P+ S  L+ +  +     + +LD + D  NIGA
Sbjct: 53  YEIVNNDILSKLLENQT-HQGIAAKIRPIFSYNLEDIDITNPKCKIAILDQITDTQNIGA 111

Query: 150 ILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQT 209
           I+RSA AF  + II  +  SP+ES  +AK+A G LE IP I++ NL   +  +   GF  
Sbjct: 112 IIRSAAAFDINAIILPQDNSPNESGSIAKAACGTLELIPIIKVINLRSCMNYLKKHGFWI 171

Query: 210 IGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAA 269
           IGL+  +      ++ +DKI L+ G+E KG+R    ET   +A + +   +++LNVSNAA
Sbjct: 172 IGLTGSANDYFTDKLISDKIVLVFGSEDKGIRKLVAETCDYLAKIPISQRVESLNVSNAA 231

Query: 270 AVALY 274
           ++  +
Sbjct: 232 SIIFH 236


>gi|329851537|ref|ZP_08266294.1| spoU rRNA Methylase family protein [Asticcacaulis biprosthecum C19]
 gi|328840383|gb|EGF89955.1| spoU rRNA Methylase family protein [Asticcacaulis biprosthecum C19]
          Length = 297

 Score =  136 bits (343), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 92/260 (35%), Positives = 147/260 (56%), Gaps = 14/260 (5%)

Query: 25  RNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWD 84
           R   +  K QSF QKS+     ++ +L+GVH V AAL N +R+    L       +    
Sbjct: 35  RQAENAPKPQSF-QKSKVN---DDGWLWGVHAVEAALKNVNRQGPLKLYLSEERTKTIAP 90

Query: 85  ANLPHP-FPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQ--LLMVLDHV 141
           A L      V T+    I +++ + AVHQG+AL    L    L+++      ++++LD V
Sbjct: 91  ALLNRSGLRVSTLMMPDIARMLPQGAVHQGIALHGPVLEGVGLESIMEGGDGVILMLDQV 150

Query: 142 NDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQK 201
            DP NIGAI RSA AF   G++   R+SP    VLAK+A+GA + +P+ R++NL+ +L+ 
Sbjct: 151 TDPQNIGAIFRSAAAFGVQGLVMQDRHSPPLQGVLAKTAAGAADRVPFARVTNLSRSLEL 210

Query: 202 MHSWGFQTIGLSSDSK----KPLEQE---IKNDKIALILGAEGKGLRPKTQETATSMAHL 254
           +   G+ ++GL+ + +      L Q+   I   K+ L+LG+EG+GLR    E    +A +
Sbjct: 211 LGENGYVSVGLAGEGEFNLHTLLAQQGWGISLKKLVLVLGSEGEGLRRLVAEHCDHLARI 270

Query: 255 HMPGIIKALNVSNAAAVALY 274
            MPG  ++LNVS+AA+++LY
Sbjct: 271 PMPGGFESLNVSHAASISLY 290


>gi|157828863|ref|YP_001495105.1| tRNA/rRNA methyltransferase [Rickettsia rickettsii str. 'Sheila
           Smith']
 gi|157801344|gb|ABV76597.1| tRNA/rRNA methyltransferase [Rickettsia rickettsii str. 'Sheila
           Smith']
          Length = 240

 Score =  136 bits (342), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 80/245 (32%), Positives = 133/245 (54%), Gaps = 12/245 (4%)

Query: 33  MQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFP 92
           MQ+    S+H       ++YG H V +ALNNP R+I  +L T+      +    L     
Sbjct: 1   MQNKKLDSKHC-----YYMYGKHPVFSALNNPKRQIDNILCTREIF---ETHKKLIGTRA 52

Query: 93  VKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQ---LLMVLDHVNDPHNIGA 149
            + V    + K++  + +HQG+A +  P+ S  L+ +  +     + +LD + D  NIGA
Sbjct: 53  YEIVNNDILSKLLENQ-IHQGIAAKIRPIFSYNLEDIDITNPKCKIAILDQITDTQNIGA 111

Query: 150 ILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQT 209
           I+RSA AF  + II  +  SP+E+  +AK+A G LE IP I+++NL   +  +   GF  
Sbjct: 112 IIRSAAAFDINAIILPQDNSPNENGSIAKAACGTLELIPIIKVTNLRSCMNYLKKHGFWI 171

Query: 210 IGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAA 269
           IGL+  +      ++ +DKI L+ G+E KG+R    ET   +A + +   +++LNVSNAA
Sbjct: 172 IGLTGSANDYFTDKLISDKIVLVFGSEDKGIRRLVAETCDYLAKIPISQRVESLNVSNAA 231

Query: 270 AVALY 274
           ++  +
Sbjct: 232 SILFH 236


>gi|34581366|ref|ZP_00142846.1| tRNA/rRNA methyltransferase [Rickettsia sibirica 246]
 gi|28262751|gb|EAA26255.1| tRNA/rRNA methyltransferase [Rickettsia sibirica 246]
          Length = 240

 Score =  136 bits (342), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 80/245 (32%), Positives = 132/245 (53%), Gaps = 12/245 (4%)

Query: 33  MQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFP 92
           MQ+    S+H       ++YG H V +ALNNP R+I  +L T+      + +  L     
Sbjct: 1   MQNKKLDSKHC-----YYMYGKHPVFSALNNPKRQIDNILCTRKIF---ETNKKLIGTRA 52

Query: 93  VKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQ---LLMVLDHVNDPHNIGA 149
            + V    + K++  +  HQG+A +  P+ S  L+ +  +     + +LD + D  NIG 
Sbjct: 53  YEIVNNDILSKLLENQT-HQGIAAKIRPIFSYNLEDIDITNPKCKIAILDQITDTQNIGT 111

Query: 150 ILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQT 209
           I+RSA AF  + II  +  SP+ES  +AK+A G LE IP I+++NL   +  +   GF  
Sbjct: 112 IIRSAAAFDINAIILPQDNSPNESGSIAKAACGTLELIPIIKVTNLRSCMNYLKKHGFWI 171

Query: 210 IGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAA 269
           IGL+  +      ++ +DKI L+ G+E KG+R    ET   +A + +   +++LNVSNAA
Sbjct: 172 IGLTGSANDYFTDKLISDKIVLVFGSEDKGIRRLVAETCDYLAKIPISQRVESLNVSNAA 231

Query: 270 AVALY 274
           ++  +
Sbjct: 232 SIIFH 236


>gi|254449207|ref|ZP_05062656.1| RNA methyltransferase, TrmH family, group 3 [gamma proteobacterium
           HTCC5015]
 gi|198261184|gb|EDY85480.1| RNA methyltransferase, TrmH family, group 3 [gamma proteobacterium
           HTCC5015]
          Length = 264

 Score =  135 bits (340), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 90/250 (36%), Positives = 125/250 (50%), Gaps = 12/250 (4%)

Query: 34  QSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPH--PF 91
           Q  +   R T  P+  FL+G+H V A +     ++FQL   K A  RL     L      
Sbjct: 7   QRSSGSKRGTKSPQ--FLFGLHAVEAFIQRRPEEVFQLYWQKGADQRLGKLQALATQLGL 64

Query: 92  PVKTVPPQTIDKIVGKEAVHQGL-------ALETAPLLSPTLDAVRNSQLLMVLDHVNDP 144
           P + V  Q +D  V   A HQG+        L     L   LD V N  L++VLD V DP
Sbjct: 65  PTQYVERQQLDDWV-DGARHQGVIAQVRSSELWREADLEGILDGVENVPLVLVLDGVTDP 123

Query: 145 HNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHS 204
           HN+GA LRSA     D +I  K  S   +AV  K A GA E  P+I+++NL   L+ +  
Sbjct: 124 HNLGACLRSANGAGVDVVIAPKDKSAGLTAVSRKVACGAAEETPFIQVTNLARTLKGLAE 183

Query: 205 WGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALN 264
            G   +GL+    + L +   +  +AL++GAEG GLR  T+E+   +  + M G + +LN
Sbjct: 184 RGLWIVGLADGEDRSLYEGRLDGPMALVMGAEGDGLRRLTRESCDEIVAIPMGGSVSSLN 243

Query: 265 VSNAAAVALY 274
           VS AA V LY
Sbjct: 244 VSVAAGVCLY 253


>gi|165933590|ref|YP_001650379.1| 23S rRNA Gm2251 methyltransferase [Rickettsia rickettsii str. Iowa]
 gi|165908677|gb|ABY72973.1| 23S rRNA Gm2251 methyltransferase [Rickettsia rickettsii str. Iowa]
          Length = 240

 Score =  135 bits (339), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 80/245 (32%), Positives = 132/245 (53%), Gaps = 12/245 (4%)

Query: 33  MQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFP 92
           MQ+    S+H       ++YG H V +ALNNP R+I  +L T+      +    L     
Sbjct: 1   MQNKKLDSKHC-----YYMYGKHPVFSALNNPKRQIDNILCTREIF---ETHKKLIGTRA 52

Query: 93  VKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQ---LLMVLDHVNDPHNIGA 149
            + V    + K++  +  HQG+A +  P+ S  L+ +  +     + +LD + D  NIGA
Sbjct: 53  YEIVNNDILSKLLENQT-HQGIAAKIRPIFSYNLEDIDITNPKCKIAILDQITDTQNIGA 111

Query: 150 ILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQT 209
           I+RSA AF  + II  +  SP+E+  +AK+A G LE IP I+++NL   +  +   GF  
Sbjct: 112 IIRSAAAFDINAIILPQDNSPNENGSIAKAACGTLELIPIIKVTNLRSCMNYLKKHGFWI 171

Query: 210 IGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAA 269
           IGL+  +      ++ +DKI L+ G+E KG+R    ET   +A + +   +++LNVSNAA
Sbjct: 172 IGLTGSANDYFTDKLISDKIVLVFGSEDKGIRRLVAETCDYLAKIPISQRVESLNVSNAA 231

Query: 270 AVALY 274
           ++  +
Sbjct: 232 SILFH 236


>gi|37913005|gb|AAR05334.1| predicted tRNA/rRNA methyltransferase [uncultured marine alpha
           proteobacterium HOT2C01]
          Length = 257

 Score =  135 bits (339), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 77/241 (31%), Positives = 132/241 (54%), Gaps = 8/241 (3%)

Query: 45  QPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPH--PFPVKTVPPQTID 102
           Q  + ++YG H V  AL N +R  +++  T  A  +L  +  L +     +K    + ID
Sbjct: 13  QNSDYWIYGHHAVVGALMNENRVKYEVYFTSEAEKKLKNEIKLENINVISIKKTRDE-ID 71

Query: 103 KIVGKEAVHQGLALETAPLLSPTL-DAVRN----SQLLMVLDHVNDPHNIGAILRSAVAF 157
            ++   + HQG+ +    L +P L D + N      ++ +LD ++DP N+GAI RSA+AF
Sbjct: 72  LLLKGISNHQGICMRVEKLQTPKLSDFINNLNEERSIIFLLDQLDDPQNVGAIFRSALAF 131

Query: 158 SCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSK 217
           + DGII T   S +E++ LAK+AS AL+ +P+I+I N++  ++ +   G+   GL   ++
Sbjct: 132 NIDGIILTNTNSVTENSFLAKTASSALDKVPFIKIQNISSCIKILKDSGYWIYGLDMKAE 191

Query: 218 KPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQ 277
           + + +     KI  ILG+E KG+R  T         + M   +++LNVSN AA+ ++   
Sbjct: 192 RSITETTFPKKIVFILGSESKGMRKITDSLCDEGLKIKMSDNLESLNVSNTAAIIMFYVS 251

Query: 278 N 278
           N
Sbjct: 252 N 252


>gi|58698910|ref|ZP_00373774.1| RNA methyltransferase, TrmH family, group 3 [Wolbachia endosymbiont
           of Drosophila ananassae]
 gi|58534575|gb|EAL58710.1| RNA methyltransferase, TrmH family, group 3 [Wolbachia endosymbiont
           of Drosophila ananassae]
          Length = 236

 Score =  135 bits (339), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 79/229 (34%), Positives = 131/229 (57%), Gaps = 17/229 (7%)

Query: 59  AALNNPSRKIFQLLATKNAL------ARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQ 112
           +AL N +R+  +LLAT+N         R   D+       V+ V  + ++ ++ K A HQ
Sbjct: 2   SALKNKNRRCIELLATENFYREHKKEIRQCVDS---KGIKVRLVESKILNDVLPKGANHQ 58

Query: 113 GLALETAPLL-----SPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKR 167
           G+AL  AP+L         ++  +S  +++LD V D HNIG+ILR++  F+ D ++    
Sbjct: 59  GIALNVAPILYNLSIEEIAESSNDSSTIVILDQVTDTHNIGSILRTSACFNVDALVLPHN 118

Query: 168 YSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKN- 226
           +SPSE+A +AK+ASGAL+ +P I ++N+   +Q +   G+   G   ++K+ ++ EIK+ 
Sbjct: 119 HSPSENASIAKAASGALDIVPLIYVTNIVKTMQYLKKVGYWCYGFDCNTKENID-EIKSF 177

Query: 227 -DKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
             K  +I G+E KG+R   +E    +  + M   I +LNVSNAAA+ LY
Sbjct: 178 EKKRVIIFGSEEKGVRRLVKENCDYLLKIPMSNAINSLNVSNAAAIGLY 226


>gi|83858604|ref|ZP_00952126.1| spoU rRNA methylase family protein [Oceanicaulis alexandrii
           HTCC2633]
 gi|83853427|gb|EAP91279.1| spoU rRNA methylase family protein [Oceanicaulis alexandrii
           HTCC2633]
          Length = 219

 Score =  134 bits (336), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 76/182 (41%), Positives = 106/182 (58%), Gaps = 5/182 (2%)

Query: 98  PQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQ--LLMVLDHVNDPHNIGAILRSAV 155
           P  I   +   AVHQG AL+T+   + +L+AV      LL+VLD + DPHN+GAILRS  
Sbjct: 24  PGQITSRLPDGAVHQGFALKTSAPPAESLNAVLEPTHGLLVVLDQITDPHNVGAILRSCA 83

Query: 156 AFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSD 215
           AF    +I   R SP     L K+A G  E IP ++++N+ D L  +   G   IGL+ +
Sbjct: 84  AFGVRAVICQDRKSPPFFGALCKTAVGTAETIPQVQVTNIADTLIALQEAGRHVIGLAGE 143

Query: 216 SKKPLEQEI---KNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVA 272
           ++  L  EI       + L+LGAEG GLRP+  E  +S+A + M    ++LNVSNAAA+A
Sbjct: 144 AEARLGDEIAAHAGPGLVLVLGAEGSGLRPRVAEHCSSLARIPMGPKAESLNVSNAAAIA 203

Query: 273 LY 274
           LY
Sbjct: 204 LY 205


>gi|114570367|ref|YP_757047.1| tRNA/rRNA methyltransferase SpoU [Maricaulis maris MCS10]
 gi|114340829|gb|ABI66109.1| tRNA/rRNA methyltransferase (SpoU) [Maricaulis maris MCS10]
          Length = 289

 Score =  133 bits (335), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 79/249 (31%), Positives = 133/249 (53%), Gaps = 15/249 (6%)

Query: 28  RDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANL 87
           R+  K   ++++S+     ++ +++G H V AA+ N  R+I +L  T+NA AR     +L
Sbjct: 25  RNTSKRPDYSRRSKPAGTGDSGWIWGRHAVLAAVANKRREILELKVTRNA-AR-----DL 78

Query: 88  PHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQ--LLMVLDHVNDPH 145
           P     + V P+ ID  + + AVHQG A     L S +++ V +     L+VLD + DPH
Sbjct: 79  PDGTDHQQVEPKVIDNALPEGAVHQGFAARARALPSESVNGVIDPTHGALLVLDQITDPH 138

Query: 146 NIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSW 205
           N+GA+LRSA AF    +I   R +P     + KSA GA E + ++R++N+ D L +    
Sbjct: 139 NVGAVLRSAAAFGIRAVIMQDRKAPPLFGTVCKSAVGAAERVAHVRVTNIADTLLEFSKA 198

Query: 206 GFQTIGLSSDSKKPLEQEIK-------NDKIALILGAEGKGLRPKTQETATSMAHLHMPG 258
           G   +GL+ +++  L   +           + L++G+E KGLR +  E    +  + M  
Sbjct: 199 GRHVLGLAGEAELDLATALAAPDGKGWGPGLVLVMGSEDKGLRQRVAECCDQLVRIPMTD 258

Query: 259 IIKALNVSN 267
            +++LNVSN
Sbjct: 259 TVESLNVSN 267


>gi|73667231|ref|YP_303247.1| RNA methyl transferase TrmH, group 3 [Ehrlichia canis str. Jake]
 gi|72394372|gb|AAZ68649.1| RNA methyl transferase TrmH, group 3 [Ehrlichia canis str. Jake]
          Length = 252

 Score =  133 bits (335), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 78/239 (32%), Positives = 133/239 (55%), Gaps = 17/239 (7%)

Query: 49  LFLYGVHTVSAALNNPSRKIFQLLATKNA---------LARLDWDANLPHPFPVKTVPPQ 99
           +++YG H   AAL N +R+ +++L T+N          ++ L    N+     +KTV   
Sbjct: 6   IWIYGKHACIAALQNKNRECYEMLVTENITKNNSEITKISELCKQRNIN----LKTVNLN 61

Query: 100 TIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLL----MVLDHVNDPHNIGAILRSAV 155
            I+ ++   + HQG+AL+ + +   T++ + NS  +    ++LD + D HN+GAI+RSAV
Sbjct: 62  YINSVLPHNSNHQGIALKASTINPLTIEEILNSSTINSTIILLDQITDIHNVGAIMRSAV 121

Query: 156 AFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSD 215
            F+ D II     SPSE+  ++K++SGA++ IP   + NL   ++   + G+   G  + 
Sbjct: 122 CFNVDAIILPYHNSPSENCGMSKTSSGAIDMIPIAYVINLVSTIKLFKNAGYWCYGFDTK 181

Query: 216 SKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
             + L +   ++K  +I G+E KG+R  T+E    +  +     I +LNVSNAAAVALY
Sbjct: 182 EGELLHKTKFDNKKLIIFGSEDKGMRKLTKENCDFLLKIATSNKIDSLNVSNAAAVALY 240


>gi|56417006|ref|YP_154080.1| hypothetical protein AM915 [Anaplasma marginale str. St. Maries]
 gi|222475374|ref|YP_002563791.1| Putative tRNA/rRNA methyltransferase TrmH [Anaplasma marginale str.
           Florida]
 gi|56388238|gb|AAV86825.1| hypothetical protein AM915 [Anaplasma marginale str. St. Maries]
 gi|222419512|gb|ACM49535.1| Putative tRNA/rRNA methyltransferase TrmH [Anaplasma marginale str.
           Florida]
          Length = 261

 Score =  132 bits (332), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 80/239 (33%), Positives = 127/239 (53%), Gaps = 13/239 (5%)

Query: 49  LFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPV--KTVPPQTIDKIVG 106
           +++ G H   AAL NP+R    +L T   L +    A +     V  K V  + I KI+G
Sbjct: 11  MWICGRHVCIAALQNPNRVCRDMLVTGEFLKKYPEVARMAQSKGVYPKRVAAEKISKILG 70

Query: 107 KEAV-HQGLALETAPLLSPTLDAVR----------NSQLLMVLDHVNDPHNIGAILRSAV 155
              + HQG+AL    L       +R           +  +++LD V D +N+GAI+RSA 
Sbjct: 71  HGGMAHQGIALMVDELSGRDGSKLRVEDIVSANPSEASTVVILDRVTDINNVGAIVRSAA 130

Query: 156 AFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSD 215
            F  D +I  + +SPSES  + K++SGA + +P +++ NL   ++ +   G+   G+ + 
Sbjct: 131 CFDADAVILPEHHSPSESCTITKASSGAADIVPVVQVGNLVKTMEYLKQNGYWCYGMDAG 190

Query: 216 SKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
             K L +    ++ A+ILG+EGKG+R  T+E    +  + M   I +LNVSNAAA+ALY
Sbjct: 191 GDKALHEISFCERRAIILGSEGKGIRRLTREHCDHLVKIPMSARIDSLNVSNAAAIALY 249


>gi|255003358|ref|ZP_05278322.1| Putative tRNA/rRNA methyltransferase TrmH [Anaplasma marginale str.
           Puerto Rico]
 gi|255004482|ref|ZP_05279283.1| Putative tRNA/rRNA methyltransferase TrmH [Anaplasma marginale str.
           Virginia]
          Length = 251

 Score =  132 bits (331), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 80/239 (33%), Positives = 127/239 (53%), Gaps = 13/239 (5%)

Query: 49  LFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPV--KTVPPQTIDKIVG 106
           +++ G H   AAL NP+R    +L T   L +    A +     V  K V  + I KI+G
Sbjct: 1   MWICGRHVCIAALQNPNRVCRDMLVTGEFLKKYPEVARMAQSKGVYPKRVAAEKISKILG 60

Query: 107 KEAV-HQGLALETAPLLSPTLDAVR----------NSQLLMVLDHVNDPHNIGAILRSAV 155
              + HQG+AL    L       +R           +  +++LD V D +N+GAI+RSA 
Sbjct: 61  HGGMAHQGIALMVDELSGRDGSKLRVEDIVSANPSEASTVVILDRVTDINNVGAIVRSAA 120

Query: 156 AFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSD 215
            F  D +I  + +SPSES  + K++SGA + +P +++ NL   ++ +   G+   G+ + 
Sbjct: 121 CFDADAVILPEHHSPSESCTITKASSGAADIVPVVQVGNLVKTMEYLKQNGYWCYGMDAG 180

Query: 216 SKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
             K L +    ++ A+ILG+EGKG+R  T+E    +  + M   I +LNVSNAAA+ALY
Sbjct: 181 GDKALHEISFCERRAIILGSEGKGIRRLTREHCDHLVKIPMSARIDSLNVSNAAAIALY 239


>gi|58697096|ref|ZP_00372541.1| RNA methyltransferase, TrmH family, group 3 [Wolbachia endosymbiont
           of Drosophila simulans]
 gi|58536620|gb|EAL59943.1| RNA methyltransferase, TrmH family, group 3 [Wolbachia endosymbiont
           of Drosophila simulans]
          Length = 236

 Score =  131 bits (330), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 78/229 (34%), Positives = 130/229 (56%), Gaps = 17/229 (7%)

Query: 59  AALNNPSRKIFQLLATKNAL------ARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQ 112
           +AL N +R+  +LLA +N         R   D+       V+ V  + ++ ++ K A HQ
Sbjct: 2   SALTNQNRRCIELLAPENFYREHKKEIRQCVDS---KGIKVRLVESKILNDVLPKGANHQ 58

Query: 113 GLALETAPLL-----SPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKR 167
           G+AL  AP+L         ++  +S  +++LD V D HNIG+ILR++  F+ D ++    
Sbjct: 59  GIALNVAPILYNLSIEEIAESSNDSSTIVILDQVTDTHNIGSILRTSACFNVDALVLPHN 118

Query: 168 YSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKN- 226
           +SPSE+A +AK+ASGAL+ +P I ++N+   +Q +   G+   G   ++K+ ++ EIK+ 
Sbjct: 119 HSPSENASIAKAASGALDIVPLIYVTNIVKTMQYLKKVGYWCYGFDCNTKENID-EIKSF 177

Query: 227 -DKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
             K  +I G+E KG+R   +E    +  + M   I +LNVSNAAA+ LY
Sbjct: 178 EKKRVIIFGSEEKGVRRLVKENCDYLLKIPMSNAINSLNVSNAAAIGLY 226


>gi|58617359|ref|YP_196558.1| putative RNA methyltransferase [Ehrlichia ruminantium str. Gardel]
 gi|58416971|emb|CAI28084.1| Hypothetical tRNA/rRNA methyltransferase [Ehrlichia ruminantium
           str. Gardel]
          Length = 249

 Score =  131 bits (329), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 78/244 (31%), Positives = 140/244 (57%), Gaps = 14/244 (5%)

Query: 49  LFLYGVHTVSAALNNPSRKIFQLLATKN------ALARLDWDANLPHPFPVKTVPPQTID 102
           +++YG H   AAL N +RK  +LL T+N       + ++   +   + +P K V   TI+
Sbjct: 6   IWIYGKHPCVAALQNINRKCHELLVTENFIKHNNGIQKIRELSKQKNIYP-KQVNINTIN 64

Query: 103 KIVGKEAVHQGLALETAPLLSPTLDAVRNS-----QLLMVLDHVNDPHNIGAILRSAVAF 157
            ++   + HQG+AL+ + + + +++ V ++       +++LD V D +N+G+I+RSAV F
Sbjct: 65  SVLPPNSNHQGIALQVSIVDTVSIEDVLSNIPTEISTIILLDQVTDVYNVGSIIRSAVCF 124

Query: 158 SCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSK 217
           +   +I     SPSE+  ++K++SGA++ IP + + N+++A+  +   G+   G  +   
Sbjct: 125 NVHAVILPYYNSPSENCGMSKTSSGAIDMIPIVYVVNISNAIHTLKKAGYWCYGFDAKQG 184

Query: 218 KPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY--I 275
           +PL +   ++K  +I G+E KGLR  T+E    +  +     I +LNVSNAAA+ALY   
Sbjct: 185 EPLHKIKLDNKRLVIFGSENKGLRTLTKENCDFLLKIATSERIDSLNVSNAAAIALYSIF 244

Query: 276 TQNH 279
            QNH
Sbjct: 245 IQNH 248


>gi|57239339|ref|YP_180475.1| putative RNA methyltransferase [Ehrlichia ruminantium str.
           Welgevonden]
 gi|57161418|emb|CAH58342.1| putative tRNA/rRNA methyltransferase [Ehrlichia ruminantium str.
           Welgevonden]
          Length = 249

 Score =  130 bits (328), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 78/244 (31%), Positives = 140/244 (57%), Gaps = 14/244 (5%)

Query: 49  LFLYGVHTVSAALNNPSRKIFQLLATKN------ALARLDWDANLPHPFPVKTVPPQTID 102
           +++YG H   AAL N +RK  +LL T+N       + ++   +   + +P K V   TI+
Sbjct: 6   IWIYGKHPCVAALQNINRKCHELLVTENFIKHNNGIQKIRELSKQKNIYP-KQVNLNTIN 64

Query: 103 KIVGKEAVHQGLALETAPLLSPTLDAVRNS-----QLLMVLDHVNDPHNIGAILRSAVAF 157
            ++   + HQG+AL+ + + + +++ V ++       +++LD V D +N+G+I+RSAV F
Sbjct: 65  SVLPPNSNHQGIALQVSIVDTVSIEDVLSNIPTEISTIILLDQVTDVYNVGSIIRSAVCF 124

Query: 158 SCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSK 217
           +   +I     SPSE+  ++K++SGA++ IP + + N+++A+  +   G+   G  +   
Sbjct: 125 NVHAVILPYYNSPSENCGMSKTSSGAIDMIPIVYVVNISNAIHTLKKAGYWCYGFDAKQG 184

Query: 218 KPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY--I 275
           +PL +   ++K  +I G+E KGLR  T+E    +  +     I +LNVSNAAA+ALY   
Sbjct: 185 EPLHKIKLDNKRLVIFGSENKGLRTLTKENCDFLLKIATSERIDSLNVSNAAAIALYSIF 244

Query: 276 TQNH 279
            QNH
Sbjct: 245 IQNH 248


>gi|58579305|ref|YP_197517.1| putative RNA methyltransferase [Ehrlichia ruminantium str.
           Welgevonden]
 gi|58417931|emb|CAI27135.1| Hypothetical tRNA/rRNA methyltransferase [Ehrlichia ruminantium
           str. Welgevonden]
          Length = 249

 Score =  130 bits (328), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 77/243 (31%), Positives = 138/243 (56%), Gaps = 12/243 (4%)

Query: 49  LFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQ-----TIDK 103
           +++YG H   AAL N +RK  +LL T+N +   +    +      K + P+     TI+ 
Sbjct: 6   IWIYGKHPCVAALQNINRKCHELLFTENFIKHNNGIQKIRELIKQKNIYPKQVNLNTINS 65

Query: 104 IVGKEAVHQGLALETAPLLSPTLDAVRNS-----QLLMVLDHVNDPHNIGAILRSAVAFS 158
           ++   + HQG+AL+ + + + +++ V ++       +++LD V D +N+G+I+RSAV F+
Sbjct: 66  VLPPNSNHQGIALQVSIVDTVSIEDVLSNIPTEISTIILLDQVTDVYNVGSIIRSAVCFN 125

Query: 159 CDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKK 218
              +I     SPSE+  ++K++SGA++ IP + + N+++A+  +   G+   G  +   +
Sbjct: 126 VHAVILPYYNSPSENCGMSKTSSGAIDMIPIVYVVNISNAIHTLKKAGYWCYGFDAKQGE 185

Query: 219 PLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY--IT 276
           PL +   ++K  +I G+E KGLR  T+E    +  +     I +LNVSNAAA+ALY    
Sbjct: 186 PLHKIKLDNKRLVIFGSENKGLRTLTKENCDFLLKIATSERIDSLNVSNAAAIALYSIFI 245

Query: 277 QNH 279
           QNH
Sbjct: 246 QNH 248


>gi|238650976|ref|YP_002916832.1| 23S rRNA Gm2251 methyltransferase [Rickettsia peacockii str.
           Rustic]
 gi|238625074|gb|ACR47780.1| 23S rRNA Gm2251 methyltransferase [Rickettsia peacockii str.
           Rustic]
          Length = 240

 Score =  130 bits (328), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 79/245 (32%), Positives = 130/245 (53%), Gaps = 12/245 (4%)

Query: 33  MQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFP 92
           MQ+    S+H       ++YG H V +ALNNP R+I  +L T+      +    L     
Sbjct: 1   MQNKKLDSKHC-----YYMYGKHPVFSALNNPKRQIDNILCTREIF---ETHKKLIGTRA 52

Query: 93  VKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQ---LLMVLDHVNDPHNIGA 149
            + V    + K++  +  HQG+A +  P+ S  L+ +  +     + +LD + D  NIGA
Sbjct: 53  YEIVNNDILSKLLENQT-HQGIAAKIRPIFSYNLEDIDITNPKCKIAILDQITDTQNIGA 111

Query: 150 ILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQT 209
           I+RSA AF  + II  +  SP+ES  +AK+A G LE IP I+++NL   +  +    F  
Sbjct: 112 IIRSAAAFDINAIILPQDNSPNESGSIAKAACGTLELIPIIKVTNLRSCMNYLKKHRFWI 171

Query: 210 IGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAA 269
           IGL+  +      ++ +DK  L+ G+E KG+R    ET   +A + +   +++LNVSNAA
Sbjct: 172 IGLTGSANDYFTDKLISDKTVLVFGSEDKGIRRLVAETCDYLAKIPISQRVESLNVSNAA 231

Query: 270 AVALY 274
           ++  +
Sbjct: 232 SILFH 236


>gi|189183948|ref|YP_001937733.1| tRNA/rRNA methyltransferase, TrmH family [Orientia tsutsugamushi
           str. Ikeda]
 gi|189180719|dbj|BAG40499.1| tRNA/rRNA methyltransferase, TrmH family [Orientia tsutsugamushi
           str. Ikeda]
          Length = 266

 Score =  130 bits (327), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 75/231 (32%), Positives = 128/231 (55%), Gaps = 12/231 (5%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEA 109
           +++G H   AALNNP R I  +  T++    L   + L      K V  + + +++G + 
Sbjct: 32  YIFGTHASLAALNNPLRVIRYIYCTESCFLSL---SKLIQKHDYKIVTTKFLHQLLGSQI 88

Query: 110 VHQGLALETAPLLSPTLDAVRNSQL------LMVLDHVNDPHNIGAILRSAVAFSCDGII 163
           VHQG+A+ T PL   T++ +++  L      + +LD + D +N+GAI+RSA AF+   II
Sbjct: 89  VHQGIAVNTIPL---TINGIKHIDLATPNYKIAILDQLLDHNNLGAIIRSAAAFNISTII 145

Query: 164 TTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQE 223
             +  S  E+  +AK A GALE I  +++ NL + +  +  +GF  IGL  ++   L ++
Sbjct: 146 LPENNSIEENGTIAKIAVGALEKINLVKVKNLYNTINYLKKYGFWIIGLDLNNSNQLTEQ 205

Query: 224 IKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
             + K+A +LG+E KGLR  T++    +  + M    ++LNV+ AA +  Y
Sbjct: 206 TFHSKMAFVLGSENKGLRNLTRQQCDFLIKIPMSHKTESLNVAGAATIIFY 256


>gi|116621924|ref|YP_824080.1| RNA methyltransferase [Candidatus Solibacter usitatus Ellin6076]
 gi|116225086|gb|ABJ83795.1| RNA methyltransferase, TrmH family, group 3 [Candidatus Solibacter
           usitatus Ellin6076]
          Length = 237

 Score =  130 bits (326), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 82/229 (35%), Positives = 124/229 (54%), Gaps = 7/229 (3%)

Query: 50  FLYGVHTVSAAL--NNPSRKIFQLLATKNALARLDWDANLPH--PFPVKTVPPQTIDKIV 105
            L G+H V  AL   NP  +I  ++A      RL    +L      PV+  P  ++D++ 
Sbjct: 3   LLSGIHPVVEALRAGNPLERI--VIAQGAGGPRLQEIIDLARQAKIPVRFEPRPSLDRLA 60

Query: 106 GKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITT 165
           G  A HQG+    A      LD+V  S++L+VLD V DPHN+GAI+R+A A     +I  
Sbjct: 61  GSSA-HQGVVGLGAARKYADLDSVAESEMLVVLDGVEDPHNLGAIVRTAHAAGAGAVIVP 119

Query: 166 KRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIK 225
           +R +   + V+AK+A+GALEH+P +R++N+  AL+ +   G    GL     +  +Q   
Sbjct: 120 ERRAAGVTDVVAKAAAGALEHLPVVRVTNINRALEDLKERGMWIYGLDERGTESYDQIDY 179

Query: 226 NDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
             K  L+LG EGKGL  + ++    +  + M G I +LNVS AA V L+
Sbjct: 180 AKKSVLVLGGEGKGLHEQVRKHCDVLVRIPMAGQISSLNVSVAAGVVLF 228


>gi|259047742|ref|ZP_05738143.1| 23S rRNA (guanosine-2'-O-)-methyltransferase RlmB [Granulicatella
           adiacens ATCC 49175]
 gi|259035933|gb|EEW37188.1| 23S rRNA (guanosine-2'-O-)-methyltransferase RlmB [Granulicatella
           adiacens ATCC 49175]
          Length = 287

 Score =  128 bits (322), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 79/234 (33%), Positives = 124/234 (52%), Gaps = 11/234 (4%)

Query: 50  FLYGVHTVSAALNNPSR--KIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGK 107
           F++G H V  AL  P R  ++F    T    A    D        V+TVP   I+ +VG 
Sbjct: 48  FVFGRHAVVEALQTPDRVNRVFIQEGTSGRDAAKVIDLAREKGIQVQTVPKTKIEDLVGN 107

Query: 108 EAVHQGLALETAPLLSPTLDAV-------RNSQLLMVLDHVNDPHNIGAILRSAVAFSCD 160
            AVHQGL    A      L+ V            +++LD V DPHN+G+ILR+A A    
Sbjct: 108 -AVHQGLVASIAAYEYADLEDVFKKAEEKGEDPFIVILDGVEDPHNLGSILRTADATGVH 166

Query: 161 GIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPL 220
           GII  KR S S +A +AK+++GA+EH+P +R++NLT  ++++ + G    G   +     
Sbjct: 167 GIIIPKRRSASLTATVAKASTGAIEHVPVVRVTNLTQTIEQLKARGVWVFGTDMNGTDYR 226

Query: 221 EQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
           +   K   +A+++G EGKG+    +E+   M  + M G +++LN S A+A+ +Y
Sbjct: 227 KWNTKG-PLAIVMGNEGKGVSRIVKESVDEMVTIPMVGHVQSLNASVASALMMY 279


>gi|254456252|ref|ZP_05069681.1| RNA methyltransferase, TrmH family, group 3 [Candidatus
           Pelagibacter sp. HTCC7211]
 gi|207083254|gb|EDZ60680.1| RNA methyltransferase, TrmH family, group 3 [Candidatus
           Pelagibacter sp. HTCC7211]
          Length = 247

 Score =  128 bits (321), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 71/233 (30%), Positives = 119/233 (51%), Gaps = 7/233 (3%)

Query: 49  LFLYGVHTVSAALNNPSRKIFQLLATKNA---LARLDWDANLPHPFPVKTVPPQTIDKIV 105
            F+ G H V  AL NP+RK+ ++  T++A   + + +   N+     V     + +DK  
Sbjct: 6   FFIAGQHAVIEALRNPNRKVLRVFLTEDAKKNIHKKNSRKNVLEDVKVYFKSKKELDKYT 65

Query: 106 GKEAV-HQGLALETAPLLSPTLDAV---RNSQLLMVLDHVNDPHNIGAILRSAVAFSCDG 161
            KE + H G   E   L  P L      +     + LD V DP NIG+++RSA +F  DG
Sbjct: 66  SKEQLMHNGYIAEVEHLEQPDLKEFIKEKKDCTFVCLDEVTDPRNIGSLIRSAASFKIDG 125

Query: 162 IITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLE 221
           +I  +R+ PS+S ++ KSASG +EH+   ++SN+   L+ +    F   G  +  +K   
Sbjct: 126 LIVKERHFPSDSKLMYKSASGCMEHLNIFKVSNINSTLKNLREKNFWVYGFDARGEKNFT 185

Query: 222 QEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
                 K  L+ G+EG G++  T + A     + +   I++LN+SN+AA+  +
Sbjct: 186 DVKWEGKNVLLFGSEGFGMKEHTGKYADFFVKIDINKDIESLNISNSAAIVFH 238


>gi|296533966|ref|ZP_06896485.1| RNA methyltransferase [Roseomonas cervicalis ATCC 49957]
 gi|296265710|gb|EFH11816.1| RNA methyltransferase [Roseomonas cervicalis ATCC 49957]
          Length = 250

 Score =  128 bits (321), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 92/244 (37%), Positives = 134/244 (54%), Gaps = 3/244 (1%)

Query: 34  QSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPV 93
           Q   +  R  + P  L+LYG+HTV+AAL NP R++ +LL T  A A L      P     
Sbjct: 1   QDAGRAPREATPPNTLWLYGLHTVAAALANPRRRLKRLLLTAEAEAALAEKLPRPWKLQA 60

Query: 94  KTVPPQTIDKIVGKEAVHQGLALETAPLLSPTL-DAVRNSQ-LLMVLDHVNDPHNIGAIL 151
           + V        + ++AVHQG AL   PL    L DA+  S+  +++LD V DP N+GAIL
Sbjct: 61  ERVERARFQTFLTEDAVHQGAALLVEPLPPVALEDALEKSRGTVLLLDQVTDPRNVGAIL 120

Query: 152 RSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIG 211
           RSA AF    ++   R +P E+  +A++A GAL+ +P +R  NL   +  +   G+  +G
Sbjct: 121 RSAAAFGAAAVVMQDRNAPPETGAMARAAVGALDTVPVVREVNLARTITVLQKAGYWVMG 180

Query: 212 LSSDSKKPLEQEIKNDK-IALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAA 270
           L   +K  L      D+  AL+LGAE  GLR   +ET   +  L +   +++LNVS AAA
Sbjct: 181 LDGTAKTELAAAKPTDRPAALVLGAEDSGLRRLQRETCDELVKLPIRPEMESLNVSVAAA 240

Query: 271 VALY 274
           +ALY
Sbjct: 241 IALY 244


>gi|33861505|ref|NP_893066.1| tRNA/rRNA methyltransferase [Prochlorococcus marinus subsp.
           pastoris str. CCMP1986]
 gi|33634082|emb|CAE19407.1| tRNA/rRNA methyltransferase [Prochlorococcus marinus subsp.
           pastoris str. CCMP1986]
          Length = 428

 Score =  127 bits (320), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 83/241 (34%), Positives = 132/241 (54%), Gaps = 14/241 (5%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPH----PFPVKTVPPQTIDKIV 105
           +++G H+V AALN   R I ++  T    +   +   L         ++ VP   + ++ 
Sbjct: 190 WIWGKHSVFAALN-SERPINRIWCTSEIFSSEKFYLLLKDLKSKGVLIEEVPWSRLSQLT 248

Query: 106 GKEAVHQGLALETAPLLSPTLDAV-------RNSQLLMVLDHVNDPHNIGAILRSAVAFS 158
              AVHQG+AL+ A   S +L+ +        ++ +++ LD V DPHN GAI+RSA AF 
Sbjct: 249 SG-AVHQGVALQHASTESISLEKLIDISKSKSSNPIIVALDGVTDPHNFGAIIRSAEAFD 307

Query: 159 CDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKK 218
           C GII  +R S   +  +AK A+GALEHIP  R+ NL  A+ ++   GF  IGLS D + 
Sbjct: 308 CKGIIVPQRRSAGLTGTVAKVAAGALEHIPVSRVVNLNRAIDELKKKGFIIIGLSGDGQV 367

Query: 219 PLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVAL-YITQ 277
           P+ +  +   + +I+GAE KG+    Q+    +  + + G   +LN S AAA++L Y++ 
Sbjct: 368 PISEFKEKAPVVVIVGAENKGISLLVQKKCDYLLKIPLKGKTSSLNASVAAAISLCYLSN 427

Query: 278 N 278
           N
Sbjct: 428 N 428


>gi|300691792|ref|YP_003752787.1| tRNA guanosine-2'-O-methyltransferase [Ralstonia solanacearum
           PSI07]
 gi|299078852|emb|CBJ51513.1| tRNA guanosine-2'-O-methyltransferase [Ralstonia solanacearum
           PSI07]
          Length = 249

 Score =  127 bits (320), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 83/233 (35%), Positives = 124/233 (53%), Gaps = 9/233 (3%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLATKNALARLDWD-ANLPHPFPVKTVPP--QTIDKIVG 106
            L G H V+A L + +R I ++    N   R   D         V+ +P   + +  I G
Sbjct: 6   LLIGFHAVTARLRHDARSIDEIYFEANRRDRRMQDFLKAAEAAGVRLIPADNERLRGIAG 65

Query: 107 KEAVHQGL-----ALETAPLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDG 161
            +  HQG+     AL  A  L   LD +    LL+VLD V DPHN+GA LR A A     
Sbjct: 66  TDR-HQGVVAKAEALSLALNLDELLDGIEGPPLLLVLDGVTDPHNLGACLRVADAAGAHA 124

Query: 162 IITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLE 221
           +I  K  S   +A +AK ASGA E +PYI ++NL   L+++   G   IG + ++++ L 
Sbjct: 125 VIAPKDRSVGINATVAKVASGAAETVPYITVTNLARTLRELQQRGVWVIGTADEAEQDLY 184

Query: 222 QEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
           Q      IAL++GAEG+G+R  T+ET  ++  + M G +++LNVS A+ V L+
Sbjct: 185 QADFKGAIALVMGAEGEGMRRLTRETCDTLVSIPMAGSVESLNVSVASGVCLF 237


>gi|297183499|gb|ADI19629.1| rRNA methylases [uncultured delta proteobacterium HF0770_45N15]
          Length = 280

 Score =  127 bits (319), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 87/249 (34%), Positives = 131/249 (52%), Gaps = 16/249 (6%)

Query: 41  RHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLD--WDANLPHPFPVKTVPP 98
           +H  + +  +LYG H+V AAL +  RK+  L    +   RL    +A      P+     
Sbjct: 13  KHQQEDQLEWLYGTHSVLAALRHKRRKLVGLHLKDSGQGRLQALVEAAKKSGVPIHYEAS 72

Query: 99  QTIDKIVGKEAVHQGLALETAPL-------LSPTLDAVRNSQLLMVLDHVNDPHNIGAIL 151
           +     +G E+VHQG+AL+  PL       L P      N  L+ VLD V DPHN+GAI+
Sbjct: 73  RWFSDNLG-ESVHQGVALQCGPLSLLDEAELPPPNSGKPN--LVFVLDGVEDPHNLGAIV 129

Query: 152 RSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIG 211
           R+   F    +   K  + + S V AK++ GALE    +R++NL   L++    G+  +G
Sbjct: 130 RTLGFFGVSAVAIPKDRAAALSPVAAKASVGALEWFSVVRVTNLHRFLERQKKRGYWVVG 189

Query: 212 LSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGI--IKALNVSNAA 269
           L   S+ PL Q   +  + ++LGAEG GLRP T+ T   +  + +PG   +++LNVSNAA
Sbjct: 190 LDGASRNPLRQLEWDRPLMVVLGAEGSGLRPLTKRTCDWL--VSIPGTPEVESLNVSNAA 247

Query: 270 AVALYITQN 278
           AV  Y  +N
Sbjct: 248 AVTCYHLRN 256


>gi|300704400|ref|YP_003746003.1| tRNA guanosine-2'-o-methyltransferase [Ralstonia solanacearum
           CFBP2957]
 gi|299072064|emb|CBJ43396.1| tRNA guanosine-2'-O-methyltransferase [Ralstonia solanacearum
           CFBP2957]
          Length = 249

 Score =  127 bits (318), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 83/233 (35%), Positives = 125/233 (53%), Gaps = 9/233 (3%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLATKNALARLDWD-ANLPHPFPVKTVPP--QTIDKIVG 106
            L G H V+A L + ++ I ++    N   R   D         V+ +P   + +  I G
Sbjct: 6   LLIGFHAVTARLRHDAQSIDEIYFEANRRDRRMQDFLKAAEAAGVRLIPADNERLRGIAG 65

Query: 107 KEAVHQGL-----ALETAPLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDG 161
            +  HQG+     AL  A  L   LD +  S LL+VLD V DPHN+GA LR A A     
Sbjct: 66  TDR-HQGVVAKAEALSLALNLDELLDGIEGSPLLLVLDGVTDPHNLGACLRVADAAGAHA 124

Query: 162 IITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLE 221
           +I  K  S   +A +AK ASGA E +PYI ++NL   L+++   G   IG + ++++ L 
Sbjct: 125 VIAPKDRSVGINATVAKVASGAAETVPYITVTNLARTLRELQQRGVWVIGTADEAEQNLY 184

Query: 222 QEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
           Q      IAL++GAEG+G+R  T+ET  ++  + M G +++LNVS A+ V L+
Sbjct: 185 QADFKGPIALVMGAEGEGMRRLTRETCDTLVSIPMAGSVESLNVSVASGVCLF 237


>gi|123966264|ref|YP_001011345.1| RNA methyltransferase TrmH, group 3 [Prochlorococcus marinus str.
           MIT 9515]
 gi|123200630|gb|ABM72238.1| RNA methyltransferase TrmH, group 3 [Prochlorococcus marinus str.
           MIT 9515]
          Length = 349

 Score =  126 bits (317), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 69/177 (38%), Positives = 104/177 (58%), Gaps = 7/177 (3%)

Query: 109 AVHQGLALETAPLLSPTLDAV-------RNSQLLMVLDHVNDPHNIGAILRSAVAFSCDG 161
           AVHQG+AL+ A   + +LD +        N+ + + LD + DPHN+GAI+RSA AF C G
Sbjct: 172 AVHQGVALQLATSQTLSLDKLIGITKSKSNNPIFVALDGITDPHNLGAIIRSAEAFDCKG 231

Query: 162 IITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLE 221
           II  +R S   +  +AK A+GALEHIP  R+ NL  A+ ++   GF  +GLS D + P+ 
Sbjct: 232 IIIPQRRSAGLTGTVAKVAAGALEHIPVSRVVNLNRAIDELKKNGFLIVGLSGDGQIPIS 291

Query: 222 QEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQN 278
           +  +   I +++GAE KG+   TQ+    +  + + G   +LN S AAA++L    N
Sbjct: 292 KFDQKAPIVVVVGAENKGISLLTQKKCDYLLKIPLRGKTSSLNASVAAAISLCYLSN 348


>gi|227501072|ref|ZP_03931121.1| tRNA/rRNA methyltransferase [Anaerococcus tetradius ATCC 35098]
 gi|227216845|gb|EEI82243.1| tRNA/rRNA methyltransferase [Anaerococcus tetradius ATCC 35098]
          Length = 234

 Score =  126 bits (317), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 63/192 (32%), Positives = 112/192 (58%), Gaps = 5/192 (2%)

Query: 91  FPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDHVNDPHNIGAI 150
             +  V  +  DKI   +  HQG+ LE       T+D V+++  L++LD + DPHN+GAI
Sbjct: 45  IEISFVDKRFFDKI---DMNHQGVMLEVESFKYATMDDVKDANRLIILDKIEDPHNLGAI 101

Query: 151 LRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTI 210
           +RSA +F  DG+I  +R S S ++ + K+++GA+ +I  IR++NLT  ++ +   GF   
Sbjct: 102 IRSAESFGFDGVIIPERRSASVTSTVYKTSAGAINNIKVIRVTNLTRTIKDLKDMGFWIY 161

Query: 211 GLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAA 270
           GL+ ++   + +     K+ L++G EG+G+    +E    + ++ M G + +LN S AA 
Sbjct: 162 GLAGEADSDISKADLKGKVTLVIGNEGEGISRLVRENCDMLINIPMLGKVNSLNASVAAG 221

Query: 271 VALY--ITQNHF 280
           +++Y  + QN F
Sbjct: 222 ISMYELLRQNGF 233


>gi|254995184|ref|ZP_05277374.1| Putative tRNA/rRNA methyltransferase TrmH [Anaplasma marginale str.
           Mississippi]
          Length = 244

 Score =  126 bits (316), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 78/229 (34%), Positives = 122/229 (53%), Gaps = 13/229 (5%)

Query: 59  AALNNPSRKIFQLLATKNALARLDWDANLPHPFPV--KTVPPQTIDKIVGKEAV-HQGLA 115
           AAL NP+R    +L T   L +    A +     V  K V  + I KI+G   + HQG+A
Sbjct: 4   AALQNPNRVCRDMLVTGEFLKKYPEVARMAQSKGVYPKRVAAEKISKILGHGGMAHQGIA 63

Query: 116 LETAPLLSPTLDAVR----------NSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITT 165
           L    L       +R           +  +++LD V D +N+GAI+RSA  F  D +I  
Sbjct: 64  LMVDELSGRDGSKLRVEDIVSANPSEASTVVILDRVTDINNVGAIVRSAACFDADAVILP 123

Query: 166 KRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIK 225
           + +SPSES  + K++SGA + +P +++ NL   ++ +   G+   G+ +   K L +   
Sbjct: 124 EHHSPSESCTITKASSGAADIVPVVQVGNLVKTMEYLKQNGYWCYGMDAGGDKALHEISF 183

Query: 226 NDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
            ++ A+ILG+EGKG+R  T+E    +  + M   I +LNVSNAAA+ALY
Sbjct: 184 CERRAIILGSEGKGIRRLTREHCDHLVKIPMSARIDSLNVSNAAAIALY 232


>gi|119474664|ref|ZP_01615017.1| RNA methyltransferase, TrmH family, group 3 [marine gamma
           proteobacterium HTCC2143]
 gi|119450867|gb|EAW32100.1| RNA methyltransferase, TrmH family, group 3 [marine gamma
           proteobacterium HTCC2143]
          Length = 247

 Score =  125 bits (315), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 81/241 (33%), Positives = 124/241 (51%), Gaps = 18/241 (7%)

Query: 47  ENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPH------PFPVKTVPPQT 100
           E  +++G+H V A L   S +I +L   +    R D   N             KTVP + 
Sbjct: 3   EEHWVFGIHAVEALLQGQSNRIEELWLQQ---GRNDKRINELQLHARQVGVKCKTVPREE 59

Query: 101 IDKIVGKEAVHQGLALETAPL-------LSPTLDAVRNSQLLMVLDHVNDPHNIGAILRS 153
           +DK V  +  HQG+   T P        L   LD + +  LL++LD V DPHN+GA LR+
Sbjct: 60  LDKQV--DGRHQGVVAFTKPAQTLRDRDLKEMLDGLDHPPLLLILDGVTDPHNLGACLRT 117

Query: 154 AVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLS 213
           A A   D +I  K  S   +A + K A GA E +PYI+++NL   ++ +   G    G +
Sbjct: 118 ADAAGVDAVIAPKDSSAPLNATVRKVACGAAEVVPYIQVTNLARTMKDIQGRGIWITGTA 177

Query: 214 SDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVAL 273
            ++++ + Q      +AL++GAEGKG+R  T+E    + +L M G + +LNVS A  V L
Sbjct: 178 GEAEQSVYQANLTGPVALVMGAEGKGMRRLTRENCDYLINLPMAGSVSSLNVSVATGVCL 237

Query: 274 Y 274
           +
Sbjct: 238 F 238


>gi|227485587|ref|ZP_03915903.1| tRNA/rRNA methyltransferase [Anaerococcus lactolyticus ATCC 51172]
 gi|227236453|gb|EEI86468.1| tRNA/rRNA methyltransferase [Anaerococcus lactolyticus ATCC 51172]
          Length = 239

 Score =  125 bits (315), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 67/191 (35%), Positives = 110/191 (57%), Gaps = 5/191 (2%)

Query: 93  VKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILR 152
           +  V  +  DKI   E  HQG+ +E        L  +   Q L++LD + DPHN+GAI+R
Sbjct: 52  INFVDKRFFDKI---ELNHQGVMVEAESFEYKDLRDLDKYQRLIILDQIEDPHNLGAIIR 108

Query: 153 SAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGL 212
           SA +F  DG+I  +R S S S ++ K+++GA+ +I  I + N   A++++   GF   GL
Sbjct: 109 SAESFGFDGVIIPERRSASVSPIVYKTSAGAINNINIIMVKNTNRAIEEIKEAGFWVYGL 168

Query: 213 SSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVA 272
           + ++  P++Q     K+ LI+G EGKGL    +E    + ++ M G + +LN S A+A+A
Sbjct: 169 AGEASSPIDQVDLKGKVCLIVGNEGKGLSRLVRENCDILINIPMKGFVNSLNASVASAIA 228

Query: 273 LY--ITQNHFA 281
           +Y  + QN F+
Sbjct: 229 MYEVLRQNGFS 239


>gi|148284217|ref|YP_001248307.1| tRNA/rRNA methyltransferase [Orientia tsutsugamushi str. Boryong]
 gi|146739656|emb|CAM79445.1| tRNA/rRNA methyltransferase [Orientia tsutsugamushi str. Boryong]
          Length = 242

 Score =  125 bits (314), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 75/231 (32%), Positives = 123/231 (53%), Gaps = 12/231 (5%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEA 109
           +++G H   AALNNP R I  +  T++    L   + L      K V  + + +++G + 
Sbjct: 8   YIFGTHASLAALNNPFRVIRYIYCTESCFLSL---SKLIQKHNYKIVTTKFLHQLLGSQI 64

Query: 110 VHQGLALETAPLLSPTLDAVRNSQL------LMVLDHVNDPHNIGAILRSAVAFSCDGII 163
           VHQG+A+ T PL   T++ ++N  L      + +LD + D +N+GAI+RSA AF    II
Sbjct: 65  VHQGIAVNTIPL---TINGIKNIDLNTPNYKIAILDQLLDHNNLGAIIRSAAAFDISTII 121

Query: 164 TTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQE 223
             +  S  E+  +AK A GALE I  +++ NL + +  +    F  IGL  +    L ++
Sbjct: 122 LPENNSIEENGTIAKIAVGALEKINLVKVKNLYNTINYLKKHEFWIIGLDLNDSNQLTEQ 181

Query: 224 IKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
             + K A +LG+E KGLR  T++    +  + M    ++LNV+ AA +  Y
Sbjct: 182 TFHSKTAFVLGSENKGLRNLTRQQCDFLIKIPMSHKTESLNVAGAATIIFY 232


>gi|304312001|ref|YP_003811599.1| 23s rrna (guanosine-2\'-o-)-methyltransferase [gamma
           proteobacterium HdN1]
 gi|301797734|emb|CBL45956.1| 23s rrna (guanosine-2\'-o-)-methyltransferase [gamma
           proteobacterium HdN1]
          Length = 248

 Score =  125 bits (313), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 77/237 (32%), Positives = 124/237 (52%), Gaps = 13/237 (5%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDA---NLPHPFPVKTVPPQTIDKIVG 106
           +LYG+H+VSA L     ++ +L   +    +   D       H    + +P +T+D  + 
Sbjct: 6   WLYGIHSVSAILERHPDRVLELFIVETREDKRIGDIIKLAKTHGLRAQFIPKKTMDHQLE 65

Query: 107 KEAVHQGLALETAPL-------LSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSC 159
           + AVHQG+A+   P        L   ++       L+ LD + DPHN+GA LRSA A   
Sbjct: 66  EGAVHQGVAIRYRPSAPGDENDLKHLVENANAPLFLLFLDGITDPHNLGACLRSADAAGV 125

Query: 160 DGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIG--LSSDSK 217
             +ITT+  S   SA + K A GA E +P+I+++NL   L+ +   G    G  LS  +K
Sbjct: 126 HAVITTRDKSAGLSAAVRKVAVGAAETVPFIQVTNLARTLEMVRQQGVWVYGTALSEGAK 185

Query: 218 KPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
              E +++ + I +++GAEG GLR  TQ+    + ++ M G +++LNVS A  V L+
Sbjct: 186 TIYETDLRGN-IGIVMGAEGVGLRRLTQDCCDGLVYIPMAGTVQSLNVSVATGVCLF 241


>gi|171778431|ref|ZP_02919589.1| hypothetical protein STRINF_00440 [Streptococcus infantarius subsp.
           infantarius ATCC BAA-102]
 gi|171282832|gb|EDT48256.1| hypothetical protein STRINF_00440 [Streptococcus infantarius subsp.
           infantarius ATCC BAA-102]
          Length = 249

 Score =  125 bits (313), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 81/248 (32%), Positives = 129/248 (52%), Gaps = 35/248 (14%)

Query: 47  ENLFLYGVHTVSAALN-NPSRKIF-------------QLLATKNALARLDWDANLPHPFP 92
           +N  +YGVH V+ AL  N   K++             ++LAT+  ++ + W        P
Sbjct: 9   QNDIVYGVHAVTEALQANTGNKLYIQDDLRGKNVDKIKMLATEKKVS-ISWT-------P 60

Query: 93  VKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAV------RNSQLLMVLDHVNDPHN 146
            KT+   T        AVHQG  L  +      LD++        + L+++LD +NDPHN
Sbjct: 61  KKTLSDMT------NGAVHQGFVLRVSEFAYAELDSILEKAVQEENPLILILDELNDPHN 114

Query: 147 IGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWG 206
            G+ILR+A A +  G+I  K  +   + V+AK+++GA+EH+P  R++NL+  L K+   G
Sbjct: 115 FGSILRTADATNVTGVIIPKHRAVGVTPVVAKTSTGAVEHVPIARVTNLSQTLDKLKEQG 174

Query: 207 FQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVS 266
           F   G   +   P  +     K+ALI+G EGKG+ P  ++    M  + M G +++LN S
Sbjct: 175 FWVFGTDMNG-TPSHKWNTAGKLALIIGNEGKGISPNIKKQVDEMITIPMNGHVQSLNAS 233

Query: 267 NAAAVALY 274
            AAAV +Y
Sbjct: 234 VAAAVLMY 241


>gi|146305679|ref|YP_001186144.1| RNA methyltransferase [Pseudomonas mendocina ymp]
 gi|145573880|gb|ABP83412.1| 23S rRNA Gm-2251 2'-O-methyltransferase [Pseudomonas mendocina ymp]
          Length = 250

 Score =  124 bits (311), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 82/234 (35%), Positives = 120/234 (51%), Gaps = 12/234 (5%)

Query: 51  LYGVHTVSAALNNPSRKIFQL-LATKNALARLDWDANLP--HPFPVKTVPPQTIDKIVGK 107
           +YGVH V A L +  +++ QL LA      R+     L   H  PV     Q +D+    
Sbjct: 7   VYGVHAVEALLRHHPKRVKQLWLAESRQAPRIQPMLELAAQHRVPVGHKERQELDEWA-- 64

Query: 108 EAVHQGLALETAP-------LLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCD 160
           E VHQG+  E +P       +L   L+      LL+VLD V DPHN+GA LR+A A    
Sbjct: 65  EGVHQGVVAEVSPSQVWGENMLDELLERSEGVPLLLVLDGVTDPHNLGACLRTADAAGAQ 124

Query: 161 GIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPL 220
            +I  K  S + +A + K A GA E IP + ++NL   L+K+   G   +G + ++++ L
Sbjct: 125 AVIVPKDKSATLNATVRKVACGAAEVIPLVAVTNLARTLEKLQKKGLWVVGTAGEAEQEL 184

Query: 221 EQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
            Q        L++GAEGKG+R  T+E    +  L M G + +LNVS A  V L+
Sbjct: 185 YQLDMTGPTVLVMGAEGKGMRRLTREHCDYLVKLPMGGSVSSLNVSVATGVCLF 238


>gi|74316627|ref|YP_314367.1| RNA methyltransferase TrmH [Thiobacillus denitrificans ATCC 25259]
 gi|74056122|gb|AAZ96562.1| RNA methyltransferase TrmH [Thiobacillus denitrificans ATCC 25259]
          Length = 254

 Score =  124 bits (311), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 77/247 (31%), Positives = 127/247 (51%), Gaps = 18/247 (7%)

Query: 43  TSQPENLFLYGVHTVSAALNNPSRKIFQL---LATKNALARLDWDANLPH-----PFPVK 94
           + +P    +YG H V A L +    + ++   L  ++A AR     +L H        + 
Sbjct: 2   SEKPAERLIYGFHAVLARLRHDPAGVLEIYLDLTRRDARAR-----DLVHQARDSGVKLA 56

Query: 95  TVPPQTIDKIVGKEAVHQGLALETAPL-----LSPTLDAVRNSQLLMVLDHVNDPHNIGA 149
            V    + ++VGK A HQG+     P+     L   L+++    LL++LD V DPHN+GA
Sbjct: 57  QVEADRLGRLVGKAAKHQGVVARVKPVALTHSLDEVLESIEGPPLLVILDGVTDPHNLGA 116

Query: 150 ILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQT 209
           ILRSA AF    +I  K  +   +A + K ASGA + +PY+ ++NL   ++++       
Sbjct: 117 ILRSADAFGAHAVIAPKDNAVGINATVEKVASGAADTVPYLMVTNLARTIEELKEHDIWV 176

Query: 210 IGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAA 269
           I    D ++PL        +A +LGAEG G+R   ++    +A + + G +++LNVS +A
Sbjct: 177 IAADMDGEQPLSGIDVRSGVAWVLGAEGAGIRRLVKQRCDQVARIPIGGTVESLNVSVSA 236

Query: 270 AVALYIT 276
           A+ LY T
Sbjct: 237 ALCLYET 243


>gi|254497333|ref|ZP_05110138.1| tRNA/rRNA methyltransferase [Legionella drancourtii LLAP12]
 gi|254353445|gb|EET12175.1| tRNA/rRNA methyltransferase [Legionella drancourtii LLAP12]
          Length = 250

 Score =  124 bits (310), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 78/238 (32%), Positives = 127/238 (53%), Gaps = 17/238 (7%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLATKNALARLD------WDANLPHPFPVKTVPPQTIDK 103
           F+YGVH VSA L NP R   +L  +++   R+D       D  +     ++ +  Q +++
Sbjct: 5   FVYGVHAVSALLANPHRTTKKLFVSQD---RVDKRLQDLVDKAVQARIGIEKLSTQQMNQ 61

Query: 104 IVGKEAVHQGLALETAPL-------LSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVA 156
               E  HQG+    + L       L   L++ ++  L+++LD + DPHN+GA LR+A A
Sbjct: 62  RFA-EFNHQGIVASASALPDYNESHLRALLESSKSPGLILILDGITDPHNLGACLRTADA 120

Query: 157 FSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDS 216
              D ++  K  S S + V++K A GA E +P +R++NL  ++  +   G    G + ++
Sbjct: 121 TGVDFVVIPKDKSASITPVVSKVACGAAESVPLVRVTNLVRSMDLLKEQGVWIYGAAGEA 180

Query: 217 KKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
           +  L Q      IAL++GAEG+GLR  T+E    +  L M G + +LNVS A  V+LY
Sbjct: 181 EHSLYQVDCRGTIALVMGAEGEGLRRLTREHCDGLFSLPMSGSVDSLNVSVATGVSLY 238


>gi|17545948|ref|NP_519350.1| tRNA/rRNA methyltransferase [Ralstonia solanacearum GMI1000]
 gi|52783318|sp|Q8Y016|RLMB_RALSO RecName: Full=23S rRNA (guanosine-2'-O-)-methyltransferase RlmB;
           AltName: Full=23S rRNA Gm2251 2'-O-methyltransferase
 gi|17428243|emb|CAD14931.1| probable 23s rrna (guanosine-2'-o-)-methyltransferase rlmb (23srrna
           gm2251 2'-o-methyltransferase) protein [Ralstonia
           solanacearum GMI1000]
          Length = 249

 Score =  124 bits (310), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 81/233 (34%), Positives = 123/233 (52%), Gaps = 9/233 (3%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLATKNALARLDWD-ANLPHPFPVKTVPP--QTIDKIVG 106
            L G H V+A L + +R I ++    N   R   D         V+ +P   + +  I G
Sbjct: 6   LLIGFHAVTARLRHDARSIDEIYFEANRRDRRMQDFLKAAEAAGVRMIPADNERLRGIAG 65

Query: 107 KEAVHQGL-----ALETAPLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDG 161
            +  HQG+     AL  A  L   LD +    LL+VLD V DPHN+GA LR A A     
Sbjct: 66  TDR-HQGVVAKAEALSLALNLDELLDGIEGPPLLLVLDGVTDPHNLGACLRVADAAGAHA 124

Query: 162 IITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLE 221
           +I  K  S   +  +AK ASGA E +PYI ++NL   L+++   G   IG + ++++ L 
Sbjct: 125 VIAPKDRSVGINTTVAKVASGAAETVPYITVTNLARTLRELQQRGVWVIGTADEAEQDLY 184

Query: 222 QEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
           +      IAL++GAEG+G+R  T+ET  ++  + M G +++LNVS A+ V L+
Sbjct: 185 RADFKGPIALVMGAEGEGMRRLTRETCDTLVSIPMAGSVESLNVSVASGVCLF 237


>gi|83747961|ref|ZP_00944992.1| 23S rRNA Gm2251 methyltransferase [Ralstonia solanacearum UW551]
 gi|207723179|ref|YP_002253578.1| 23s rrna (guanosine-2'-o-)-methyltransferase rlmb (23srrna gm2251
           2'-o-methyltransferase) protein [Ralstonia solanacearum
           MolK2]
 gi|207743429|ref|YP_002259821.1| 23s rrna (guanosine-2'-o-)-methyltransferase rlmb (23srrna gm2251
           2'-o-methyltransferase) protein [Ralstonia solanacearum
           IPO1609]
 gi|83725379|gb|EAP72526.1| 23S rRNA Gm2251 methyltransferase [Ralstonia solanacearum UW551]
 gi|206588373|emb|CAQ35336.1| 23s rrna (guanosine-2'-o-)-methyltransferase rlmb (23srrna gm2251
           2'-o-methyltransferase) protein [Ralstonia solanacearum
           MolK2]
 gi|206594826|emb|CAQ61753.1| 23s rrna (guanosine-2'-o-)-methyltransferase rlmb (23srrna gm2251
           2'-o-methyltransferase) protein [Ralstonia solanacearum
           IPO1609]
          Length = 249

 Score =  124 bits (310), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 82/233 (35%), Positives = 124/233 (53%), Gaps = 9/233 (3%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLATKNALARLDWD-ANLPHPFPVKTVPP--QTIDKIVG 106
            L G H V+A L + ++ I ++    N   R   D         V+ +P   + +  I G
Sbjct: 6   LLIGFHAVTARLRHDAQSIDEIYFEANRRDRRMQDFLKAAEAAGVRLIPADNERLRGIAG 65

Query: 107 KEAVHQGL-----ALETAPLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDG 161
            +  HQG+     AL  A  L   LD +    LL+VLD V DPHN+GA LR A A     
Sbjct: 66  TDR-HQGVVAKAEALSLALNLDELLDGIDGPPLLLVLDGVTDPHNLGACLRVADAAGAHA 124

Query: 162 IITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLE 221
           +I  K  S   +A +AK ASGA E +PYI ++NL   L+++   G   IG + ++++ L 
Sbjct: 125 VIAPKDRSVGINATVAKVASGAAETVPYITVTNLARTLRELQQRGVWVIGTADEAEQNLY 184

Query: 222 QEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
           Q      IAL++GAEG+G+R  T+ET  ++  + M G +++LNVS A+ V L+
Sbjct: 185 QADFKGPIALVMGAEGEGMRRLTRETCDTLVSIPMAGSVESLNVSVASGVCLF 237


>gi|299067280|emb|CBJ38477.1| tRNA guanosine-2'-O-methyltransferase [Ralstonia solanacearum
           CMR15]
          Length = 249

 Score =  124 bits (310), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 81/233 (34%), Positives = 123/233 (52%), Gaps = 9/233 (3%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLATKNALARLDWD-ANLPHPFPVKTVPP--QTIDKIVG 106
            L G H V+A L + +R I ++    N   R   D         V+ +P   + +  I G
Sbjct: 6   LLIGFHAVTARLRHDARSIDEIYFEANRRDRRMQDFLKAAEAAGVRMIPADNERLRGIAG 65

Query: 107 KEAVHQGL-----ALETAPLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDG 161
            +  HQG+     AL  A  L   LD +    LL+VLD V DPHN+GA LR A A     
Sbjct: 66  TDR-HQGVVAKAEALSLALNLDELLDGIEGPPLLLVLDGVTDPHNLGACLRVADAAGAHA 124

Query: 162 IITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLE 221
           +I  K  S   +  +AK ASGA E +PYI ++NL   L+++   G   IG + ++++ L 
Sbjct: 125 VIAPKDRSVGINTTVAKVASGAAETVPYITVTNLARTLRELQQRGVWVIGTADEAEQDLY 184

Query: 222 QEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
           +      IAL++GAEG+G+R  T+ET  ++  + M G +++LNVS A+ V L+
Sbjct: 185 RADFKGPIALVMGAEGEGMRRLTRETCDALVSIPMAGSVESLNVSVASGVCLF 237


>gi|24378679|ref|NP_720634.1| putative tRNA/rRNA methyltransferase [Streptococcus mutans UA159]
 gi|24376542|gb|AAN57940.1|AE014868_2 putative tRNA/rRNA methyltransferase [Streptococcus mutans UA159]
          Length = 248

 Score =  124 bits (310), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 84/244 (34%), Positives = 129/244 (52%), Gaps = 14/244 (5%)

Query: 41  RHTSQPENL-FLYGVHTVSAALN-NPSRKIF--QLLATKNALARLDWDANLPHPFPVKTV 96
           R+    EN   +YGVH V  +L  N   K++    L  KN     D  A      P+   
Sbjct: 2   RYKDFTENTDIVYGVHAVIESLQANTGHKLYIQNDLRGKNVDKIKDLAAE--KKVPISWT 59

Query: 97  PPQTIDKIVGKEAVHQGLALETAPLLSPTLDAV------RNSQLLMVLDHVNDPHNIGAI 150
           P +T+  +  K AVHQG  L  +       + +       ++ LL++LD +NDPHN G+I
Sbjct: 60  PKKTLSDMT-KGAVHQGFILHVSAFAYTEFEMLLKKAEREDNPLLLILDELNDPHNFGSI 118

Query: 151 LRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTI 210
           LR+A A +  GII TK  +   + V+AK+++GA+EHIP  R++NL  AL K+ + GF   
Sbjct: 119 LRTADATNVTGIIITKHRAVGVTPVVAKTSTGAVEHIPIARVTNLGQALDKLKAAGFWIF 178

Query: 211 GLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAA 270
           G   +   P  Q   + K+ALI+G EG+G+    ++    M  + M G +++LN S AAA
Sbjct: 179 GTDMNG-TPSTQWNTSGKLALIIGNEGRGISHNIKKQVDEMVTIPMNGHVQSLNASVAAA 237

Query: 271 VALY 274
           + +Y
Sbjct: 238 ILMY 241


>gi|68171778|ref|ZP_00545123.1| RNA methyltransferase TrmH, group 3 [Ehrlichia chaffeensis str.
           Sapulpa]
 gi|67998803|gb|EAM85510.1| RNA methyltransferase TrmH, group 3 [Ehrlichia chaffeensis str.
           Sapulpa]
          Length = 218

 Score =  124 bits (310), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 73/217 (33%), Positives = 119/217 (54%), Gaps = 18/217 (8%)

Query: 62  NNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPL 121
           NN   KI +L   KN                +K V P  I+ ++   + HQG+AL+ + +
Sbjct: 4   NNEISKILRLCKQKN--------------INLKQVNPNYINSVLPHNSNHQGIALKASVI 49

Query: 122 LSPTLDAVRN----SQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLA 177
            S T++ V N    S  +++LD V D HN+G+I+RSAV F+ D II     SPSE+  ++
Sbjct: 50  DSTTVEEVLNTSKESSTIILLDQVTDIHNVGSIIRSAVCFNVDAIILPYHNSPSENCGMS 109

Query: 178 KSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEG 237
           K++SGA++ IP + + N+ + ++ +   G+   G  +   + L +   + K  +I G+E 
Sbjct: 110 KTSSGAVDMIPIVYVINIVNTIKLLKKAGYWCYGFDAKEGEFLHKTKLDSKKLIIFGSED 169

Query: 238 KGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
           KG+R  T+E    +  + +   I +LNVSNAAAVALY
Sbjct: 170 KGMRKLTKENCDFLLKIAISKKIDSLNVSNAAAVALY 206


>gi|220934084|ref|YP_002512983.1| RNA methyltransferase, TrmH family, group 3 [Thioalkalivibrio sp.
           HL-EbGR7]
 gi|219995394|gb|ACL71996.1| RNA methyltransferase, TrmH family, group 3 [Thioalkalivibrio sp.
           HL-EbGR7]
          Length = 248

 Score =  123 bits (309), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 83/242 (34%), Positives = 127/242 (52%), Gaps = 14/242 (5%)

Query: 44  SQPENLFLYGVHTVSAALN---NPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQT 100
           S+P+  FL+G+H V AAL     P   ++     K+A  R   DA       V+ V  Q 
Sbjct: 2   SEPQ--FLFGLHAVLAALTRKPTPVTTLWVDAGRKDARMREILDAARKAGVTVERVDAQA 59

Query: 101 IDKIVGKEAVHQGLALE----TAPLLS----PTLDAVRNSQLLMVLDHVNDPHNIGAILR 152
           ++++    A HQG+  E      P ++    P L     S LL+VLD V DPHN+GA LR
Sbjct: 60  LERLC-PGARHQGVVAERIQEAGPEITEADLPNLVGRVASPLLLVLDGVTDPHNLGACLR 118

Query: 153 SAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGL 212
           +A A   D +I  +  +   + V  K ASGA E +P+++++NL   L ++   G   IG 
Sbjct: 119 TADAAGVDAVIVPRDRAAGLTPVARKVASGAAEVVPFVQVTNLARTLDQLKQAGVWIIGT 178

Query: 213 SSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVA 272
           S D+ + L Q      IA+++GAEG+G+R  T+E    + ++ M G + +LNVS A  V 
Sbjct: 179 SGDAPQTLYQADLKGPIAIVMGAEGQGMRRLTRERCDLLVNIPMQGSVSSLNVSVATGVC 238

Query: 273 LY 274
           L+
Sbjct: 239 LF 240


>gi|312958662|ref|ZP_07773182.1| RNA methyltransferase TrmH, group 3 [Pseudomonas fluorescens WH6]
 gi|311287205|gb|EFQ65766.1| RNA methyltransferase TrmH, group 3 [Pseudomonas fluorescens WH6]
          Length = 251

 Score =  123 bits (309), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 82/238 (34%), Positives = 124/238 (52%), Gaps = 10/238 (4%)

Query: 51  LYGVHTVSAALNNPSRKIFQL-LATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEA 109
           +YGVH V A L +  +++ Q+ LA   +  R+     L     V     +  +  V  E 
Sbjct: 6   IYGVHAVEALLRHHPKRVKQVWLAEGRSEPRVQALVELATQNKVAIGQAERREMDVWVEG 65

Query: 110 VHQGLALETAP-------LLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGI 162
           VHQG+  + +P       +L   LD    + LL+VLD V DPHN+GA LRSA A     +
Sbjct: 66  VHQGVVADVSPSQVWGEAMLDELLDRTEGAPLLLVLDGVTDPHNLGACLRSADAAGALAV 125

Query: 163 ITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPL-E 221
           I  K  S + + V+ K A GA E IP + ++NL   L+K+   G   +G + +++  + +
Sbjct: 126 IVPKDKSATLTPVVRKVACGAAEVIPLVAVTNLARTLEKLQQRGLWIVGTAGEAEVSIYD 185

Query: 222 QEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNH 279
           Q++    I LI+GAEGKG+R  T+E    + HL M G + +LNVS A  V L+  Q  
Sbjct: 186 QDLTGPTI-LIMGAEGKGMRRLTREHCDYLVHLPMAGSVSSLNVSVATGVCLFEAQRQ 242


>gi|241662769|ref|YP_002981129.1| TrmH family RNA methyltransferase [Ralstonia pickettii 12D]
 gi|240864796|gb|ACS62457.1| RNA methyltransferase, TrmH family, group 3 [Ralstonia pickettii
           12D]
          Length = 250

 Score =  123 bits (308), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 78/233 (33%), Positives = 122/233 (52%), Gaps = 9/233 (3%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLATKNALARLDWD-ANLPHPFPVKTVPPQTIDKIVGKE 108
            L G H V+A L + ++ I ++    N   R   D         V+ +P    D++ G  
Sbjct: 6   LLIGFHAVTARLRHGAKSIDEIYFEANRRDRRMQDFLKAAEAAGVRLIPADA-DRLRGIA 64

Query: 109 AV--HQGLALETAPL-----LSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDG 161
               HQG+  +   L     L   LD +  + LL+VLD V DPHN+GA LR A A     
Sbjct: 65  GTDRHQGVVAKAESLSLALNLDELLDGIEGTPLLLVLDGVTDPHNLGACLRVADAAGAHA 124

Query: 162 IITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLE 221
           +I  K  S   +  +AK ASGA E +PYI ++NL   L+++   G   IG + ++++ L 
Sbjct: 125 VIAPKDRSVGINTTVAKVASGAAETVPYITVTNLARTLRELQERGVWVIGTADEAEQDLY 184

Query: 222 QEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
           Q      IA+++GAEG+G+R  T+ET  ++  + M G +++LNVS A+ V L+
Sbjct: 185 QADFKGPIAIVMGAEGEGMRRLTRETCDALVSIPMAGSVESLNVSVASGVCLF 237


>gi|52840348|ref|YP_094147.1| tRNA/rRNA methyltransferase [Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1]
 gi|52627459|gb|AAU26200.1| tRNA/rRNA methyltransferase [Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1]
          Length = 258

 Score =  123 bits (308), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 85/243 (34%), Positives = 127/243 (52%), Gaps = 27/243 (11%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKT----VPPQTIDKIV 105
           ++YG+H VSA L NP R I +L   ++   R+D      H F VK     VP   I+K+ 
Sbjct: 14  YVYGLHAVSALLANPHRMIKKLFVNQD---RID---KRLHEFLVKAENAHVP---IEKLS 64

Query: 106 GK-------EAVHQGLALETAPL-------LSPTLDAVRNSQLLMVLDHVNDPHNIGAIL 151
            +       E  HQG+    + L       L   L+  +   L+++LD + DPHN+GA L
Sbjct: 65  AQKMNQQFSEFTHQGVVALASALAEYGESDLVTLLEKSKKPVLILILDGITDPHNLGACL 124

Query: 152 RSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIG 211
           RSA A   D ++  K  S S + V++K A GA E IP +R++NL  A+  +   G    G
Sbjct: 125 RSADATGVDFVVIPKDKSASITPVVSKVACGAAESIPLVRVTNLARAMDILKQQGVWIFG 184

Query: 212 LSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAV 271
            + +++  L     +  IAL++GAEG GLR  T+E    +  L M G +++LNVS A  V
Sbjct: 185 AAGEAENLLYAMDCSGNIALVMGAEGTGLRRLTREHCDGLFSLPMMGSVESLNVSVATGV 244

Query: 272 ALY 274
           +LY
Sbjct: 245 SLY 247


>gi|319786532|ref|YP_004146007.1| RNA methyltransferase, TrmH family, group 3 [Pseudoxanthomonas
           suwonensis 11-1]
 gi|317465044|gb|ADV26776.1| RNA methyltransferase, TrmH family, group 3 [Pseudoxanthomonas
           suwonensis 11-1]
          Length = 248

 Score =  122 bits (307), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 75/239 (31%), Positives = 128/239 (53%), Gaps = 13/239 (5%)

Query: 47  ENLFLYGVHTVSAALNNPSRKIFQLLATKNA----LARLDWDANLPHPFPVKTVPPQTID 102
           +N ++ GV+ V++A+ N +  + ++L   +A    L  ++  A   +   V+ V  Q +D
Sbjct: 4   QNQWVVGVNAVASAIENDAEHVREVLVDSSARNPRLVEIEEQAR-RYGIEVRKVATQALD 62

Query: 103 KIVGKEAVHQGLALETAPL-------LSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAV 155
            I G    HQG+A   A         L+  ++A     LL+VLD V DPHN+GA LRSA+
Sbjct: 63  GI-GGNVRHQGVAARYAAAKTWGEGELAGLVEAADGKALLLVLDGVQDPHNLGACLRSAL 121

Query: 156 AFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSD 215
           A     ++  +  S   +A + K+++GA + +P ++++NL   L+++   G    GL+ +
Sbjct: 122 AAGATAVVIPRDKSAPVNATVRKTSAGAADRLPVVQVTNLARTLRELQKQGVWIYGLAGE 181

Query: 216 SKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
             + L        +AL+LG E  GLR  T+ET   +  + MPG +++LNVS AA V L+
Sbjct: 182 VDETLYGVDLKGNVALVLGGEADGLRRLTRETCDGLVRIPMPGDVESLNVSVAAGVCLF 240


>gi|256372653|ref|YP_003110477.1| RNA methyltransferase, TrmH family, group 3 [Acidimicrobium
           ferrooxidans DSM 10331]
 gi|256009237|gb|ACU54804.1| RNA methyltransferase, TrmH family, group 3 [Acidimicrobium
           ferrooxidans DSM 10331]
          Length = 251

 Score =  122 bits (307), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 60/184 (32%), Positives = 112/184 (60%), Gaps = 2/184 (1%)

Query: 91  FPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDHVNDPHNIGAI 150
            PV+ +PP+  +++   E VHQG+  +  P++   LD + +  LL+V+DH+ DPHN+GA+
Sbjct: 59  VPVELLPPERFERVARTE-VHQGVLADCDPVVDVGLDGLADGSLLVVVDHLEDPHNLGAV 117

Query: 151 LRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTI 210
           LRSA AF  DG++  +  S   +  + K A+G +E + +  +S++  AL+++ + G  ++
Sbjct: 118 LRSAAAFGADGVVLPRYRSVPLTPTVTKVAAGGVEWLRFALVSSIPAALRRLRARGVWSV 177

Query: 211 GLSSDSKKPL-EQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAA 269
           GL +D+   +    +  +++AL++GAEG+GL P  +      A + +   + +LN S AA
Sbjct: 178 GLDADAATSVFSLTLATERLALVVGAEGRGLAPLVRRGVDVTAAIPLAATVASLNASVAA 237

Query: 270 AVAL 273
           ++AL
Sbjct: 238 SIAL 241


>gi|56476097|ref|YP_157686.1| tRNA/rRNA methyltransferase protein [Aromatoleum aromaticum EbN1]
 gi|56312140|emb|CAI06785.1| tRNA/RRNA methyltransferase protein [Aromatoleum aromaticum EbN1]
          Length = 244

 Score =  122 bits (307), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 74/236 (31%), Positives = 123/236 (52%), Gaps = 9/236 (3%)

Query: 47  ENLFLYGVHTVSAALNNPSRKIFQL-LATKNALARLDWDANLPHPFPVKTVPPQT--IDK 103
           E+  +YG H V   L      +F+L L+ +   AR      L     V+ +  +   +D 
Sbjct: 2   ESRLIYGFHAVLGKLRRDPESVFELYLSAQRTDARAKDVVRLAESQNVRLIQAEAERLDG 61

Query: 104 IVGKEAVHQGLALETAPL-----LSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFS 158
           +VG    HQG+            L+  L+ +  + L++VLD V DPHN+GA LR A A  
Sbjct: 62  MVGTRR-HQGVVARVDAKSRELKLADVLEVLEENALILVLDGVQDPHNLGACLRVADAVG 120

Query: 159 CDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKK 218
              ++  K  +   +A   K ASGA + +PY+ ++NL  AL++M   G   +G + +++K
Sbjct: 121 AHAVVAPKDRAVGLNATAIKVASGAADSVPYVTVTNLARALREMQEAGIWVVGAAGEAEK 180

Query: 219 PLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
            + +  +   +A +LGAEG GLR  T+ET   +A + M G +++LNVS A+ + L+
Sbjct: 181 SVYEVDQKGPVAWVLGAEGDGLRRLTRETCDELARIPMLGTVESLNVSVASGICLF 236


>gi|237745438|ref|ZP_04575918.1| RNA methyltransferase [Oxalobacter formigenes HOxBLS]
 gi|229376789|gb|EEO26880.1| RNA methyltransferase [Oxalobacter formigenes HOxBLS]
          Length = 248

 Score =  122 bits (307), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 74/236 (31%), Positives = 121/236 (51%), Gaps = 9/236 (3%)

Query: 47  ENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWD---ANLPHPFPVKTVPPQTIDK 103
           +N  ++G H V++ L + +  + ++        R   D   A       +     Q +DK
Sbjct: 2   KNKVIFGFHAVTSRLRHEASSVEEIYVDSERSDRRMQDLLKAAKAAGIRIIAADSQRLDK 61

Query: 104 IVGKEAVHQGLALETAPL-----LSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFS 158
           +VG    HQG+    APL     L   LD++  + LL+VLD + DPHN+GA LR A +  
Sbjct: 62  MVGTRR-HQGVVAMAAPLSLARNLDELLDSIEGAPLLLVLDGITDPHNLGACLRVADSVG 120

Query: 159 CDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKK 218
              +I  K  S   +A + K ASGA E +PYI ++NL   L+++       +G + DS K
Sbjct: 121 AHAVIAPKDRSAGINATVEKVASGAAETVPYITVTNLARTLRQLKERDIWVVGTADDSDK 180

Query: 219 PLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
            L +       A ++G+EG+G+R  T+ET   +  + M G +++LN+S A+ + LY
Sbjct: 181 SLYEPDYAGGTAFVMGSEGEGMRRLTKETCDELVAIPMFGSVESLNISVASGICLY 236


>gi|119897231|ref|YP_932444.1| tRNA/rRNA methyltransferase [Azoarcus sp. BH72]
 gi|119669644|emb|CAL93557.1| tRNA/rRNA methyltransferase [Azoarcus sp. BH72]
          Length = 254

 Score =  122 bits (307), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 77/233 (33%), Positives = 124/233 (53%), Gaps = 9/233 (3%)

Query: 50  FLYGVHTVSAALNNPSRKIFQL-LATKNALARLDWDANLPHPFPVKTVPPQ--TIDKIVG 106
            +YG H VSA L +    + ++ L+     AR+            + VP +   +D +VG
Sbjct: 12  LIYGFHAVSAKLRHAPEAVLEVYLSGDRKDARVKKFLATAEAIGTRIVPSEHERLDALVG 71

Query: 107 KEAVHQGL-----ALETAPLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDG 161
               HQG+     A      L+  LD +  + L++VLD V DPHN+GA LR A A     
Sbjct: 72  TRR-HQGVVARIDATRREIKLADVLDNLDENALILVLDGVQDPHNLGACLRVADAAGAHA 130

Query: 162 IITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLE 221
           ++  K  +   +A  AK ASGA + +PYI ++NL  AL++M   G   +G + +++K + 
Sbjct: 131 VVAPKDRAVGLNATAAKVASGAADTVPYITVTNLARALREMQEAGVWVVGAAGEAEKSVY 190

Query: 222 QEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
           Q  +   +A +LGAEG GLR  T++T   +A + M G +++LNVS A+ + L+
Sbjct: 191 QVDQRGPLAWVLGAEGDGLRRLTRDTCDELAQIPMHGSVESLNVSVASGICLF 243


>gi|229588085|ref|YP_002870204.1| 23s rRNA (guanosine-2'-o-)-methyltransferase [Pseudomonas
           fluorescens SBW25]
 gi|229359951|emb|CAY46805.1| 23s rRNA (guanosine-2'-o-)-methyltransferase [Pseudomonas
           fluorescens SBW25]
          Length = 251

 Score =  122 bits (307), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 81/233 (34%), Positives = 123/233 (52%), Gaps = 10/233 (4%)

Query: 51  LYGVHTVSAALNNPSRKIFQL-LATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEA 109
           +YGVH V A L +  +++ Q+ LA   +  R+     L     V     +  +  V  E 
Sbjct: 6   IYGVHAVEALLRHHPKRVKQVWLAEGRSEPRVQALVELATQNKVAIGQAERREMDVWVEG 65

Query: 110 VHQGLALETAP-------LLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGI 162
           VHQG+  + +P       +L   LD    + LL+VLD V DPHN+GA LRSA A     +
Sbjct: 66  VHQGVVADVSPSQVWGEAMLDELLDRTEGAPLLLVLDGVTDPHNLGACLRSADAAGALAV 125

Query: 163 ITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPL-E 221
           I  K  S + + V+ K A GA E IP + ++NL   L+K+   G   +G + +++  + +
Sbjct: 126 IVPKDKSATLTPVVRKVACGAAEVIPLVAVTNLARTLEKLQQRGLWVVGTAGEAEVSIYD 185

Query: 222 QEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
           Q++    I LI+GAEGKG+R  T+E    + HL M G + +LNVS A  V L+
Sbjct: 186 QDLTGPTI-LIMGAEGKGMRRLTREHCDYLVHLPMAGSVSSLNVSVATGVCLF 237


>gi|89094562|ref|ZP_01167500.1| hypothetical protein MED92_00984 [Oceanospirillum sp. MED92]
 gi|89081161|gb|EAR60395.1| hypothetical protein MED92_00984 [Oceanospirillum sp. MED92]
          Length = 245

 Score =  122 bits (307), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 76/235 (32%), Positives = 123/235 (52%), Gaps = 13/235 (5%)

Query: 51  LYGVHTVSAALNNPSRKIFQLLATKN----ALARLDWDANLPHPFPVKTVPPQTIDKIVG 106
           L+G+H V+ AL   +++I ++L  K      + RL  D  L     ++ V  + ++++V 
Sbjct: 6   LFGIHAVNTALKRDAQRIHKILIMKGRQDAKMQRL-IDTALDLRIRIEQVSKRELEELV- 63

Query: 107 KEAVHQGLALETAPL-------LSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSC 159
           K AVHQG+     P+       L   LD +     L++LD V DPHN+GA LR+A A   
Sbjct: 64  KGAVHQGVVALCKPIQTYNEQYLDKLLDQLEEPPFLLILDGVTDPHNLGACLRTADAAGV 123

Query: 160 DGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKP 219
             ++  K  S   +A  AK A GA E +PY+ ++NL   L+ +   G  T G + ++   
Sbjct: 124 QAVVAPKDKSAPLNATAAKVACGAAESVPYVLVTNLARTLKSLQERGVWTTGTAGETDLD 183

Query: 220 LEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
           + Q      +ALI+GAEG+G+R  T+E    +  + M G + +LNVS A  + L+
Sbjct: 184 IYQANLKGPMALIMGAEGQGMRRLTREHCDQLVKIPMAGEVSSLNVSVATGICLF 238


>gi|78779235|ref|YP_397347.1| RNA methyltransferase TrmH, group 3 [Prochlorococcus marinus str.
           MIT 9312]
 gi|78712734|gb|ABB49911.1| RNA methyltransferase TrmH, group 3 [Prochlorococcus marinus str.
           MIT 9312]
          Length = 336

 Score =  122 bits (306), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 67/173 (38%), Positives = 105/173 (60%), Gaps = 7/173 (4%)

Query: 109 AVHQGLALETAPLLSPTLDAV-----RNSQ--LLMVLDHVNDPHNIGAILRSAVAFSCDG 161
           A HQG+AL+ A   + +L+ +     RN+   +++ LD + DPHN+GAI+RSA AF C G
Sbjct: 159 ASHQGVALQLACSKTISLEKLIDFSKRNTSNPIILALDGITDPHNVGAIIRSAEAFDCKG 218

Query: 162 IITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLE 221
           II  +R S   +  +AK A+GALEH+P  R+ NL  AL+++   GF  IGLS D +  + 
Sbjct: 219 IIIPQRRSAGLTGTVAKVAAGALEHLPVSRVVNLNRALEELKKNGFMVIGLSGDGQLSIS 278

Query: 222 QEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
           +  +   + +I+GAE KG+   TQ+    +  + + G   +LN S AAA++L+
Sbjct: 279 KFHEKTPLVVIVGAEDKGISLLTQKKCDFLLKIPLKGKTSSLNASVAAAISLF 331


>gi|254492112|ref|ZP_05105287.1| RNA methyltransferase, TrmH family, group 3 [Methylophaga
           thiooxidans DMS010]
 gi|224462664|gb|EEF78938.1| RNA methyltransferase, TrmH family, group 3 [Methylophaga
           thiooxydans DMS010]
          Length = 246

 Score =  122 bits (306), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 79/235 (33%), Positives = 123/235 (52%), Gaps = 11/235 (4%)

Query: 50  FLYGVHTVSAALNNPSRKIFQL-LATKNALARLD--WDANLPHPFPVKTVPPQTIDKIVG 106
            ++G+H V AAL+ P  +I ++ LA      R+D    A       V      T+DKI  
Sbjct: 5   VIFGLHAVQAALDVPVSRIKEIWLAADRQDQRVDALLKAAEQQGVVVHKAERDTLDKI-A 63

Query: 107 KEAVHQGLALETAPL-------LSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSC 159
               HQG A    PL       L   ++++    LL++LD V DPHN+GA LR+A A   
Sbjct: 64  PNVQHQGCAARCKPLESLDEKGLMTLVESLNEPALLLILDGVQDPHNLGACLRTAEAAGA 123

Query: 160 DGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKP 219
             +I  K  +   +A   K +SGA E +P+ +++NL+  ++++   G   +G S DS+  
Sbjct: 124 HAVIAPKDRASGLTATAVKISSGAAERVPFAQVTNLSRLMRELQDAGVWLVGTSGDSELS 183

Query: 220 LEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
           L Q      +A++LGAEGKG+R  T++    + ++ M G  ++LNVS AA V LY
Sbjct: 184 LFQAELKGSMAIVLGAEGKGIRRLTRDNCDQVVYIPMQGEAESLNVSVAAGVCLY 238


>gi|260584968|ref|ZP_05852712.1| TrmH family RNA methyltransferase [Granulicatella elegans ATCC
           700633]
 gi|260157398|gb|EEW92470.1| TrmH family RNA methyltransferase [Granulicatella elegans ATCC
           700633]
          Length = 282

 Score =  122 bits (306), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 77/250 (30%), Positives = 126/250 (50%), Gaps = 15/250 (6%)

Query: 36  FNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDW----DANLPHPF 91
           +  +S    Q    F+YG H V  AL  P R     L  + AL+  +     D    H  
Sbjct: 30  YTPESSSNEQESTDFVYGRHAVREALQQPER--VNKLWVQEALSGKEITPIIDLAKEHRI 87

Query: 92  PVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAV-------RNSQLLMVLDHVNDP 144
            ++ VP   +  +VG E VHQG+    A     TL+ V            +++LD + DP
Sbjct: 88  QIQNVPKAKLQDLVG-EVVHQGVVASIAAYEYATLEDVFEKAQEKNEDPFILILDGIEDP 146

Query: 145 HNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHS 204
           +N+G+ILR+A A    GII  KR S S ++ +AK+++GA+EH+P +R++NLT  ++++  
Sbjct: 147 YNLGSILRTADATGVHGIIIPKRRSVSLTSTVAKASTGAIEHVPVVRVTNLTQTIEQLKE 206

Query: 205 WGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALN 264
            G    G         +   K   IA+++G EGKG+    ++    M  + M G +++LN
Sbjct: 207 RGVWVFGTDMKGTDYRQWNTKG-PIAIVMGNEGKGVSRIVKDAVDEMITIPMTGHVQSLN 265

Query: 265 VSNAAAVALY 274
            S A+A+ +Y
Sbjct: 266 ASVASALMMY 275


>gi|152983804|ref|YP_001350984.1| putative rRNA methylase [Pseudomonas aeruginosa PA7]
 gi|150958962|gb|ABR80987.1| probable rRNA methylase [Pseudomonas aeruginosa PA7]
          Length = 248

 Score =  122 bits (306), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 82/234 (35%), Positives = 120/234 (51%), Gaps = 12/234 (5%)

Query: 51  LYGVHTVSAALNNPSRKIFQL-LATKNALARLDWDANLPHPF--PVKTVPPQTIDKIVGK 107
           +YGVH V A L +  +++ QL LA      R+     L   F  PV     + +D+    
Sbjct: 7   VYGVHAVEALLRHHPKRVKQLWLAEGRHDPRVQVLTELAAGFRIPVGQRDRRELDEWA-- 64

Query: 108 EAVHQGLALETAP-------LLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCD 160
           E VHQG+  E +P       +L   L+    + LL+ LD V DPHN+GA LR+A A    
Sbjct: 65  EGVHQGVVAEVSPSQVWGENMLEELLERAEGAPLLLALDGVTDPHNLGACLRTADAAGVL 124

Query: 161 GIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPL 220
            +I  K  S + +A + K A GA E IP + ++NL   L+K+   G   +G + ++ K L
Sbjct: 125 AVIVPKDKSATLNATVRKVACGAAEVIPLVAVTNLARTLEKLQQRGLWVVGTAGEADKTL 184

Query: 221 EQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
            Q        L++GAEGKG+R  T+E    +A L M G + +LNVS A  V L+
Sbjct: 185 YQLDLKGPTVLVMGAEGKGMRRLTREHCDFLARLPMAGSVSSLNVSVATGVCLF 238


>gi|325567613|ref|ZP_08144280.1| 23S rRNA (guanosine-2'-O-)-methyltransferase RlmB [Enterococcus
           casseliflavus ATCC 12755]
 gi|325159046|gb|EGC71192.1| 23S rRNA (guanosine-2'-O-)-methyltransferase RlmB [Enterococcus
           casseliflavus ATCC 12755]
          Length = 279

 Score =  122 bits (305), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 80/237 (33%), Positives = 125/237 (52%), Gaps = 15/237 (6%)

Query: 47  ENLFLYGVHTVSAAL-NNPSRKIF-QLLATKNALARLDWDANLPHPFPVKTVPPQTIDKI 104
           E+ F++G H V+ AL      K+F    A    + RL   A      PVK VP Q +D +
Sbjct: 38  EDNFVFGYHAVAEALKEGRGNKLFLSEEARGEKIDRLKEMAR-EQAVPVKWVPKQKLDTM 96

Query: 105 VGKEAVHQGLALETAPLLSPTLDAV----RNSQLLMVLDHVNDPHNIGAILRSAVAFSCD 160
              + VHQG+ L   P    TLD +    +   L ++LD++ DPHN G+I+R+A A   D
Sbjct: 97  -SDQGVHQGMILAITPYQYLTLDELLAQTKEQPLYLILDNLEDPHNFGSIMRTADASGVD 155

Query: 161 GIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGL---SSDSK 217
           GII  K  +   + ++ K+++GA+EHIP  R++NLT A+Q++   GF   G     SD +
Sbjct: 156 GIIIPKHRAVGITPIVVKTSTGAVEHIPVARVTNLTQAVQQLKKAGFWIFGTDMSGSDYR 215

Query: 218 KPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
               Q      + LI+G EG+G+    ++    M  + M G +++LN S AA + +Y
Sbjct: 216 TWNAQ----GAVGLIIGNEGRGMGEGLKKEVDQMLTIPMTGHVQSLNASVAAGLLMY 268


>gi|257875922|ref|ZP_05655575.1| RNA methyltransferase TrmH [Enterococcus casseliflavus EC20]
 gi|257810088|gb|EEV38908.1| RNA methyltransferase TrmH [Enterococcus casseliflavus EC20]
          Length = 279

 Score =  122 bits (305), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 80/237 (33%), Positives = 125/237 (52%), Gaps = 15/237 (6%)

Query: 47  ENLFLYGVHTVSAAL-NNPSRKIF-QLLATKNALARLDWDANLPHPFPVKTVPPQTIDKI 104
           E+ F++G H V+ AL      K+F    A    + RL   A      PVK VP Q +D +
Sbjct: 38  EDNFVFGYHAVAEALKEGRGNKLFLSEEARGEKIDRLKEMAR-EQAVPVKWVPKQKLDTM 96

Query: 105 VGKEAVHQGLALETAPLLSPTLDAV----RNSQLLMVLDHVNDPHNIGAILRSAVAFSCD 160
              + VHQG+ L   P    TLD +    +   L ++LD++ DPHN G+I+R+A A   D
Sbjct: 97  -SNQGVHQGMILAITPYQYLTLDELLAQTKEQPLYLILDNLEDPHNFGSIMRTADASGVD 155

Query: 161 GIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGL---SSDSK 217
           GII  K  +   + ++ K+++GA+EHIP  R++NLT A+Q++   GF   G     SD +
Sbjct: 156 GIIIPKHRAVGITPIVVKTSTGAVEHIPVARVTNLTQAVQQLKKAGFWIFGTDMSGSDYR 215

Query: 218 KPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
               Q      + LI+G EG+G+    ++    M  + M G +++LN S AA + +Y
Sbjct: 216 TWNAQ----GAVGLIIGNEGRGMGEGLKKEVDQMLTIPMTGHVQSLNASVAAGLLMY 268


>gi|116053085|ref|YP_793404.1| TrmH family RNA methyltransferase , group 3 [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|115588306|gb|ABJ14321.1| putative RNA methyltransferase, TrmH family, group 3 [Pseudomonas
           aeruginosa UCBPP-PA14]
          Length = 248

 Score =  122 bits (305), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 82/234 (35%), Positives = 119/234 (50%), Gaps = 12/234 (5%)

Query: 51  LYGVHTVSAALNNPSRKIFQL-LATKNALARLDWDANLPHPF--PVKTVPPQTIDKIVGK 107
           +YGVH V A L +  +++ QL LA      R+     L   F  PV     + +D+    
Sbjct: 7   VYGVHAVEALLRHHPKRVKQLWLAEGRHDPRVQVLTELAAGFRIPVGQRDRRELDEWA-- 64

Query: 108 EAVHQGLALETAP-------LLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCD 160
           E VHQG+  E +P       +L   L+      LL+ LD V DPHN+GA LR+A A    
Sbjct: 65  EGVHQGVVAEVSPSQVWGENMLEELLERSEGVPLLLALDGVTDPHNLGACLRTADAAGVQ 124

Query: 161 GIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPL 220
            +I  K  S + +A + K A GA E IP + ++NL   L+K+   G   +G + ++ K L
Sbjct: 125 AVIVPKDKSATLNATVRKVACGAAEVIPLVAVTNLARTLEKLQQRGLWVVGTAGEADKTL 184

Query: 221 EQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
            Q        L++GAEGKG+R  T+E    +A L M G + +LNVS A  V L+
Sbjct: 185 YQLDLTGPTVLVMGAEGKGMRRLTREHCDFLARLPMAGSVSSLNVSVATGVCLF 238


>gi|257866303|ref|ZP_05645956.1| RNA methyltransferase TrmH [Enterococcus casseliflavus EC30]
 gi|257873181|ref|ZP_05652834.1| RNA methyltransferase TrmH [Enterococcus casseliflavus EC10]
 gi|257800261|gb|EEV29289.1| RNA methyltransferase TrmH [Enterococcus casseliflavus EC30]
 gi|257807345|gb|EEV36167.1| RNA methyltransferase TrmH [Enterococcus casseliflavus EC10]
          Length = 279

 Score =  122 bits (305), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 80/237 (33%), Positives = 125/237 (52%), Gaps = 15/237 (6%)

Query: 47  ENLFLYGVHTVSAAL-NNPSRKIF-QLLATKNALARLDWDANLPHPFPVKTVPPQTIDKI 104
           E+ F++G H V+ AL      K+F    A    + RL   A      PVK VP Q +D +
Sbjct: 38  EDNFVFGYHAVAEALKEGRGNKLFLSEEARGEKIDRLKEMAR-EQAVPVKWVPKQKLDTM 96

Query: 105 VGKEAVHQGLALETAPLLSPTLDAV----RNSQLLMVLDHVNDPHNIGAILRSAVAFSCD 160
              + VHQG+ L   P    TLD +    +   L ++LD++ DPHN G+I+R+A A   D
Sbjct: 97  -SDQGVHQGMILAITPYQYLTLDELLAQTKEQPLYLILDNLEDPHNFGSIMRTADASGVD 155

Query: 161 GIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGL---SSDSK 217
           GII  K  +   + ++ K+++GA+EHIP  R++NLT A+Q++   GF   G     SD +
Sbjct: 156 GIIIPKHRAVGITPIVVKTSTGAVEHIPVARVTNLTQAVQQLKKAGFWIFGTDMSGSDYR 215

Query: 218 KPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
               Q      + LI+G EG+G+    ++    M  + M G +++LN S AA + +Y
Sbjct: 216 TWNAQ----GAVGLIIGNEGRGMGEGLKKEVDQMLTIPMTGHVQSLNASVAAGLLMY 268


>gi|15600129|ref|NP_253623.1| rRNA methylase [Pseudomonas aeruginosa PAO1]
 gi|218894031|ref|YP_002442900.1| putative rRNA methylase [Pseudomonas aeruginosa LESB58]
 gi|254244173|ref|ZP_04937495.1| hypothetical protein PA2G_05016 [Pseudomonas aeruginosa 2192]
 gi|296391776|ref|ZP_06881251.1| putative rRNA methylase [Pseudomonas aeruginosa PAb1]
 gi|313109938|ref|ZP_07795866.1| putative rRNA methylase [Pseudomonas aeruginosa 39016]
 gi|52783327|sp|Q9HUM8|RLMB_PSEAE RecName: Full=23S rRNA (guanosine-2'-O-)-methyltransferase RlmB;
           AltName: Full=23S rRNA Gm2251 2'-O-methyltransferase
 gi|9951215|gb|AAG08321.1|AE004906_9 probable rRNA methylase [Pseudomonas aeruginosa PAO1]
 gi|126197551|gb|EAZ61614.1| hypothetical protein PA2G_05016 [Pseudomonas aeruginosa 2192]
 gi|218774259|emb|CAW30076.1| probable rRNA methylase [Pseudomonas aeruginosa LESB58]
 gi|310882368|gb|EFQ40962.1| putative rRNA methylase [Pseudomonas aeruginosa 39016]
          Length = 248

 Score =  122 bits (305), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 82/234 (35%), Positives = 119/234 (50%), Gaps = 12/234 (5%)

Query: 51  LYGVHTVSAALNNPSRKIFQL-LATKNALARLDWDANLPHPF--PVKTVPPQTIDKIVGK 107
           +YGVH V A L +  +++ QL LA      R+     L   F  PV     + +D+    
Sbjct: 7   VYGVHAVEALLRHHPKRVKQLWLAEGRHDPRVQVLTELAAGFRIPVGQRDRRELDEWA-- 64

Query: 108 EAVHQGLALETAP-------LLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCD 160
           E VHQG+  E +P       +L   L+      LL+ LD V DPHN+GA LR+A A    
Sbjct: 65  EGVHQGVVAEVSPSQVWGENMLEELLERSEGVPLLLALDGVTDPHNLGACLRTADAAGVQ 124

Query: 161 GIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPL 220
            +I  K  S + +A + K A GA E IP + ++NL   L+K+   G   +G + ++ K L
Sbjct: 125 AVIVPKDKSATLNATVRKVACGAAEVIPLVAVTNLARTLEKLQQRGLWVVGTAGEADKTL 184

Query: 221 EQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
            Q        L++GAEGKG+R  T+E    +A L M G + +LNVS A  V L+
Sbjct: 185 YQLDLKGPTVLVMGAEGKGMRRLTREHCDFLARLPMAGSVSSLNVSVATGVCLF 238


>gi|107104035|ref|ZP_01367953.1| hypothetical protein PaerPA_01005108 [Pseudomonas aeruginosa PACS2]
 gi|254238349|ref|ZP_04931672.1| hypothetical protein PACG_04484 [Pseudomonas aeruginosa C3719]
 gi|126170280|gb|EAZ55791.1| hypothetical protein PACG_04484 [Pseudomonas aeruginosa C3719]
          Length = 248

 Score =  121 bits (304), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 82/234 (35%), Positives = 119/234 (50%), Gaps = 12/234 (5%)

Query: 51  LYGVHTVSAALNNPSRKIFQL-LATKNALARLDWDANLPHPF--PVKTVPPQTIDKIVGK 107
           +YGVH V A L +  +++ QL LA      R+     L   F  PV     + +D+    
Sbjct: 7   VYGVHAVEALLRHHPKRVKQLWLAEGRHDPRVQVLTELAAGFRIPVGQRDRRELDEWA-- 64

Query: 108 EAVHQGLALETAP-------LLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCD 160
           E VHQG+  E +P       +L   L+      LL+ LD V DPHN+GA LR+A A    
Sbjct: 65  EGVHQGVVAEVSPSQVWGENMLEELLERGEGVPLLLALDGVTDPHNLGACLRTADAAGVQ 124

Query: 161 GIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPL 220
            +I  K  S + +A + K A GA E IP + ++NL   L+K+   G   +G + ++ K L
Sbjct: 125 AVIVPKDKSATLNATVRKVACGAAEVIPLVAVTNLARTLEKLQQRGLWVVGTAGEADKTL 184

Query: 221 EQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
            Q        L++GAEGKG+R  T+E    +A L M G + +LNVS A  V L+
Sbjct: 185 YQLDLKGPTVLVMGAEGKGMRRLTREHCDFLARLPMAGSVSSLNVSVATGVCLF 238


>gi|307608839|emb|CBW98231.1| hypothetical protein LPW_00911 [Legionella pneumophila 130b]
          Length = 249

 Score =  121 bits (304), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 81/241 (33%), Positives = 126/241 (52%), Gaps = 23/241 (9%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPF---------PVKTVPPQT 100
           ++YG+H VSA L NP R I +L   ++ +     D  L H F         P++ +  Q 
Sbjct: 5   YVYGLHAVSALLANPHRMIKKLFVNQDRI-----DKRL-HEFLIKAENAHVPIEKLSAQK 58

Query: 101 IDKIVGKEAVHQGLALETAPL-------LSPTLDAVRNSQLLMVLDHVNDPHNIGAILRS 153
           +++    E  HQG+    + L       L   L+  +   L+++LD + DPHN+GA LRS
Sbjct: 59  MNQQF-SEFTHQGVVALASALPEYGESDLVTLLERSKKPVLILILDGITDPHNLGACLRS 117

Query: 154 AVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLS 213
           A A   D ++  K  S S + V++K A GA E IP +R++NL  A+  +   G    G +
Sbjct: 118 ADATGVDFVVIPKDKSASITPVVSKVACGAAESIPLVRVTNLARAMDILKQQGVWIFGAA 177

Query: 214 SDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVAL 273
            +++  L     +  IAL++GAEG GLR  T+E    +  L M G +++LNVS A  V+L
Sbjct: 178 GEAEHLLYAMDCSGNIALVMGAEGTGLRRLTREHCDGLFSLPMMGSVESLNVSVATGVSL 237

Query: 274 Y 274
           Y
Sbjct: 238 Y 238


>gi|222152461|ref|YP_002561636.1| SpoU rRNA methylase family protein [Streptococcus uberis 0140J]
 gi|222113272|emb|CAR40803.1| SpoU rRNA methylase family protein [Streptococcus uberis 0140J]
          Length = 251

 Score =  121 bits (304), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 81/247 (32%), Positives = 138/247 (55%), Gaps = 18/247 (7%)

Query: 39  KSRHTSQPENLFLYGVHTVSAALN-NPSRKIF--QLLATKN--ALARLDWDANLPHPFPV 93
           K +H  +  ++ +YGVH V+ +LN N   K++  + L  KN  A+  L  +  +     +
Sbjct: 5   KDKHLQETTDM-VYGVHAVTESLNANTGNKLYIQEDLRGKNVDAIKALATEKKVS----I 59

Query: 94  KTVPPQTIDKIVGKEAVHQGLALETAPLLSPTL-DAVRNSQ-----LLMVLDHVNDPHNI 147
              P +T+ ++  + AVHQG  L  +      L D ++ ++     L+M+LD + DPHN 
Sbjct: 60  SWTPKKTLSEMT-EGAVHQGFVLRVSEYAYAELADILKKAESEENPLIMILDGITDPHNF 118

Query: 148 GAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGF 207
           G+ILR+A A    GII  K  +   + V++K+++GA+EH+P  R++NL+  L K+   GF
Sbjct: 119 GSILRTADATKVCGIIIPKHRAVGVTPVVSKTSTGAVEHLPIARVTNLSQTLDKLKEAGF 178

Query: 208 QTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSN 267
              G   D   P+++   + K+ALI+G+EGKG+    ++    M  + M G +++LN S 
Sbjct: 179 WIFGTDMDG-TPVQKWNTSGKLALIIGSEGKGISHNIKKQVDEMITIPMDGHVQSLNASV 237

Query: 268 AAAVALY 274
           AAAV +Y
Sbjct: 238 AAAVLMY 244


>gi|315640328|ref|ZP_07895445.1| 23S rRNA (guanosine-2'-O-)-methyltransferase RlmB [Enterococcus
           italicus DSM 15952]
 gi|315483990|gb|EFU74469.1| 23S rRNA (guanosine-2'-O-)-methyltransferase RlmB [Enterococcus
           italicus DSM 15952]
          Length = 278

 Score =  121 bits (304), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 79/256 (30%), Positives = 130/256 (50%), Gaps = 11/256 (4%)

Query: 26  NHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALN-NPSRKIFQLLATKNALARLDWD 84
           N +D +K      K     +    F++G H V  AL      K+F L   +    R+D  
Sbjct: 14  NKKDTRKQTVRKDKEMTAEELAENFVFGHHAVVEALKKGRGNKLFLLEDARGE--RIDEV 71

Query: 85  ANL--PHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVR----NSQLLMVL 138
             L      PVK VP Q +++   ++ VHQG+ L   P    +LD +          ++L
Sbjct: 72  KELSKEQSVPVKWVPKQKLEQY-SQQGVHQGMVLAITPYEYLSLDELLAKSPEKPFFIIL 130

Query: 139 DHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDA 198
           D++ DPHN G+ILR+A A   DGII  K  +   + V+ K+++GA+EH+P  R++NL+ A
Sbjct: 131 DNLEDPHNFGSILRTADASGVDGIIIPKHRAVGITPVVVKTSTGAVEHVPIARVTNLSQA 190

Query: 199 LQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPG 258
           +Q +   GF T G + +         +   IALI+G EG+G+    +++   +  + M G
Sbjct: 191 VQTLKERGFWTFGTAMEGTNYRSWNTQG-AIALIIGNEGRGMSEGLKKSVDELLTIPMVG 249

Query: 259 IIKALNVSNAAAVALY 274
            +++LN S AA + +Y
Sbjct: 250 HVQSLNASVAAGLLMY 265


>gi|77456761|ref|YP_346266.1| RNA methyltransferase TrmH, group 3 [Pseudomonas fluorescens Pf0-1]
 gi|77380764|gb|ABA72277.1| 23S rRNA Gm-2251 2'-O-methyltransferase [Pseudomonas fluorescens
           Pf0-1]
          Length = 255

 Score =  121 bits (303), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 79/237 (33%), Positives = 120/237 (50%), Gaps = 8/237 (3%)

Query: 51  LYGVHTVSAALNNPSRKIFQL-LATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEA 109
           +YGVH V A L +  +++ Q+ LA      R+     L +   V+    +  +     E 
Sbjct: 7   IYGVHAVEALLRHHPKRVKQIWLAESRNDPRVQTLIELANENRVQIGQAERREMDAWVEG 66

Query: 110 VHQGLALETAP-------LLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGI 162
           VHQG+  + +P       +L   LD    + LL+VLD V DPHN+GA LRSA A     +
Sbjct: 67  VHQGVVADVSPSQVWGEAMLDELLDRTEGAPLLLVLDGVTDPHNLGACLRSADAAGALAV 126

Query: 163 ITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQ 222
           I  K  S + + V+ K A GA E IP + ++NL   L+K+   G   +G + +++  +  
Sbjct: 127 IVPKDKSATLTPVVRKVACGAAEVIPLVAVTNLARTLEKLQQRGLWIVGTAGEAEVSIYD 186

Query: 223 EIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNH 279
           +       LI+GAEGKG+R  T+E    + HL M G + +LNVS A  V L+  Q  
Sbjct: 187 QDLTGPTILIMGAEGKGMRRLTREHCDYLVHLPMAGSVSSLNVSVATGVCLFEAQRQ 243


>gi|290579663|ref|YP_003484055.1| putative tRNA/rRNA methyltransferase [Streptococcus mutans NN2025]
 gi|254996562|dbj|BAH87163.1| putative tRNA/rRNA methyltransferase [Streptococcus mutans NN2025]
          Length = 248

 Score =  121 bits (303), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 83/244 (34%), Positives = 128/244 (52%), Gaps = 14/244 (5%)

Query: 41  RHTSQPENL-FLYGVHTVSAALN-NPSRKIF--QLLATKNALARLDWDANLPHPFPVKTV 96
           R+    EN   +YGVH V  +L  N   K++    L  KN     D  A      P+   
Sbjct: 2   RYKDFTENTDIVYGVHAVIESLQANTGHKLYIQNDLRGKNVDKIKDLAAE--KKVPISWT 59

Query: 97  PPQTIDKIVGKEAVHQGLALETAPLLSPTLDAV------RNSQLLMVLDHVNDPHNIGAI 150
           P +T+  +  K AVHQG  L  +       + +       ++ LL++LD +NDPHN G+I
Sbjct: 60  PKKTLSDMT-KGAVHQGFILHVSAFAYTEFEMLLKKAEREDNPLLLILDELNDPHNFGSI 118

Query: 151 LRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTI 210
           LR+A A +  GII  K  +   + V+AK+++GA+EHIP  R++NL  AL K+ + GF   
Sbjct: 119 LRTADATNVTGIIIPKHRAVGVTPVVAKTSTGAVEHIPIARVTNLGQALDKLKAAGFWIF 178

Query: 211 GLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAA 270
           G   +   P  Q   + K+ALI+G EG+G+    ++    M  + M G +++LN S AAA
Sbjct: 179 GTDMNG-TPSTQWNTSGKLALIIGNEGRGISHNIKKQVDEMVTIPMNGHVQSLNASVAAA 237

Query: 271 VALY 274
           + +Y
Sbjct: 238 ILMY 241


>gi|329769072|ref|ZP_08260494.1| RNA methyltransferase [Gemella sanguinis M325]
 gi|328839563|gb|EGF89139.1| RNA methyltransferase [Gemella sanguinis M325]
          Length = 271

 Score =  121 bits (303), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 82/267 (30%), Positives = 139/267 (52%), Gaps = 18/267 (6%)

Query: 23  LRRNHRDYKKMQSFNQKSRHTSQ-----PENLFLYGVHTVSAALNNP---SRKIFQLLAT 74
           +++N+  YK+++  N++ +   Q     P+   + G + +  A+ +    ++ +FQ    
Sbjct: 1   MKKNNNYYKELRKKNKEQKAPVQNTELDPDKEVIAGRNAILEAIKSGREINKILFQEGIE 60

Query: 75  KNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRN--- 131
           K  L  +   AN       + VP + +D    +   HQG+    AP     LD V N   
Sbjct: 61  KGRLKSIFAIAN-EKKIVCQEVPKRKLDNTTTER--HQGVIAFVAPYNYFELDEVLNKLD 117

Query: 132 ---SQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIP 188
              S  L++LDH+ DPHN+GAI+R+A A    GII  KR +   S    K+++GA+EH+P
Sbjct: 118 INKSTTLLILDHIEDPHNLGAIIRTAEASGVKGIIIPKRRAAVVSQTAVKASAGAIEHMP 177

Query: 189 YIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKND-KIALILGAEGKGLRPKTQET 247
            IR+S+LTDA++K+   GF   G +   +     +I  D  +A+++G EG+G+     + 
Sbjct: 178 VIRVSSLTDAIKKLKEKGFWIAGTTLAERSEEYTKIAKDVPLAIVIGNEGEGMSKVVTKE 237

Query: 248 ATSMAHLHMPGIIKALNVSNAAAVALY 274
              + HL M G I++LN S AA + +Y
Sbjct: 238 CDFLYHLPMLGKIQSLNASVAAGIIMY 264


>gi|309782307|ref|ZP_07677034.1| RNA methyltransferase, TrmH family, group 3 [Ralstonia sp.
           5_7_47FAA]
 gi|308918925|gb|EFP64595.1| RNA methyltransferase, TrmH family, group 3 [Ralstonia sp.
           5_7_47FAA]
          Length = 250

 Score =  121 bits (303), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 77/233 (33%), Positives = 121/233 (51%), Gaps = 9/233 (3%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLATKNALARLDWD-ANLPHPFPVKTVPPQTIDKIVGKE 108
            L G H V+A L + ++ I ++    N   R   D         V+ +P    D++ G  
Sbjct: 6   LLIGFHAVTARLRHGAKSIDEIYFEANRRDRRMQDFLKAAEAAGVRLIPADA-DRLRGIA 64

Query: 109 AV--HQGLALETAPL-----LSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDG 161
               HQG+  +   L     L   LD +  + LL+VLD V DPHN+GA LR A A     
Sbjct: 65  GTDRHQGVVAKAESLSLALNLDELLDGIEGTPLLLVLDGVTDPHNLGACLRVADAAGAHA 124

Query: 162 IITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLE 221
           +I  K  S   +  +AK ASGA E +PYI ++NL   L+++   G   IG + ++++ L 
Sbjct: 125 VIAPKDRSVGINTTVAKVASGAAETVPYITVTNLARTLRELQERGVWVIGTADEAEQDLY 184

Query: 222 QEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
           Q       A+++GAEG+G+R  T+ET  ++  + M G +++LNVS A+ V L+
Sbjct: 185 QADFKGPTAIVMGAEGEGMRRLTRETCDALVSIPMAGSVESLNVSVASGVCLF 237


>gi|187928166|ref|YP_001898653.1| TrmH family RNA methyltransferase [Ralstonia pickettii 12J]
 gi|187725056|gb|ACD26221.1| RNA methyltransferase, TrmH family, group 3 [Ralstonia pickettii
           12J]
          Length = 250

 Score =  121 bits (303), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 77/233 (33%), Positives = 121/233 (51%), Gaps = 9/233 (3%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLATKNALARLDWD-ANLPHPFPVKTVPPQTIDKIVGKE 108
            L G H V+A L + ++ I ++    N   R   D         V+ +P    D++ G  
Sbjct: 6   LLIGFHAVTARLRHGAKSIDEIYFEANRRDRRMQDFLKAAEAAGVRLIPADA-DRLRGIA 64

Query: 109 AV--HQGLALETAPL-----LSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDG 161
               HQG+  +   L     L   LD +  + LL+VLD V DPHN+GA LR A A     
Sbjct: 65  GTDRHQGVVAKAESLSLALNLDELLDGIEGTPLLLVLDGVTDPHNLGACLRVADAAGAHA 124

Query: 162 IITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLE 221
           +I  K  S   +  +AK ASGA E +PYI ++NL   L+++   G   IG + ++++ L 
Sbjct: 125 VIAPKDRSVGINTTVAKVASGAAETVPYITVTNLARTLRELQERGVWVIGTADEAEQDLY 184

Query: 222 QEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
           Q       A+++GAEG+G+R  T+ET  ++  + M G +++LNVS A+ V L+
Sbjct: 185 QADFKGPTAIVMGAEGEGMRRLTRETCDALVSIPMAGSVESLNVSVASGVCLF 237


>gi|54293055|ref|YP_125470.1| hypothetical protein lpl0092 [Legionella pneumophila str. Lens]
 gi|53752887|emb|CAH14322.1| hypothetical protein lpl0092 [Legionella pneumophila str. Lens]
          Length = 249

 Score =  121 bits (303), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 81/241 (33%), Positives = 126/241 (52%), Gaps = 23/241 (9%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPF---------PVKTVPPQT 100
           ++YG+H VSA L NP R I +L   ++ +     D  L H F         P++ +  Q 
Sbjct: 5   YVYGLHAVSALLANPHRMIKKLFVNQDRI-----DKRL-HEFLIKAENAHVPIEKLSAQK 58

Query: 101 IDKIVGKEAVHQGLALETAPL-------LSPTLDAVRNSQLLMVLDHVNDPHNIGAILRS 153
           +++    E  HQG+    + L       L   L+  +   L+++LD + DPHN+GA LRS
Sbjct: 59  MNQQF-SEFTHQGVVALASALPEYGESDLVTLLERSKKPVLILILDGITDPHNLGACLRS 117

Query: 154 AVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLS 213
           A A   D ++  K  S S + V++K A GA E IP +R++NL  A+  +   G    G +
Sbjct: 118 ADATGVDFVLIPKDKSASITPVVSKVACGAAESIPLVRVTNLARAMDILKQQGVWIFGAA 177

Query: 214 SDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVAL 273
            +++  L     +  IAL++GAEG GLR  T+E    +  L M G +++LNVS A  V+L
Sbjct: 178 GEAEHLLYAMDCSGNIALVMGAEGTGLRRLTREHCDGLFSLPMMGSVESLNVSVATGVSL 237

Query: 274 Y 274
           Y
Sbjct: 238 Y 238


>gi|322374192|ref|ZP_08048725.1| RNA methyltransferase, TrmH family, group 3 [Streptococcus sp.
           C150]
 gi|321276897|gb|EFX53969.1| RNA methyltransferase, TrmH family, group 3 [Streptococcus sp.
           C150]
          Length = 247

 Score =  120 bits (302), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 81/234 (34%), Positives = 123/234 (52%), Gaps = 13/234 (5%)

Query: 50  FLYGVHTVSAALN-NPSRKIF--QLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVG 106
            +YGVH V+ +L  N   K++    L  KN  A     A       +   P +T+  + G
Sbjct: 11  IVYGVHAVTESLEANTGNKLYIQDDLRGKNVDAIKALAAE--KKVSISWTPKKTLSDMTG 68

Query: 107 KEAVHQGLALETAPL----LSPTLDAVRNSQ--LLMVLDHVNDPHNIGAILRSAVAFSCD 160
             AVHQG  L  +      LS  +D V   +  L+++LD +NDPHN G+ILR+A A    
Sbjct: 69  G-AVHQGFVLRVSEFAYSELSDIMDKVEQEENPLILILDGLNDPHNFGSILRTADATQVT 127

Query: 161 GIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPL 220
           G+I  K  +   + V+AK+++GA+EHIP  R++NL+  L K+   GF   G   D   P 
Sbjct: 128 GVIIPKHRAVGVTPVVAKTSTGAVEHIPIARVTNLSQTLDKLKEAGFWIFGTDMDG-TPS 186

Query: 221 EQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
            +     ++ALI+G EGKG+    ++    M  + M G +++LN S AAAV +Y
Sbjct: 187 HKWNTAGRLALIIGNEGKGISANIKKQVDEMITIPMSGHVQSLNASVAAAVLMY 240


>gi|330816741|ref|YP_004360446.1| RNA methyltransferase, TrmH family, group 3 [Burkholderia gladioli
           BSR3]
 gi|327369134|gb|AEA60490.1| RNA methyltransferase, TrmH family, group 3 [Burkholderia gladioli
           BSR3]
          Length = 249

 Score =  120 bits (302), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 78/232 (33%), Positives = 124/232 (53%), Gaps = 7/232 (3%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLL--ATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGK 107
            LYG H V+A L + +  + ++L   T+     +D+ A             +T    +  
Sbjct: 6   VLYGFHAVTARLRHDASTVAEVLYDQTRRDRRMIDFLATAKEAGVRLIAADETRLWGLAH 65

Query: 108 EAVHQGLA--LETAPL---LSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGI 162
              HQG+   +E  PL   L+  LD ++   LL+VLD V DPHN+GA LR A A     I
Sbjct: 66  TERHQGVVARVEDLPLAQNLAELLDGIQGPALLLVLDGVTDPHNLGACLRVADAAGAHAI 125

Query: 163 ITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQ 222
           I  +  +   +A  AK ASGA + +PYI ++NL  AL+++   G   IG + D+   L +
Sbjct: 126 IAPRDRAVGLNATAAKVASGAADTVPYITVTNLARALRELKDAGVWVIGTADDAGASLYE 185

Query: 223 EIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
              +  +AL++GAEG+G+R  T++T   + ++ M G +++LNVS A+ V LY
Sbjct: 186 TKLDGPVALVMGAEGEGMRRLTRDTCDDVMNIPMAGSVESLNVSVASGVCLY 237


>gi|209515693|ref|ZP_03264557.1| RNA methyltransferase, TrmH family, group 3 [Burkholderia sp. H160]
 gi|209503929|gb|EEA03921.1| RNA methyltransferase, TrmH family, group 3 [Burkholderia sp. H160]
          Length = 247

 Score =  120 bits (302), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 64/169 (37%), Positives = 99/169 (58%), Gaps = 5/169 (2%)

Query: 111 HQGLALETAPL-----LSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITT 165
           HQG+      L     L+  LD +  S L++VLD V DPHN+GA LR A A     +I  
Sbjct: 69  HQGVVARAGDLPLAQNLAELLDGITGSPLILVLDGVTDPHNLGACLRVADAAGAHAVIAP 128

Query: 166 KRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIK 225
           +  +   +A  AK ASGA + +PYI ++NL  AL+++   G   +G + D++K +     
Sbjct: 129 RDRAVGLNATAAKVASGAADTVPYITVTNLARALRELKDAGVWVVGTAGDAEKSVYDTEL 188

Query: 226 NDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
           +  +AL+LGAEG+G+R  T+ET   + H+ M G +++LNVS A+ V L+
Sbjct: 189 DGPVALVLGAEGEGMRRLTRETCDVVMHIPMAGTVESLNVSVASGVCLF 237


>gi|148358250|ref|YP_001249457.1| tRNA/rRNA methyltransferase [Legionella pneumophila str. Corby]
 gi|296105603|ref|YP_003617303.1| tRNA/rRNA methyltransferase [Legionella pneumophila 2300/99 Alcoy]
 gi|148280023|gb|ABQ54111.1| tRNA/rRNA methyltransferase [Legionella pneumophila str. Corby]
 gi|295647504|gb|ADG23351.1| tRNA/rRNA methyltransferase [Legionella pneumophila 2300/99 Alcoy]
          Length = 249

 Score =  120 bits (302), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 84/243 (34%), Positives = 127/243 (52%), Gaps = 27/243 (11%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKT----VPPQTIDKIV 105
           ++YG+H VSA L NP R I +L   ++ +     D  L H F VK     VP   I+K+ 
Sbjct: 5   YVYGLHAVSALLANPHRMIKKLFVNQDRI-----DKRL-HEFLVKAENAHVP---IEKLS 55

Query: 106 GK-------EAVHQGLALETAPL-------LSPTLDAVRNSQLLMVLDHVNDPHNIGAIL 151
            +       E  HQG+    + L       L   L+  +   L+++LD + DPHN+GA L
Sbjct: 56  AQKMNQQFSEFTHQGVVALASALPEYGESDLVTLLERSKKPVLILILDGITDPHNLGACL 115

Query: 152 RSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIG 211
           RSA A   D ++  K  S + + V++K A GA E IP +R++NL  A+  +   G    G
Sbjct: 116 RSADATGVDFVVIPKDKSANITPVVSKVACGAAESIPLVRVTNLARAMDILKQQGVWIFG 175

Query: 212 LSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAV 271
            + +++  L     +  IAL++GAEG GLR  T+E    +  L M G +++LNVS A  V
Sbjct: 176 AAGEAEHLLYAMDCSGNIALVMGAEGTGLRRLTREHCDGLFSLPMMGSVESLNVSVATGV 235

Query: 272 ALY 274
           +LY
Sbjct: 236 SLY 238


>gi|330501633|ref|YP_004378502.1| RNA methyltransferase [Pseudomonas mendocina NK-01]
 gi|328915919|gb|AEB56750.1| RNA methyltransferase [Pseudomonas mendocina NK-01]
          Length = 250

 Score =  120 bits (302), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 81/234 (34%), Positives = 119/234 (50%), Gaps = 12/234 (5%)

Query: 51  LYGVHTVSAALNNPSRKIFQL-LATKNALARLDWDANLP--HPFPVKTVPPQTIDKIVGK 107
           +YGVH V A L +  +++ QL LA      R+     L   +  PV     Q +D+    
Sbjct: 7   VYGVHAVEALLRHHPKRVKQLWLAESRQAPRIQPMLELAAQNRVPVGHKERQELDEWA-- 64

Query: 108 EAVHQGLALETAP-------LLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCD 160
           E VHQG+  E +P       +L   L+      LL+VLD V DPHN+GA LR+A A    
Sbjct: 65  EGVHQGVVAEVSPSQVWGENMLDELLERSEGVPLLLVLDGVTDPHNLGACLRTADAAGAQ 124

Query: 161 GIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPL 220
            +I  K  S + +A + K A GA E IP + ++NL   L+K+   G   +G + + ++ L
Sbjct: 125 AVIVPKDKSATLNATVRKVACGAAEVIPLVAVTNLARTLEKLQKKGLWVVGTAGEVEQEL 184

Query: 221 EQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
            Q        L++GAEGKG+R  T+E    +  L M G + +LNVS A  V L+
Sbjct: 185 YQLDMTGPTVLVMGAEGKGMRRLTREHCDYLVKLPMGGSVSSLNVSVATGVCLF 238


>gi|209696173|ref|YP_002264103.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Aliivibrio
           salmonicida LFI1238]
 gi|208010126|emb|CAQ80451.1| 23S rRNA (guanosine-2'-O-)-methyltransferase RlmB [Aliivibrio
           salmonicida LFI1238]
          Length = 247

 Score =  120 bits (302), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 77/241 (31%), Positives = 120/241 (49%), Gaps = 20/241 (8%)

Query: 48  NLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLP-------HPFPVKTVPPQT 100
           N FL+G+H   A L     +  ++   K    R D D  LP         F ++ +P +T
Sbjct: 3   NEFLFGIHATKAVLERDPARFIEIFVLK---GRED-DRLLPIITELGELGFKIQELPRKT 58

Query: 101 IDKIVGKEAVHQGLALETAPL-------LSPTLDAVRNSQLLMVLDHVNDPHNIGAILRS 153
           +D    K A HQG+     P        L   +D   N  L +VLD V DPHN+GA LR+
Sbjct: 59  LDD-KAKGANHQGIIARVTPAKQLNERDLDDIMDKTENP-LFLVLDGVTDPHNLGACLRN 116

Query: 154 AVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLS 213
           A       +I  K  S S +A ++K A GA E +P +R++NL   ++ +   G   +G +
Sbjct: 117 ADGAGVAAVIVPKDKSASMTATVSKVACGAAEMVPLVRVTNLARTMRALQEKGVWFVGTA 176

Query: 214 SDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVAL 273
            ++ K + Q      +A+++GAEG G+R  T+ET   +  + M G + +LNVS A+ V L
Sbjct: 177 GEATKDVFQSKLTGPLAIVMGAEGDGMRRLTRETCDDLIKIPMAGSVTSLNVSVASGVCL 236

Query: 274 Y 274
           +
Sbjct: 237 F 237


>gi|313889615|ref|ZP_07823259.1| RNA methyltransferase, TrmH family, group 3 [Streptococcus
           pseudoporcinus SPIN 20026]
 gi|313122042|gb|EFR45137.1| RNA methyltransferase, TrmH family, group 3 [Streptococcus
           pseudoporcinus SPIN 20026]
          Length = 248

 Score =  120 bits (301), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 78/241 (32%), Positives = 127/241 (52%), Gaps = 13/241 (5%)

Query: 48  NLFLYGVHTVSAALN-NPSRKIF--QLLATKNALARLDWDANLPHPFPVKTVPPQTIDKI 104
           N  +YGVH V+ +L  N   K++  + L  KN     D   N      +   P +T+  +
Sbjct: 10  NDMVYGVHAVTESLRANTGNKLYIQEDLRGKNVDIIKDLARN--KKVSISWAPKKTLSDM 67

Query: 105 VGKEAVHQGLALETAPLLSPTLDAV------RNSQLLMVLDHVNDPHNIGAILRSAVAFS 158
             + AVHQG  L  +      L+ +        + L+++LD + DPHN G+ILR+A A  
Sbjct: 68  T-EGAVHQGFVLRVSAFAYSELETLIVKAEKEENPLILILDGLTDPHNFGSILRTADATK 126

Query: 159 CDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKK 218
             G+I  K  +   + V+AK+++GA+EH+P  R++NL+ AL K+   GF   G   D   
Sbjct: 127 VSGVIIPKHRAVGVTPVVAKTSTGAVEHVPIARVTNLSQALDKLKEAGFWIFGTDMDG-T 185

Query: 219 PLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQN 278
           P+++   + K+ALI+G+EGKG+    ++    M  + M G +++LN   AAAV +Y    
Sbjct: 186 PVQKWNTSGKLALIIGSEGKGISTNIKKQVDEMITIPMGGHVQSLNAGVAAAVLMYEVFR 245

Query: 279 H 279
           H
Sbjct: 246 H 246


>gi|15603818|ref|NP_246892.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Pasteurella multocida
           subsp. multocida str. Pm70]
 gi|52783323|sp|Q9CJP3|RLMB_PASMU RecName: Full=23S rRNA (guanosine-2'-O-)-methyltransferase RlmB;
           AltName: Full=23S rRNA Gm2251 2'-O-methyltransferase
 gi|12722390|gb|AAK04037.1| unknown [Pasteurella multocida subsp. multocida str. Pm70]
          Length = 245

 Score =  120 bits (301), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 86/245 (35%), Positives = 123/245 (50%), Gaps = 33/245 (13%)

Query: 51  LYGVHTVSAALNNPSRKIFQLLATK-----------NALARLDWDANLPHPFPVKTVPPQ 99
           +YG+H VSA LNN   ++ ++ A K           N L RL           ++ V  Q
Sbjct: 5   IYGIHAVSAFLNNAPERLIEVYALKGRDDKRLQPLLNELHRLG--------ITIQFVNRQ 56

Query: 100 TIDKIVGKEAVHQGLALETAP---LLSPTLDAVRNSQ---LLMVLDHVNDPHNIGAILRS 153
           T+DK    E VHQG+     P   L    LD +  +Q   LL+VLD V DPHN+GA LR+
Sbjct: 57  TLDKKAEGE-VHQGIMARVQPAKELNEADLDTLLQNQSNPLLLVLDGVTDPHNLGACLRT 115

Query: 154 AVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDAL----QKMHSWGFQT 209
           A A     +I  K  S   +A+  K A GA E +P IR++NL   L    QK + W    
Sbjct: 116 ADAAGVCAVIVPKDKSAQLTAIARKVACGAAEVVPLIRVTNLARTLRELQQKHNIW---V 172

Query: 210 IGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAA 269
           +G + ++   L Q      +AL++GAEG+G+R  T+E    +  + M G + +LNVS A 
Sbjct: 173 VGTAGEATNTLYQTQLTGGLALVMGAEGEGMRRLTREHCDQLISIPMAGSVSSLNVSVAT 232

Query: 270 AVALY 274
            V L+
Sbjct: 233 GVCLF 237


>gi|237654034|ref|YP_002890348.1| RNA methyltransferase, TrmH family, group 3 [Thauera sp. MZ1T]
 gi|237625281|gb|ACR01971.1| RNA methyltransferase, TrmH family, group 3 [Thauera sp. MZ1T]
          Length = 251

 Score =  120 bits (301), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 78/240 (32%), Positives = 123/240 (51%), Gaps = 12/240 (5%)

Query: 46  PENL---FLYGVHTVSAALNNPSRKIFQLLAT---KNALARLDWDANLPHPFPVKTVPPQ 99
           PEN     +YG H VSA L +    + ++  T   K+A  R            +      
Sbjct: 5   PENTPTRLIYGFHAVSAKLRHAPDSVLEIFLTADRKDARVRKFLAQAESAGVRITQSEGD 64

Query: 100 TIDKIVGKEAVHQGLALETAPL-----LSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSA 154
            +D +VG    HQG+  +         L+  LD++  + L++VLD V DPHN+GA LR A
Sbjct: 65  KLDALVGTRR-HQGVVAKVDATRREIKLADVLDSLDENALILVLDGVQDPHNLGACLRVA 123

Query: 155 VAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSS 214
            A     ++  K  +   +A   K ASGA + +PYI ++NL  AL++M   G   +G + 
Sbjct: 124 DAAGAHAVVAPKDRAVGLNATAVKVASGAADTVPYITVTNLARALREMQDAGVWVVGAAG 183

Query: 215 DSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
           +++K L    +   +A +LGAEG GLR  T+ET   +A + M G +++LNVS A+ + L+
Sbjct: 184 EAEKTLYGVDQKVPVAWVLGAEGDGLRRLTRETCDELARIPMHGSVESLNVSVASGICLF 243


>gi|54296089|ref|YP_122458.1| hypothetical protein lpp0107 [Legionella pneumophila str. Paris]
 gi|53749874|emb|CAH11255.1| hypothetical protein lpp0107 [Legionella pneumophila str. Paris]
          Length = 249

 Score =  120 bits (301), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 84/243 (34%), Positives = 127/243 (52%), Gaps = 27/243 (11%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKT----VPPQTIDKIV 105
           ++YG+H VSA L NP R I +L   ++ +     D  L H F VK     VP   I+K+ 
Sbjct: 5   YVYGLHAVSALLANPHRMIKKLFVNQDRI-----DKRL-HEFLVKAENAHVP---IEKLS 55

Query: 106 GK-------EAVHQGLALETAPL-------LSPTLDAVRNSQLLMVLDHVNDPHNIGAIL 151
            +       E  HQG+    + L       L   L+  +   L+++LD + DPHN+GA L
Sbjct: 56  SQKMNQQFSEFTHQGVVALASALPEYGESDLVTLLERSKKPVLILILDGITDPHNLGACL 115

Query: 152 RSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIG 211
           RSA A   D ++  K  S + + V++K A GA E IP +R++NL  A+  +   G    G
Sbjct: 116 RSADATGVDFVVIPKDKSANITPVVSKVACGAAESIPLVRVTNLARAMDILKQQGVWIFG 175

Query: 212 LSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAV 271
            + +++  L     +  IAL++GAEG GLR  T+E    +  L M G +++LNVS A  V
Sbjct: 176 AAGEAEHLLYAMDCSGNIALVMGAEGTGLRRLTREHCDGLFSLPMMGSVESLNVSVATGV 235

Query: 272 ALY 274
           +LY
Sbjct: 236 SLY 238


>gi|320547737|ref|ZP_08042021.1| 23S rRNA (guanosine-2'-O-)-methyltransferase RlmB [Streptococcus
           equinus ATCC 9812]
 gi|320447497|gb|EFW88256.1| 23S rRNA (guanosine-2'-O-)-methyltransferase RlmB [Streptococcus
           equinus ATCC 9812]
          Length = 276

 Score =  120 bits (301), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 77/236 (32%), Positives = 123/236 (52%), Gaps = 13/236 (5%)

Query: 48  NLFLYGVHTVSAALN-NPSRKIF--QLLATKNALARLDWDANLPHPFPVKTVPPQTIDKI 104
           N  +YGVH V+ +L  N   K++    L  KN     D  A       +   P +T++ +
Sbjct: 37  NDIVYGVHAVTESLTANTGNKLYIQDDLRGKNVDKIKDLAA--EKKVSISWTPKKTLNDM 94

Query: 105 VGKEAVHQGLALETAPLLSPTLDAV------RNSQLLMVLDHVNDPHNIGAILRSAVAFS 158
               AVHQG  L  +      LD +        + L+++LD +NDPHN G+ILR+A A +
Sbjct: 95  TNG-AVHQGFVLRVSEFAYAELDTILDKAAQEENPLILILDGLNDPHNFGSILRTADATN 153

Query: 159 CDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKK 218
             G+I  K  +   + V++K+++GA+EH+P  R++NL+  L K+   GF   G   +   
Sbjct: 154 VTGVIIPKHRAVGVTPVVSKTSTGAVEHVPIARVTNLSQTLDKLKEQGFWVFGTDMNGTS 213

Query: 219 PLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
             +      K+ALI+G EGKG+ P  ++    M  + M G +++LN S AAAV +Y
Sbjct: 214 SHKWNTSG-KLALIIGNEGKGISPNIKKQVDEMITIPMNGHVQSLNASVAAAVLMY 268


>gi|312862606|ref|ZP_07722847.1| RNA methyltransferase, TrmH family, group 3 [Streptococcus
           vestibularis F0396]
 gi|311101866|gb|EFQ60068.1| RNA methyltransferase, TrmH family, group 3 [Streptococcus
           vestibularis F0396]
          Length = 247

 Score =  120 bits (301), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 82/234 (35%), Positives = 122/234 (52%), Gaps = 13/234 (5%)

Query: 50  FLYGVHTVSAALN-NPSRKIF--QLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVG 106
            +YGVH V+ +L  N   K++    L  KN  A     A       +   P +T+  + G
Sbjct: 11  IVYGVHAVTESLEANTGNKLYIQDDLRGKNVDAIKALAAE--KKVSISWTPKKTLSDMTG 68

Query: 107 KEAVHQGLALETAPL----LSPTLDAVRNSQ--LLMVLDHVNDPHNIGAILRSAVAFSCD 160
             AVHQG  L  +      LS  +D     +  L+++LD +NDPHN G+ILR+A A    
Sbjct: 69  G-AVHQGFVLRVSEFAYSDLSVIMDKAEQEENPLILILDGLNDPHNFGSILRTADATQVT 127

Query: 161 GIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPL 220
           GII  K  +   + V+AK+++GA+EHIP  R++NL+  L K+   GF   G   D   P 
Sbjct: 128 GIIIPKHRAVGVTPVVAKTSTGAVEHIPIARVTNLSQTLDKLKESGFWVFGTDMDG-TPS 186

Query: 221 EQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
            +     K+ALI+G EGKG+    ++    M  + M G +++LN S AAAV +Y
Sbjct: 187 HKWNTAGKLALIIGNEGKGISANIKKQVDEMITIPMSGHVQSLNASVAAAVLMY 240


>gi|257125181|ref|YP_003163295.1| RNA methyltransferase, TrmH family, group 3 [Leptotrichia buccalis
           C-1013-b]
 gi|257049120|gb|ACV38304.1| RNA methyltransferase, TrmH family, group 3 [Leptotrichia buccalis
           C-1013-b]
          Length = 232

 Score =  120 bits (301), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 53/144 (36%), Positives = 86/144 (59%)

Query: 130 RNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPY 189
           +   +++VLD V DP N GAI+RSA  F  DGII   R S   +  + KS++GA+EH+  
Sbjct: 84  KEKSIVVVLDQVQDPRNFGAIIRSAECFGVDGIIIQDRNSVKVTETVVKSSTGAIEHVDI 143

Query: 190 IRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETAT 249
           ++++N++D + K+  +G+   G  +D +    QE   +K  L+LG+EG G+R K +E   
Sbjct: 144 VKVTNISDTIDKLKKYGYTVYGAEADGQNYYYQENYPEKACLVLGSEGNGMRKKVKEHCD 203

Query: 250 SMAHLHMPGIIKALNVSNAAAVAL 273
            +  +H+ G I +LNVS A  + L
Sbjct: 204 KIVKIHLKGEINSLNVSVAGGIIL 227


>gi|71083818|ref|YP_266538.1| SpoU rRNA methylase family [Candidatus Pelagibacter ubique
           HTCC1062]
 gi|91763146|ref|ZP_01265110.1| SpoU rRNA Methylase family protein [Candidatus Pelagibacter ubique
           HTCC1002]
 gi|71062931|gb|AAZ21934.1| SpoU rRNA Methylase family [Candidatus Pelagibacter ubique
           HTCC1062]
 gi|91717559|gb|EAS84210.1| SpoU rRNA Methylase family protein [Candidatus Pelagibacter ubique
           HTCC1002]
          Length = 247

 Score =  120 bits (301), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 68/233 (29%), Positives = 114/233 (48%), Gaps = 7/233 (3%)

Query: 49  LFLYGVHTVSAALNNPSRKIFQLLAT---KNALARLDWDANLPHPFPVKTVPPQTIDKIV 105
             + G H V  AL NP RK+ ++  T   K  + R +   N+     V     + +DK  
Sbjct: 6   FLIVGQHAVIEALRNPKRKVLKVFLTEESKKNIHRKNPKKNVLEDVKVYFKSKKELDKYT 65

Query: 106 GKEAV-HQGLALETAPLLSPTLDAV---RNSQLLMVLDHVNDPHNIGAILRSAVAFSCDG 161
            K+ + H G   E   +  P L      +N    + +D V DP NIG+++RSA +F  DG
Sbjct: 66  SKDQIMHGGYIAEVEHIDQPDLKEFIKGKNELTFVCIDEVTDPRNIGSLIRSASSFHIDG 125

Query: 162 IITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLE 221
           +I  +R  PS+S ++ K+ASG +EHI    +SN+   L+ +    F   G  +  +K   
Sbjct: 126 LIVKERQFPSDSKLMYKAASGCMEHINIFEVSNINSTLKNLREKNFWVYGFDARGEKDFT 185

Query: 222 QEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
           +     K  L+ G+EG G+R  T +       + +   +++LN+SN+AA+  +
Sbjct: 186 EIKWEGKNVLLFGSEGFGMREHTGKYTDFFVKIDINKDVESLNISNSAAIVFH 238


>gi|67924215|ref|ZP_00517655.1| RNA methyltransferase TrmH, group 3 [Crocosphaera watsonii WH 8501]
 gi|67853934|gb|EAM49253.1| RNA methyltransferase TrmH, group 3 [Crocosphaera watsonii WH 8501]
          Length = 292

 Score =  120 bits (301), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 76/247 (30%), Positives = 126/247 (51%), Gaps = 19/247 (7%)

Query: 42  HTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTI 101
            T Q ++  +YG H+V AAL +  R++ ++  T     RL +D    +           I
Sbjct: 37  QTEQSDDDLIYGRHSVLAALES-DRQLNRIWITN----RLHYDPRFHNLIQASKAKGAVI 91

Query: 102 DKI-------VGKEAVHQGLALETAPLLSPTLDAV-------RNSQLLMVLDHVNDPHNI 147
           D++       +   A HQG+A + AP     LD +        +  ++++ D ++DPHN+
Sbjct: 92  DEVSVQRLSQITNGANHQGVAAQVAPYNYHDLDGLIAQAKANSDEPVIVIADSISDPHNL 151

Query: 148 GAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGF 207
           GAI+R+A A  C G+I  +R +   ++ ++K A+GALE  P  R+ NL+ AL+ + + GF
Sbjct: 152 GAIIRTAEALGCQGMIIPQRRAAGVTSTVSKVAAGALESFPVARVVNLSRALETLKAEGF 211

Query: 208 QTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSN 267
              G  S+  K L+       I L++G+EG GL   TQ     +  + + G   +LN S 
Sbjct: 212 WIYGTVSEGGKRLQDFNFRGAIGLVIGSEGSGLSLLTQRCCDELVSIPLGGKTPSLNASV 271

Query: 268 AAAVALY 274
           AAA+ LY
Sbjct: 272 AAAINLY 278


>gi|148239400|ref|YP_001224787.1| tRNA/rRNA methyltransferase [Synechococcus sp. WH 7803]
 gi|147847939|emb|CAK23490.1| Possible tRNA/rRNA methyltransferase [Synechococcus sp. WH 7803]
          Length = 456

 Score =  120 bits (300), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 85/269 (31%), Positives = 141/269 (52%), Gaps = 23/269 (8%)

Query: 25  RNHRDYKKMQSFNQKSR-----HTSQP-ENLFLYGVHTVSAAL--NNPSRKIFQLLATKN 76
           R  R  +  + F +K R     H++ P  +  L+G H   AAL    P  +I+     ++
Sbjct: 129 RQDRSDRPDRRFEEKPRGESSSHSADPVADDLLWGRHATQAALEAGRPIHRIWCTSEMRS 188

Query: 77  A--LARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLD------- 127
           A    +L  DA       V+ V    + ++ G  AVHQG+AL+TA   + TLD       
Sbjct: 189 APRFMQLLRDAKSSGVL-VEEVTWARLAQMTGG-AVHQGIALQTA--AADTLDLADLIEG 244

Query: 128 --AVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALE 185
             A++ + LL+ LD + DPHN+GAI+RSA A    G++  +R S   +  +AK A+GALE
Sbjct: 245 CAALQEAPLLLALDGLTDPHNLGAIVRSAEALGAHGVVLPQRRSAGLTGSVAKVAAGALE 304

Query: 186 HIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQ 245
           H+P  R+ NL  +L+ +   G++ +GL+ +  + LE+      + ++ G+EG+GL   T+
Sbjct: 305 HLPVARVVNLNRSLETLKDAGYRVVGLAEEGDQTLEEADLEGPLVVVTGSEGQGLSMLTR 364

Query: 246 ETATSMAHLHMPGIIKALNVSNAAAVALY 274
                +  + + G+  +LN S A A+ LY
Sbjct: 365 RHCDQLIRIPLRGVTPSLNASVATALCLY 393


>gi|228477774|ref|ZP_04062402.1| RNA methyltransferase, TrmH family, group 3 [Streptococcus
           salivarius SK126]
 gi|228250466|gb|EEK09680.1| RNA methyltransferase, TrmH family, group 3 [Streptococcus
           salivarius SK126]
          Length = 247

 Score =  120 bits (300), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 81/234 (34%), Positives = 122/234 (52%), Gaps = 13/234 (5%)

Query: 50  FLYGVHTVSAALN-NPSRKIF--QLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVG 106
            +YGVH V+ +L  N   K++    L  KN  A     A       +   P +T+  + G
Sbjct: 11  IVYGVHAVTESLEANTGNKLYIQDDLRGKNVDAIKALAAE--KKVSISWTPKKTLSDMTG 68

Query: 107 KEAVHQGLALETAPL----LSPTLDAVRNSQ--LLMVLDHVNDPHNIGAILRSAVAFSCD 160
             AVHQG  L  +      LS  +D     +  L+++LD +NDPHN G+ILR+A A    
Sbjct: 69  G-AVHQGFVLRVSEFAYSELSVIMDKAEQEENPLVLILDGLNDPHNFGSILRTADATQVT 127

Query: 161 GIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPL 220
           G+I  K  +   + V+AK+++GA+EHIP  R++NL+  L K+   GF   G   D   P 
Sbjct: 128 GVIIPKHRAVGVTPVVAKTSTGAVEHIPIARVTNLSQTLDKLKEAGFWVFGTDMDG-TPS 186

Query: 221 EQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
            +     K+ALI+G EGKG+    ++    M  + M G +++LN S AAAV +Y
Sbjct: 187 HKWNTAGKVALIIGNEGKGISANIKKQVDEMITIPMSGHVQSLNASVAAAVLMY 240


>gi|15838579|ref|NP_299267.1| tRNA/rRNA methyltransferase [Xylella fastidiosa 9a5c]
 gi|52783331|sp|Q9PC00|RLMB_XYLFA RecName: Full=23S rRNA (guanosine-2'-O-)-methyltransferase RlmB;
           AltName: Full=23S rRNA Gm2251 2'-O-methyltransferase
 gi|9107096|gb|AAF84787.1|AE004018_3 tRNA/rRNA methyltransferase [Xylella fastidiosa 9a5c]
          Length = 249

 Score =  120 bits (300), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 80/239 (33%), Positives = 126/239 (52%), Gaps = 13/239 (5%)

Query: 47  ENLFLYGVHTVSAALNNPSRKIFQLL---ATKNALARLDWDANLPHP-FPVKTVPPQTID 102
           +N ++ G++ V +++ N +  + ++L    +KN+   LD + N       V+ V  Q +D
Sbjct: 4   KNQWIVGINAVVSSIENDAEHVCEVLVEAGSKNSRL-LDIEENARRKGIEVRRVTTQALD 62

Query: 103 KIVGKEAVHQGLALETAPL-------LSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAV 155
             VG    HQG+A   A +       L   +DA     LL+VLD V DPHN+GA LRSA 
Sbjct: 63  G-VGGGVRHQGVAARYAAVRLWEEHDLKDLVDAAGGQALLLVLDGVQDPHNLGACLRSAA 121

Query: 156 AFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSD 215
           A     +I  K  S   +A + K++SGA + +P I + NL  +L+++        GL  +
Sbjct: 122 AAGVTAVIIPKDKSVGINATVRKTSSGAADRLPVIAVVNLARSLRELQKQDVWIYGLEGE 181

Query: 216 SKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
           ++  L       K+AL+LG E  GLR  T+E    +A + MPG +++LNVS AA V L+
Sbjct: 182 AETSLYALDLRGKVALVLGGEADGLRRLTREHCDVLARIPMPGEVESLNVSVAAGVTLF 240


>gi|260912878|ref|ZP_05919364.1| 23S rRNA (guanosine-2'-O-)-methyltransferase RlmB [Pasteurella
           dagmatis ATCC 43325]
 gi|260633256|gb|EEX51421.1| 23S rRNA (guanosine-2'-O-)-methyltransferase RlmB [Pasteurella
           dagmatis ATCC 43325]
          Length = 245

 Score =  120 bits (300), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 85/237 (35%), Positives = 122/237 (51%), Gaps = 17/237 (7%)

Query: 51  LYGVHTVSAALNNPSRKIFQLLATKNAL-ARLDWDANLPH--PFPVKTVPPQTIDKIVGK 107
           +YG+H VSA LN    ++ ++   K     RL    N  H     V+ V  QT+DK    
Sbjct: 5   IYGIHAVSAFLNTAPERLIEVYVLKGREDKRLQPLLNELHRLGISVQFVNRQTLDKKADG 64

Query: 108 EAVHQGLALETAP---LLSPTLDAV---RNSQLLMVLDHVNDPHNIGAILRSAVAFSCDG 161
           E VHQG+     P   L    LDA+   + S LL+VLD V DPHN+GA LR+A A     
Sbjct: 65  E-VHQGIIARIQPAKELNEADLDAILKNKQSPLLLVLDGVTDPHNLGACLRTADAAGVCA 123

Query: 162 IITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHS----WGFQTIGLSSDSK 217
           +I  K  S   S++  K A GA E IP IR++NL   L+ + +    W    +G + ++ 
Sbjct: 124 VIVPKDKSAQLSSIARKVACGAAEVIPLIRVTNLARTLRDLQNEHNIW---VVGTAGEAT 180

Query: 218 KPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
           + L Q      +AL++GAEG G+R  T+E    +  + M G + +LNVS A  V L+
Sbjct: 181 ETLYQAKLTGGLALVMGAEGDGMRRLTRENCDQLISIPMAGSVSSLNVSVATGVCLF 237


>gi|238027543|ref|YP_002911774.1| TrmH family RNA methyltransferase [Burkholderia glumae BGR1]
 gi|237876737|gb|ACR29070.1| RNA methyltransferase, TrmH family, group 3 [Burkholderia glumae
           BGR1]
          Length = 250

 Score =  119 bits (299), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 81/239 (33%), Positives = 124/239 (51%), Gaps = 21/239 (8%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEA 109
            LYG H V+A L + +  + ++L  +    R   D      F ++T     +  I   E 
Sbjct: 6   VLYGFHAVTARLRHDASTVAEVLYDQTRRDRRMTD------F-LQTAKEAGVRLIAADET 58

Query: 110 VHQGLA-----------LETAPL---LSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAV 155
              GLA           +E  PL   L+  LD ++   LL+VLD V DPHN+GA LR A 
Sbjct: 59  RLWGLAHTERHQGVVARVEDLPLAQNLAELLDGIQGPALLLVLDGVTDPHNLGACLRVAD 118

Query: 156 AFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSD 215
           A     II  +  +   +A  AK ASGA + +PYI ++NL  AL+++   G   IG + D
Sbjct: 119 AAGAHAIIAPRDRAVGLNATAAKVASGAADTVPYITVTNLARALRELKDAGVWVIGTADD 178

Query: 216 SKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
           +   L +   +  +AL++GAEG+G+R  T++T   + +L M G +++LNVS A+ V LY
Sbjct: 179 APASLYETKLDGPVALVMGAEGEGMRRLTRDTCDDVMNLPMAGSVESLNVSVASGVCLY 237


>gi|306832717|ref|ZP_07465854.1| RNA methyltransferase [Streptococcus bovis ATCC 700338]
 gi|304425173|gb|EFM28302.1| RNA methyltransferase [Streptococcus bovis ATCC 700338]
          Length = 249

 Score =  119 bits (299), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 79/238 (33%), Positives = 127/238 (53%), Gaps = 17/238 (7%)

Query: 48  NLFLYGVHTVSAALN-NPSRKIF--QLLATKNALARLDWDANL--PHPFPVKTVPPQTID 102
           N  +YGVH V+ +L  N   K++    L  KN    +D   NL       +  +P +T++
Sbjct: 10  NDIVYGVHAVTESLTANTGNKLYIQDDLRGKN----VDKIKNLAAEKKVSISWMPKKTLN 65

Query: 103 KIVGKEAVHQGLALETAPLLSPTLDAV------RNSQLLMVLDHVNDPHNIGAILRSAVA 156
            +    AVHQG  L  +      LD +        + L+++LD +NDPHN G+ILR+A A
Sbjct: 66  DMTNG-AVHQGFVLRVSEFAYAELDMILDKAAQEENPLILILDGLNDPHNFGSILRTADA 124

Query: 157 FSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDS 216
            +  G+I  K  +   + V+AK+++GA+EH+P  R++NL+  L K+   GF   G   + 
Sbjct: 125 TNVTGVIIPKHRAVGVTPVVAKTSTGAIEHVPIARVTNLSQTLDKLKEQGFWVFGTDMNG 184

Query: 217 KKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
             P  +   + K+ALI+G EGKG+    ++    M  + M G +++LN S AAAV +Y
Sbjct: 185 -TPSHKWNTSGKLALIIGNEGKGISQNIKKQVDEMITIPMNGHVQSLNASVAAAVLMY 241


>gi|170730155|ref|YP_001775588.1| tRNA/rRNA methyltransferase [Xylella fastidiosa M12]
 gi|167964948|gb|ACA11958.1| tRNA/rRNA methyltransferase [Xylella fastidiosa M12]
          Length = 249

 Score =  119 bits (299), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 80/239 (33%), Positives = 127/239 (53%), Gaps = 13/239 (5%)

Query: 47  ENLFLYGVHTVSAALNNPSRKIFQLL---ATKNALARLDWDANLPHP-FPVKTVPPQTID 102
           +N ++ G++ V +++ N +  + ++L   A+KN+   LD + N       V+ V  Q +D
Sbjct: 4   KNQWIVGINAVVSSIENDAEHVREVLVEAASKNSRL-LDIEENARRKGIEVRRVTTQALD 62

Query: 103 KIVGKEAVHQGLALETAPL-------LSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAV 155
             VG    HQG+A   A +       L   +DA     LL+VLD V DPHN+GA LRSA 
Sbjct: 63  G-VGGGVRHQGVAARYAAVRLWEEHDLKDLVDAAGGQALLLVLDGVQDPHNLGACLRSAA 121

Query: 156 AFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSD 215
           A     +I +K  S   +A + K++SGA + +P I + NL  +L+++        GL+ +
Sbjct: 122 AAGVTAVIISKDKSVGINATVRKTSSGAADRLPVIAVVNLARSLRELQKQDVWIYGLAGE 181

Query: 216 SKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
            +  L        +AL+LG E  GLR  T+E    +A + MPG +++LNVS AA V L+
Sbjct: 182 VETSLYALDLRGNVALVLGGEADGLRRLTREHCDVLARIPMPGEVESLNVSVAAGVTLF 240


>gi|307709243|ref|ZP_07645701.1| spoU rRNA Methylase family protein [Streptococcus mitis SK564]
 gi|307619826|gb|EFN98944.1| spoU rRNA Methylase family protein [Streptococcus mitis SK564]
          Length = 242

 Score =  119 bits (298), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 79/238 (33%), Positives = 125/238 (52%), Gaps = 17/238 (7%)

Query: 48  NLFLYGVHTVSAAL-NNPSRKIF--QLLATKNA--LARLDWDANLPHPFPVKTVPPQTID 102
           N  +YGVH V+ AL  N   K++  + L  KN   + +L  +  +   +  K    +  +
Sbjct: 4   NDIVYGVHAVTEALLANTGNKLYLQEDLRGKNVEKVKKLATEKKVSISWTSKKSLSEMTE 63

Query: 103 KIVGKEAVHQGLALETAPLLSPTLDAV------RNSQLLMVLDHVNDPHNIGAILRSAVA 156
                 AVHQG  L  +      LD +        + LL++LD + DPHN+G+ILR+A A
Sbjct: 64  G-----AVHQGFVLRVSEFAYSELDQILVKTRQEENPLLLILDGLTDPHNLGSILRTADA 118

Query: 157 FSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDS 216
            +  G+I  K  +   + V+AK+A+GA+EH+P  R++NL+  L K+   GF T G   + 
Sbjct: 119 TNVSGVIIPKHRAVGVTPVVAKTATGAIEHVPIARVTNLSQTLDKLKDEGFWTFGTDMNG 178

Query: 217 KKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
             P  +     KIALI+G EGKG+    ++    M  + M G +++LN S AAA+ +Y
Sbjct: 179 -TPCHKWNTKGKIALIIGNEGKGISSNIKKQVDEMITIPMDGHVQSLNASVAAAILMY 235


>gi|168491355|ref|ZP_02715498.1| RNA methyltransferase, TrmH family, group 3 [Streptococcus
           pneumoniae CDC0288-04]
 gi|183574511|gb|EDT95039.1| RNA methyltransferase, TrmH family, group 3 [Streptococcus
           pneumoniae CDC0288-04]
          Length = 242

 Score =  119 bits (298), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 79/238 (33%), Positives = 124/238 (52%), Gaps = 17/238 (7%)

Query: 48  NLFLYGVHTVSAAL-NNPSRKIF--QLLATKNA--LARLDWDANLPHPFPVKTVPPQTID 102
           N  +YGVH V+ AL  N   K++  + L  KN   +  L  +  +   +  K    +  +
Sbjct: 4   NDIVYGVHAVTEALLANTGNKLYLQEDLRGKNVEKVKELATEKKVSISWTSKKSLSEMTE 63

Query: 103 KIVGKEAVHQGLALETAPLLSPTLDAV------RNSQLLMVLDHVNDPHNIGAILRSAVA 156
                 AVHQG  L  +      LD +        + LL++LD + DPHN+G+ILR+A A
Sbjct: 64  G-----AVHQGFVLRVSEFAYSELDYILAKTRQEENSLLLILDGLTDPHNLGSILRTADA 118

Query: 157 FSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDS 216
            +  G+I  K  +   + V+AK+A+GA+EH+P  R++NL+  L K+   GF T G   + 
Sbjct: 119 TNVSGVIIPKHRAVGVTPVVAKTATGAIEHVPIARVTNLSQTLDKLKDEGFWTFGTDMNG 178

Query: 217 KKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
             P  +     KIALI+G EGKG+    ++    M  + M G +++LN S AAA+ +Y
Sbjct: 179 -TPCHKWNTKGKIALIIGNEGKGISSNIKKQVDEMITIPMNGHVQSLNASVAAAILMY 235


>gi|188584816|ref|YP_001916361.1| RNA methyltransferase, TrmH family, group 3 [Natranaerobius
           thermophilus JW/NM-WN-LF]
 gi|179349503|gb|ACB83773.1| RNA methyltransferase, TrmH family, group 3 [Natranaerobius
           thermophilus JW/NM-WN-LF]
          Length = 247

 Score =  119 bits (298), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 75/222 (33%), Positives = 117/222 (52%), Gaps = 14/222 (6%)

Query: 65  SRKIFQLLATKNALARLDWDANLP----HPFPVKTVPPQTIDKIVGKEAVHQGLALETAP 120
           +RK+F++  +K++      D  L     H   +  VP   +DK+V     HQG+  ET P
Sbjct: 20  NRKVFRIYISKDSNKNFQ-DEMLKLAQQHNINLDKVPLDRLDKMVPTTE-HQGIVAETEP 77

Query: 121 LLSPTLDAV-----RNSQ---LLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSE 172
                LD V      N+Q    L++LDH+ DP N GAI+R+A A   DG+I  KR S   
Sbjct: 78  FKYSQLDTVLKGFDYNNQKPLTLLILDHLTDPQNFGAIIRTADAVGVDGVIIPKRRSVDV 137

Query: 173 SAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALI 232
           +  + K++SGA EH+P I++SNL   + K+       +G   D  + + +E  N  +AL+
Sbjct: 138 NPTVMKASSGAAEHVPIIKVSNLRQTISKLKEQWIWILGTDIDGDRGIFEENYNIPLALV 197

Query: 233 LGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
           +G E  G+ P  ++    +A++ M G + +LN S A AV LY
Sbjct: 198 VGNEASGMSPLVKKECDFIANIPMIGRVNSLNASVATAVVLY 239


>gi|226942911|ref|YP_002797984.1| RNA methyltransferase TrmH, group 3 [Azotobacter vinelandii DJ]
 gi|226717838|gb|ACO77009.1| RNA methyltransferase TrmH, group 3 [Azotobacter vinelandii DJ]
          Length = 247

 Score =  119 bits (298), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 80/238 (33%), Positives = 118/238 (49%), Gaps = 20/238 (8%)

Query: 51  LYGVHTVSAALNNPSRKIFQLLATKN-------ALARLDWDANLPHPFPVKTVPPQTIDK 103
           +YGVH V A L +  R++ +L   +        AL  L   A +     V     + +D+
Sbjct: 7   IYGVHAVEALLRHHPRRVKRLWLAEGRQDPRVQALLELARQARIA----VGQRERRELDE 62

Query: 104 IVGKEAVHQGLALETAP-------LLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVA 156
               E VHQG+  E +P       +L   LD      LL+VLD V DPHN+GA LR+A A
Sbjct: 63  WA--EGVHQGVVAEVSPSQVWGEAMLDELLDRCEGPPLLLVLDGVTDPHNLGACLRTADA 120

Query: 157 FSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDS 216
                +I  K  S + +A + K A GA E +P + ++NL   L+K+   G  T+G + + 
Sbjct: 121 AGAQAVIVPKDKSATLNATVRKVACGAAEVVPLVAVTNLARTLEKLRQRGLWTVGTAGEV 180

Query: 217 KKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
           ++ L          LI+GAEGKG+R  T+E    +  L M G + +LNVS A  V L+
Sbjct: 181 EQELYGVDLRGPTVLIMGAEGKGMRRLTREHCDYLVRLPMAGSVSSLNVSVATGVCLF 238


>gi|15901307|ref|NP_345911.1| spoU rRNA methylase family protein [Streptococcus pneumoniae TIGR4]
 gi|111657374|ref|ZP_01408131.1| hypothetical protein SpneT_02001428 [Streptococcus pneumoniae
           TIGR4]
 gi|221232182|ref|YP_002511335.1| SpoU rRNA methylase family protein [Streptococcus pneumoniae ATCC
           700669]
 gi|225854898|ref|YP_002736410.1| RNA methyltransferase, TrmH family, group 3 [Streptococcus
           pneumoniae JJA]
 gi|14972946|gb|AAK75551.1| RNA methyltransferase, TrmH family, group 3 [Streptococcus
           pneumoniae TIGR4]
 gi|220674643|emb|CAR69212.1| SpoU rRNA methylase family protein [Streptococcus pneumoniae ATCC
           700669]
 gi|225722312|gb|ACO18165.1| RNA methyltransferase, TrmH family, group 3 [Streptococcus
           pneumoniae JJA]
          Length = 242

 Score =  119 bits (298), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 80/238 (33%), Positives = 128/238 (53%), Gaps = 17/238 (7%)

Query: 48  NLFLYGVHTVSAAL-NNPSRKIF--QLLATKNA--LARLDWDANLPHPFPVKTVPPQTID 102
           N  +YGVH V+ AL  N   K++  + L  KN   +  L  +  +   +  K    +++ 
Sbjct: 4   NDIVYGVHAVTEALLANTGNKLYLQEDLRGKNVEKVKELATEKKVSISWTSK----KSLS 59

Query: 103 KIVGKEAVHQGLALETAPLLSPTLDAV------RNSQLLMVLDHVNDPHNIGAILRSAVA 156
           +I  + AVHQG  L  +      LD +        + LL++LD + DPHN+G+ILR+A A
Sbjct: 60  EIT-EGAVHQGFVLRVSEFAYSELDYILAKTRQEENPLLLILDGLTDPHNLGSILRTADA 118

Query: 157 FSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDS 216
            +  G+I  K  +   + V+AK+A+GA+EH+P  R++NL+  L K+   GF T G   + 
Sbjct: 119 TNVSGVIIPKHRTVGVTPVVAKTATGAIEHVPIARVTNLSQTLDKLKDEGFWTFGTDMNG 178

Query: 217 KKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
             P  +     KIALI+G EGKG+    ++    M  + M G +++LN S AAA+ +Y
Sbjct: 179 -TPCHKWNTKGKIALIIGNEGKGISSNIKKQVDEMITIPMNGHVQSLNASVAAAILMY 235


>gi|332522981|ref|ZP_08399233.1| RNA methyltransferase, TrmH family, group 3 [Streptococcus porcinus
           str. Jelinkova 176]
 gi|332314245|gb|EGJ27230.1| RNA methyltransferase, TrmH family, group 3 [Streptococcus porcinus
           str. Jelinkova 176]
          Length = 248

 Score =  119 bits (298), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 78/243 (32%), Positives = 128/243 (52%), Gaps = 17/243 (6%)

Query: 48  NLFLYGVHTVSAALN-NPSRKIF--QLLATKNALARLDWDANLPHP--FPVKTVPPQTID 102
           N  +YGVH V+ +LN N   K++  + L  KN    +D   NL       +   P +T+ 
Sbjct: 10  NDMVYGVHAVTESLNANTGNKLYIQEDLRGKN----VDTIKNLARDKKVSISWAPKKTLS 65

Query: 103 KIVGKEAVHQGLALETAPLLSPTLDAV------RNSQLLMVLDHVNDPHNIGAILRSAVA 156
            +  + AVHQG  L  +      L+ +        + L++VLD + DPHN G+ILR+A A
Sbjct: 66  DMT-EGAVHQGFVLRVSAFAYSELETLIAKAEKEENPLILVLDGLTDPHNFGSILRTADA 124

Query: 157 FSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDS 216
               G++  K  +   + V+AK+++GA+EH+P  R++NL+  L K+   GF   G   D 
Sbjct: 125 TKVCGVVIPKHRAVGVTPVVAKTSTGAVEHVPIARVTNLSQTLDKLKEAGFWIFGTDMDG 184

Query: 217 KKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYIT 276
             P+++   + K+ LI+G+EGKG+    ++    M  + M G +++LN   AAAV +Y  
Sbjct: 185 -TPVQKWNTSGKLVLIIGSEGKGISTNIKKQVDEMITIPMDGHVQSLNAGVAAAVLMYEV 243

Query: 277 QNH 279
             H
Sbjct: 244 FRH 246


>gi|148984799|ref|ZP_01818052.1| TrmH family RNA methyltransferase group 3 [Streptococcus pneumoniae
           SP3-BS71]
 gi|148990265|ref|ZP_01821476.1| TrmH family RNA methyltransferase group 3 [Streptococcus pneumoniae
           SP6-BS73]
 gi|168486152|ref|ZP_02710660.1| RNA methyltransferase, TrmH family, group 3 [Streptococcus
           pneumoniae CDC1087-00]
 gi|225860774|ref|YP_002742283.1| RNA methyltransferase, TrmH family, group 3 [Streptococcus
           pneumoniae Taiwan19F-14]
 gi|298230952|ref|ZP_06964633.1| RNA methyltransferase, TrmH family, group 3 [Streptococcus
           pneumoniae str. Canada MDR_19F]
 gi|298254976|ref|ZP_06978562.1| RNA methyltransferase, TrmH family, group 3 [Streptococcus
           pneumoniae str. Canada MDR_19A]
 gi|298502589|ref|YP_003724529.1| TrmH family tRNA/rRNA methyltransferase [Streptococcus pneumoniae
           TCH8431/19A]
 gi|147922821|gb|EDK73937.1| TrmH family RNA methyltransferase group 3 [Streptococcus pneumoniae
           SP3-BS71]
 gi|147924404|gb|EDK75494.1| TrmH family RNA methyltransferase group 3 [Streptococcus pneumoniae
           SP6-BS73]
 gi|183570789|gb|EDT91317.1| RNA methyltransferase, TrmH family, group 3 [Streptococcus
           pneumoniae CDC1087-00]
 gi|225727049|gb|ACO22900.1| RNA methyltransferase, TrmH family, group 3 [Streptococcus
           pneumoniae Taiwan19F-14]
 gi|298238184|gb|ADI69315.1| TrmH family tRNA/rRNA methyltransferase [Streptococcus pneumoniae
           TCH8431/19A]
 gi|301800307|emb|CBW32933.1| SpoU rRNA methylase family protein [Streptococcus pneumoniae
           OXC141]
 gi|327389642|gb|EGE87987.1| RNA 2'-O ribose methyltransferase substrate binding family protein
           [Streptococcus pneumoniae GA04375]
 gi|332073794|gb|EGI84272.1| RNA 2'-O ribose methyltransferase substrate binding family protein
           [Streptococcus pneumoniae GA41301]
          Length = 242

 Score =  119 bits (297), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 80/238 (33%), Positives = 128/238 (53%), Gaps = 17/238 (7%)

Query: 48  NLFLYGVHTVSAAL-NNPSRKIF--QLLATKNA--LARLDWDANLPHPFPVKTVPPQTID 102
           N  +YGVH V+ AL  N   K++  + L  KN   +  L  +  +   +  K    +++ 
Sbjct: 4   NDIVYGVHAVTEALLANTGNKLYLQEDLRGKNVEKVKELATEKKVSISWTSK----KSLS 59

Query: 103 KIVGKEAVHQGLALETAPLLSPTLDAV------RNSQLLMVLDHVNDPHNIGAILRSAVA 156
           +I  + AVHQG  L  +      LD +        + LL++LD + DPHN+G+ILR+A A
Sbjct: 60  EIT-EGAVHQGFVLRVSEFAYSELDYILAKTRQEENPLLLILDGLTDPHNLGSILRTADA 118

Query: 157 FSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDS 216
            +  G+I  K  +   + V+AK+A+GA+EH+P  R++NL+  L K+   GF T G   + 
Sbjct: 119 TNVSGVIIPKHRAVGVTPVVAKTATGAIEHVPIARVTNLSQTLDKLKDEGFWTFGTDMNG 178

Query: 217 KKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
             P  +     KIALI+G EGKG+    ++    M  + M G +++LN S AAA+ +Y
Sbjct: 179 -TPCHKWNTKGKIALIIGNEGKGISSNIKKQVDEMITIPMNGHVQSLNASVAAAILMY 235


>gi|323126494|gb|ADX23791.1| putative tRNA/rRNA methyltransferase [Streptococcus dysgalactiae
           subsp. equisimilis ATCC 12394]
          Length = 248

 Score =  119 bits (297), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 76/238 (31%), Positives = 133/238 (55%), Gaps = 17/238 (7%)

Query: 48  NLFLYGVHTVSAALN-NPSRKIF--QLLATKNA--LARLDWDANLPHPFPVKTVPPQTID 102
           N  +YGVH V+ +L+ N   K++  + L  KN   + RL  +  +     +   P +T+ 
Sbjct: 10  NDIVYGVHAVTESLHANTGNKLYIQEDLRGKNVDNIKRLATEKKVS----ISWTPKKTLS 65

Query: 103 KIVGKEAVHQGLALETAPLLSPTLDAV------RNSQLLMVLDHVNDPHNIGAILRSAVA 156
           ++  + AVHQG  L  +      LD +       ++ L+++LD + DPHN+G+ILR+A A
Sbjct: 66  EMT-EGAVHQGFVLRVSAFAYTELDVILEKAEQEDNPLILILDGLTDPHNLGSILRTADA 124

Query: 157 FSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDS 216
            +  G+I  K  +   + V++K+++GA+EH+P  R++NL+  L K+ + GF T G   + 
Sbjct: 125 TNVCGVIIPKHRAVGVTPVVSKTSTGAVEHVPIARVTNLSQTLDKLKAKGFWTFGTDMNG 184

Query: 217 KKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
             P  +   + K+ALI+G EGKG+    ++    M  + M G +++LN S AAA+ +Y
Sbjct: 185 -TPSHRWNTSGKLALIIGNEGKGISANIKKQVDEMITIPMNGHVQSLNASVAAAILMY 241


>gi|225857083|ref|YP_002738594.1| RNA methyltransferase, TrmH family, group 3 [Streptococcus
           pneumoniae P1031]
 gi|225725663|gb|ACO21515.1| RNA methyltransferase, TrmH family, group 3 [Streptococcus
           pneumoniae P1031]
 gi|332074779|gb|EGI85253.1| RNA 2'-O ribose methyltransferase substrate binding family protein
           [Streptococcus pneumoniae GA17545]
          Length = 242

 Score =  119 bits (297), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 80/238 (33%), Positives = 128/238 (53%), Gaps = 17/238 (7%)

Query: 48  NLFLYGVHTVSAAL-NNPSRKIF--QLLATKNA--LARLDWDANLPHPFPVKTVPPQTID 102
           N  +YGVH V+ AL  N   K++  + L  KN   +  L  +  +   +  K    +++ 
Sbjct: 4   NDIVYGVHAVTEALLANTGNKLYLQEDLRGKNVEKVKELATEKKVSISWTSK----KSLS 59

Query: 103 KIVGKEAVHQGLALETAPLLSPTLDAV------RNSQLLMVLDHVNDPHNIGAILRSAVA 156
           +I  + AVHQG  L  +      LD +        + LL++LD + DPHN+G+ILR+A A
Sbjct: 60  EIT-EGAVHQGFVLRVSEFAYSELDYILAKTRQEENPLLLILDGLTDPHNLGSILRTADA 118

Query: 157 FSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDS 216
            +  G+I  K  +   + V+AK+A+GA+EH+P  R++NL+  L K+   GF T G   + 
Sbjct: 119 TNVSGVIIPKHRAVGVTPVVAKTATGAIEHVPIARVTNLSQTLDKLKDEGFWTFGTDMNG 178

Query: 217 KKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
             P  +     KIALI+G EGKG+    ++    M  + M G +++LN S AAA+ +Y
Sbjct: 179 -TPCHKWNTKGKIALIIGNEGKGISSNIKKQVDEMITIPMNGHVQSLNASVAAAILMY 235


>gi|302878484|ref|YP_003847048.1| RNA methyltransferase, TrmH family, group 3 [Gallionella
           capsiferriformans ES-2]
 gi|302581273|gb|ADL55284.1| RNA methyltransferase, TrmH family, group 3 [Gallionella
           capsiferriformans ES-2]
          Length = 247

 Score =  119 bits (297), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 75/233 (32%), Positives = 121/233 (51%), Gaps = 9/233 (3%)

Query: 50  FLYGVHTVSAAL-NNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQT--IDKIVG 106
            +YG H V++ +  NP   +   L ++    R+     L     V+ +P  +  +D + G
Sbjct: 6   LIYGFHAVTSRIRQNPEGVMEIYLQSQRQDQRMRDLIALAELSGVRVIPVDSARLDGMAG 65

Query: 107 KEAVHQGLALETAPL-----LSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDG 161
             A HQG+A           LS  L+ +    LL+VLD + DPHN+GA LRSA AF    
Sbjct: 66  G-ARHQGVAARVDAARRVQHLSDVLETLTEPPLLLVLDGIQDPHNLGACLRSADAFGVHA 124

Query: 162 IITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLE 221
           +I  K  +   +A + K A GA E +PYI ++NL   L+++   G   +G + ++K+ L 
Sbjct: 125 VIAPKDRAVGITATVEKVACGAAETVPYITVTNLARTLRELKDQGIWVVGAAGEAKQDLH 184

Query: 222 QEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
                  +A++LGAEG+GLR  T ET   +  + M G +++LNVS +  + L+
Sbjct: 185 SFKHTGPLAIVLGAEGEGLRRLTMETCDELVRIPMLGSVESLNVSVSTGICLF 237


>gi|237821018|ref|ZP_04596863.1| RNA methyltransferase, TrmH family, group 3 [Streptococcus
           pneumoniae CCRI 1974M2]
          Length = 251

 Score =  119 bits (297), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 80/247 (32%), Positives = 127/247 (51%), Gaps = 35/247 (14%)

Query: 48  NLFLYGVHTVSAAL-NNPSRKIF-------------QLLATKNALARLDWDANLPHPFPV 93
           N  +YGVH V+ AL  N   K++             + LAT+  ++ + W +        
Sbjct: 4   NDIVYGVHAVTEALLANTGNKLYLQEDLRGKNVEKVKELATEKKVS-ISWTSK------- 55

Query: 94  KTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAV------RNSQLLMVLDHVNDPHNI 147
           K++   T      + AVHQG  L  +      LD +        + LL++LD + DPHN+
Sbjct: 56  KSLSEMT------EGAVHQGFVLRVSEFAYSELDYILAKTRQEENPLLLILDGLTDPHNL 109

Query: 148 GAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGF 207
           G+ILR+A A +  G+I  K  +   + V+AK+A+GA+EH+P  R++NL+  L K+   GF
Sbjct: 110 GSILRTADATNVSGVIIPKHRTVGVTPVVAKTATGAIEHVPIARVTNLSQTLDKLKDEGF 169

Query: 208 QTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSN 267
            T G   +   P  +     KIALI+G EGKG+    ++    M  + M G +++LN S 
Sbjct: 170 WTFGTDMNG-TPCHKWNTKGKIALIIGNEGKGISSNIKKQVDEMITIPMNGHVQSLNASV 228

Query: 268 AAAVALY 274
           AAA+ +Y
Sbjct: 229 AAAILMY 235


>gi|260891370|ref|ZP_05902633.1| RNA methyltransferase, TrmH family, group 3 [Leptotrichia hofstadii
           F0254]
 gi|260858753|gb|EEX73253.1| RNA methyltransferase, TrmH family, group 3 [Leptotrichia hofstadii
           F0254]
          Length = 233

 Score =  119 bits (297), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 52/144 (36%), Positives = 86/144 (59%)

Query: 130 RNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPY 189
           +   +++VLD V DP N GAI+RSA  F  DGII   R S   +  + KS++GA+EH+  
Sbjct: 84  KEKSIVVVLDQVQDPRNFGAIIRSAECFGVDGIIIQDRNSVKVTETVVKSSTGAIEHVDI 143

Query: 190 IRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETAT 249
           ++++N++D + K+  +G+   G  +D +    +E   +K  L+LG+EG G+R K +E   
Sbjct: 144 VKVTNISDTIDKLKKYGYAVYGAEADGQNYYYEENYPEKACLVLGSEGNGMRKKVKEHCD 203

Query: 250 SMAHLHMPGIIKALNVSNAAAVAL 273
            +  +H+ G I +LNVS A  + L
Sbjct: 204 KIVKIHLKGQINSLNVSVAGGIIL 227


>gi|322376908|ref|ZP_08051401.1| RNA methyltransferase, TrmH family, group 3 [Streptococcus sp.
           M334]
 gi|321282715|gb|EFX59722.1| RNA methyltransferase, TrmH family, group 3 [Streptococcus sp.
           M334]
          Length = 253

 Score =  118 bits (296), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 78/236 (33%), Positives = 127/236 (53%), Gaps = 13/236 (5%)

Query: 48  NLFLYGVHTVSAALN-NPSRKIF--QLLATKNALARLDWDANLPHPFPVKTVPPQTIDKI 104
           N  +YGVH V+ AL  N   K++  + L  KN L ++  +        +     +++ +I
Sbjct: 15  NDIVYGVHAVTEALRANTGNKLYLQEDLRGKN-LEKVK-ELATEKKVSISWTSKKSLSEI 72

Query: 105 VGKEAVHQGLALETAPLLSPTLDAV------RNSQLLMVLDHVNDPHNIGAILRSAVAFS 158
             + AVHQG  L  +      LD +        + LL++LD + DPHN+G+ILR+A A +
Sbjct: 73  T-EGAVHQGFVLRVSEFAYSELDHILAKTHQEENPLLLILDGLTDPHNLGSILRTADATN 131

Query: 159 CDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKK 218
             G+I  K  +   + V++K+A+GA+EH+P  R++NL+  L K+   GF T G   +   
Sbjct: 132 VSGVIIPKHRAVGVTPVVSKTATGAIEHVPIARVTNLSQTLDKLKDEGFWTFGTDMNG-T 190

Query: 219 PLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
           P  +     KIALI+G EGKG+    ++    M  + M G +++LN S AAA+ +Y
Sbjct: 191 PCHKWNTKGKIALIIGNEGKGISSNIKKQVDEMITIPMNGHVQSLNASVAAAILMY 246


>gi|88808428|ref|ZP_01123938.1| hypothetical protein WH7805_02022 [Synechococcus sp. WH 7805]
 gi|88787416|gb|EAR18573.1| hypothetical protein WH7805_02022 [Synechococcus sp. WH 7805]
          Length = 370

 Score =  118 bits (296), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 84/272 (30%), Positives = 139/272 (51%), Gaps = 17/272 (6%)

Query: 16  KDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAAL--NNPSRKIFQLLA 73
           +DS   +  R  R + +      KS       +  L+G H   AAL    P  +I+    
Sbjct: 40  QDSRSLRSDRQDRRFDEKPRGEAKSHSADSVADDLLWGRHATQAALEAGRPIHRIWCTSE 99

Query: 74  TKNA--LARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLD---- 127
            ++A    +L  DA       V+ V    + ++ G  AVHQG+AL+TA   + TLD    
Sbjct: 100 MRSAPRFMQLLRDAKASGVL-VEEVTWARLAQMTGG-AVHQGIALQTAA--AETLDLSDL 155

Query: 128 -----AVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASG 182
                A++ + LL+ LD + DPHN+GAI+RSA A    G++  +R S   +  +AK A+G
Sbjct: 156 IEGCAALQEAPLLLALDGLTDPHNLGAIVRSAEALGAHGVVLPQRRSAGLTGSVAKVAAG 215

Query: 183 ALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRP 242
           ALEH+P  R+ NL  +L+ +   G++ +GL+ +  + LE+   +  + ++ G+E +GL  
Sbjct: 216 ALEHLPVARVVNLNRSLETLKDAGYRVVGLAEEGDQTLEEVDLDGPLVVVTGSEDQGLSM 275

Query: 243 KTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
            T+     +  + + GI  +LN S A A+ LY
Sbjct: 276 LTRRHCDHLIRIPLRGITPSLNASVATALCLY 307


>gi|307702003|ref|ZP_07639011.1| RNA methyltransferase, TrmH family, group 3 [Streptococcus mitis
           NCTC 12261]
 gi|307616648|gb|EFN95837.1| RNA methyltransferase, TrmH family, group 3 [Streptococcus mitis
           NCTC 12261]
          Length = 242

 Score =  118 bits (296), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 80/247 (32%), Positives = 127/247 (51%), Gaps = 35/247 (14%)

Query: 48  NLFLYGVHTVSAAL-NNPSRKIF-------------QLLATKNALARLDWDANLPHPFPV 93
           N  +YGVH V+ AL  N   K++             + LAT+  ++ + W +        
Sbjct: 4   NDIVYGVHAVTEALLANTGNKLYLQEDLRGKNVEKVKELATEKKVS-ISWTSK------- 55

Query: 94  KTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAV------RNSQLLMVLDHVNDPHNI 147
           K++   T      + AVHQG  L  +      LD +        + LL++LD + DPHN+
Sbjct: 56  KSLSEMT------EGAVHQGFVLRVSEFAYSELDQILAKTRQEENPLLLILDGLTDPHNL 109

Query: 148 GAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGF 207
           G+ILR+A A +  G+I  K  +   + V+AK+A+GA+EH+P  R++NL+  L K+   GF
Sbjct: 110 GSILRTADATNVSGVIIPKHRAVGVTPVVAKTATGAIEHVPIARVTNLSQTLDKLKGEGF 169

Query: 208 QTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSN 267
            T G   +   P  +     KIALI+G EGKG+    ++    M  + M G +++LN S 
Sbjct: 170 WTFGTDMNG-TPCHKWNTKGKIALIIGNEGKGISTNIKKQVDEMITIPMNGHVQSLNASV 228

Query: 268 AAAVALY 274
           AAA+ +Y
Sbjct: 229 AAAILMY 235


>gi|332526798|ref|ZP_08402899.1| RNA methyltransferase [Rubrivivax benzoatilyticus JA2]
 gi|332111200|gb|EGJ11232.1| RNA methyltransferase [Rubrivivax benzoatilyticus JA2]
          Length = 262

 Score =  118 bits (296), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 64/169 (37%), Positives = 95/169 (56%), Gaps = 5/169 (2%)

Query: 111 HQGLALETAPL-----LSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITT 165
           HQG+     PL     L   LDA   + L++VLD V DPHN+GA LR A       ++  
Sbjct: 86  HQGVVARVTPLATTHSLDDALDAAVGAPLVLVLDGVTDPHNLGACLRVADGAGACAVVAP 145

Query: 166 KRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIK 225
           K ++   +A +AK ASGA E +PY+ ++NL  +L +M     + IG S D+ K +     
Sbjct: 146 KDHAVGLNATVAKVASGAAETVPYLMVTNLARSLGEMKERDIRVIGTSDDATKTIYDVDL 205

Query: 226 NDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
              +AL+LGAEG G+R  T++T   +  + M G +++LNVS AA + LY
Sbjct: 206 RGPVALVLGAEGHGMRQLTRKTCDELVRIPMQGAVESLNVSVAAGICLY 254


>gi|167836767|ref|ZP_02463650.1| RNA methyltransferase, TrmH family, group 3 [Burkholderia
           thailandensis MSMB43]
          Length = 247

 Score =  118 bits (296), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 67/169 (39%), Positives = 98/169 (57%), Gaps = 5/169 (2%)

Query: 111 HQGLA--LETAPL---LSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITT 165
           HQG+   +E  PL   L+  LD +    LL+VLD V DPHN+GA LR A A     II  
Sbjct: 69  HQGVVARVEDLPLAQNLAELLDGIEGPALLLVLDGVTDPHNLGACLRVADAAGAHAIIAP 128

Query: 166 KRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIK 225
           +  +   +A  AK ASGA + +PYI ++NL  AL+++   G   IG S D+   L     
Sbjct: 129 RDRAAGLNATAAKVASGAADTVPYITVTNLARALRELKDAGVWVIGTSDDATASLYDTKL 188

Query: 226 NDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
           +  +AL++GAEG+G+R  T++T   +  + M G +++LNVS A+ V LY
Sbjct: 189 DGPVALVMGAEGEGMRRLTRDTCDEVMFIPMAGSVESLNVSVASGVCLY 237


>gi|295676348|ref|YP_003604872.1| RNA methyltransferase, TrmH family, group 3 [Burkholderia sp.
           CCGE1002]
 gi|295436191|gb|ADG15361.1| RNA methyltransferase, TrmH family, group 3 [Burkholderia sp.
           CCGE1002]
          Length = 247

 Score =  118 bits (296), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 62/169 (36%), Positives = 100/169 (59%), Gaps = 5/169 (2%)

Query: 111 HQGLALETAPL-----LSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITT 165
           HQG+      L     L+  LD +  S L++VLD V DPHN+GA LR A A     +I  
Sbjct: 69  HQGVVARAGDLPLAQNLAELLDGISGSPLILVLDGVTDPHNLGACLRVADAAGAHAVIAP 128

Query: 166 KRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIK 225
           +  +   +A  AK ASGA + +PYI ++NL  AL+++   G   +G + D++K + +   
Sbjct: 129 RDRAVGLNATAAKVASGAADTVPYITVTNLARALRELKDAGVWVVGTAGDAQKSVYETEL 188

Query: 226 NDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
           +  +AL++GAEG+G+R  T+ET   + ++ M G +++LNVS A+ V L+
Sbjct: 189 DGPVALVMGAEGEGMRRLTRETCDVVMNIPMAGTVESLNVSVASGVCLF 237


>gi|322517687|ref|ZP_08070550.1| TrmH family RNA methyltransferase [Streptococcus vestibularis ATCC
           49124]
 gi|322123675|gb|EFX95267.1| TrmH family RNA methyltransferase [Streptococcus vestibularis ATCC
           49124]
          Length = 247

 Score =  118 bits (296), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 80/234 (34%), Positives = 121/234 (51%), Gaps = 13/234 (5%)

Query: 50  FLYGVHTVSAALN-NPSRKIF--QLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVG 106
            +YGVH V+ +L  N   K++    L  KN  A     A       +   P +T+  + G
Sbjct: 11  IVYGVHAVTESLEANTGNKLYIQDDLRGKNVDAIKALAAE--KKVSISWTPKKTLSDMTG 68

Query: 107 KEAVHQGLALETAPL----LSPTLDAVRNSQ--LLMVLDHVNDPHNIGAILRSAVAFSCD 160
             AVHQG  L  +       S  +D     +  L+++LD +NDPHN G+ILR+A A    
Sbjct: 69  G-AVHQGFVLRVSEFAYSDFSVIMDKAEQEENPLILILDGLNDPHNFGSILRTADATQVT 127

Query: 161 GIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPL 220
           G+I  K  +   + V+AK+++GA+EHIP  R++NL+  L K+   GF   G   D   P 
Sbjct: 128 GVIIPKHRAVGVTPVVAKTSTGAVEHIPIARVTNLSQTLDKLKESGFWVFGTDMDG-TPS 186

Query: 221 EQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
            +     K+ALI+G EGKG+    ++    M  + M G +++LN S AAAV +Y
Sbjct: 187 HKWNTAGKLALIIGNEGKGISANIKKQVDEMITIPMSGHVQSLNASVAAAVLMY 240


>gi|288904447|ref|YP_003429668.1| RNA methyltransferase, TrmH family [Streptococcus gallolyticus
           UCN34]
 gi|306830480|ref|ZP_07463650.1| RNA methyltransferase [Streptococcus gallolyticus subsp.
           gallolyticus TX20005]
 gi|325977443|ref|YP_004287159.1| TrmH family RNA methyltransferase [Streptococcus gallolyticus
           subsp. gallolyticus ATCC BAA-2069]
 gi|288731172|emb|CBI12720.1| putative RNA methyltransferase, TrmH family [Streptococcus
           gallolyticus UCN34]
 gi|304427505|gb|EFM30607.1| RNA methyltransferase [Streptococcus gallolyticus subsp.
           gallolyticus TX20005]
 gi|325177371|emb|CBZ47415.1| RNA methyltransferase, TrmH family [Streptococcus gallolyticus
           subsp. gallolyticus ATCC BAA-2069]
          Length = 249

 Score =  118 bits (296), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 79/238 (33%), Positives = 125/238 (52%), Gaps = 17/238 (7%)

Query: 48  NLFLYGVHTVSAALN-NPSRKIF--QLLATKNALARLDWDANL--PHPFPVKTVPPQTID 102
           N  +YGVH V+ +L  N   K++    L  KN    +D   NL       +   P +T+ 
Sbjct: 10  NDIVYGVHAVTESLTANTGNKLYIQDDLRGKN----VDKIKNLAAEKKVSISWTPKKTLS 65

Query: 103 KIVGKEAVHQGLALETAPLLSPTLDAV------RNSQLLMVLDHVNDPHNIGAILRSAVA 156
            +    AVHQG  L  +      LD +        + L+++LD +NDPHN G+ILR+A A
Sbjct: 66  DMTNG-AVHQGFVLRVSEFAYAELDTILDKAAQEENPLILILDGLNDPHNFGSILRTADA 124

Query: 157 FSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDS 216
            +  G+I  K  +   + V+AK+++GA+EH+P  R++NL+  L K+   GF   G   + 
Sbjct: 125 TNVTGVIIPKHRAVGVTPVVAKTSTGAVEHVPIARVTNLSQTLDKLKEQGFWVFGTDMNG 184

Query: 217 KKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
             P  +   + K+ALI+G EGKG+    ++    M  + M G +++LN S AAAV +Y
Sbjct: 185 -TPSHKWNTSGKLALIIGNEGKGISQNIKKQVDEMITIPMNGHVQSLNASVAAAVLMY 241


>gi|307704980|ref|ZP_07641867.1| spoU rRNA Methylase family protein [Streptococcus mitis SK597]
 gi|307621431|gb|EFO00481.1| spoU rRNA Methylase family protein [Streptococcus mitis SK597]
          Length = 242

 Score =  118 bits (296), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 81/247 (32%), Positives = 127/247 (51%), Gaps = 35/247 (14%)

Query: 48  NLFLYGVHTVSAAL-NNPSRKIF-------------QLLATKNALARLDWDANLPHPFPV 93
           N  +YGVH V+ AL  N   K++             + LAT+  ++ + W +        
Sbjct: 4   NDIVYGVHAVTEALLANTGNKLYLQEDLRGKNVEKVKELATEKKVS-ISWTSK------- 55

Query: 94  KTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAV------RNSQLLMVLDHVNDPHNI 147
           K++   T      + AVHQG  L  +      LD +        + LL++LD + DPHN+
Sbjct: 56  KSLSEMT------EGAVHQGFVLRVSEFSYSELDNILAKTRQEENPLLLILDGLTDPHNL 109

Query: 148 GAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGF 207
           G+ILR+A A +  G+I  K  +   + V+AK+A+GA+EHIP  R++NL+  L K+   GF
Sbjct: 110 GSILRTADATNVSGVIIPKHRAVGVTPVVAKTATGAIEHIPIARVTNLSQTLDKLKDEGF 169

Query: 208 QTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSN 267
            T G   +   P  +     KIALI+G EGKG+    ++    M  + M G +++LN S 
Sbjct: 170 WTFGTDMNG-TPCHKWNTKGKIALIIGNEGKGISSNIKKQVDEMITIPMNGHVQSLNASV 228

Query: 268 AAAVALY 274
           AAA+ +Y
Sbjct: 229 AAAILMY 235


>gi|83720095|ref|YP_443037.1| RNA methyltransferase [Burkholderia thailandensis E264]
 gi|167620200|ref|ZP_02388831.1| RNA methyltransferase, TrmH family, group 3 [Burkholderia
           thailandensis Bt4]
 gi|257139267|ref|ZP_05587529.1| RNA methyltransferase [Burkholderia thailandensis E264]
 gi|83653920|gb|ABC37983.1| RNA methyltransferase, TrmH family, group 3 [Burkholderia
           thailandensis E264]
          Length = 247

 Score =  118 bits (296), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 68/169 (40%), Positives = 98/169 (57%), Gaps = 5/169 (2%)

Query: 111 HQGLA--LETAPL---LSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITT 165
           HQG+   +E  PL   L+  LD V    LL+VLD V DPHN+GA LR A A     II  
Sbjct: 69  HQGVVARVEDLPLAQNLAELLDGVAGPALLLVLDGVTDPHNLGACLRVADAAGAHAIIAP 128

Query: 166 KRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIK 225
           +  +   +A  AK ASGA + +PYI ++NL  AL+++   G   IG S D+   L     
Sbjct: 129 RDRAAGLNATAAKVASGAADTVPYITVTNLARALRELKDAGVWVIGTSDDATASLYDTKL 188

Query: 226 NDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
           +  +AL++GAEG+G+R  T++T   +  + M G +++LNVS A+ V LY
Sbjct: 189 DGPVALVMGAEGEGMRRLTRDTCDEVMFIPMAGSVESLNVSVASGVCLY 237


>gi|149002852|ref|ZP_01827778.1| spoU rRNA methylase family protein [Streptococcus pneumoniae
           SP14-BS69]
 gi|168493358|ref|ZP_02717501.1| RNA methyltransferase, TrmH family, group 3 [Streptococcus
           pneumoniae CDC3059-06]
 gi|194397072|ref|YP_002038090.1| TrmH family RNA methyltransferase [Streptococcus pneumoniae G54]
 gi|225859218|ref|YP_002740728.1| RNA methyltransferase, TrmH family, group 3 [Streptococcus
           pneumoniae 70585]
 gi|237651107|ref|ZP_04525359.1| RNA methyltransferase, TrmH family, group 3 [Streptococcus
           pneumoniae CCRI 1974]
 gi|303254383|ref|ZP_07340490.1| RNA methyltransferase, TrmH family protein [Streptococcus
           pneumoniae BS455]
 gi|303259053|ref|ZP_07345032.1| spoU rRNA methylase family protein [Streptococcus pneumoniae
           SP-BS293]
 gi|303261733|ref|ZP_07347680.1| spoU rRNA methylase family protein [Streptococcus pneumoniae
           SP14-BS292]
 gi|303264406|ref|ZP_07350326.1| spoU rRNA methylase family protein [Streptococcus pneumoniae BS397]
 gi|303267526|ref|ZP_07353374.1| spoU rRNA methylase family protein [Streptococcus pneumoniae BS457]
 gi|303269332|ref|ZP_07355105.1| spoU rRNA methylase family protein [Streptococcus pneumoniae BS458]
 gi|147759146|gb|EDK66140.1| spoU rRNA methylase family protein [Streptococcus pneumoniae
           SP14-BS69]
 gi|183576562|gb|EDT97090.1| RNA methyltransferase, TrmH family, group 3 [Streptococcus
           pneumoniae CDC3059-06]
 gi|194356739|gb|ACF55187.1| RNA methyltransferase, TrmH family [Streptococcus pneumoniae G54]
 gi|225722127|gb|ACO17981.1| RNA methyltransferase, TrmH family, group 3 [Streptococcus
           pneumoniae 70585]
 gi|301802185|emb|CBW34931.1| SpoU rRNA methylase family protein [Streptococcus pneumoniae
           INV200]
 gi|302598630|gb|EFL65669.1| RNA methyltransferase, TrmH family protein [Streptococcus
           pneumoniae BS455]
 gi|302637313|gb|EFL67801.1| spoU rRNA methylase family protein [Streptococcus pneumoniae
           SP14-BS292]
 gi|302639996|gb|EFL70452.1| spoU rRNA methylase family protein [Streptococcus pneumoniae
           SP-BS293]
 gi|302641162|gb|EFL71536.1| spoU rRNA methylase family protein [Streptococcus pneumoniae BS458]
 gi|302642927|gb|EFL73226.1| spoU rRNA methylase family protein [Streptococcus pneumoniae BS457]
 gi|302646218|gb|EFL76445.1| spoU rRNA methylase family protein [Streptococcus pneumoniae BS397]
          Length = 242

 Score =  118 bits (296), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 80/247 (32%), Positives = 127/247 (51%), Gaps = 35/247 (14%)

Query: 48  NLFLYGVHTVSAAL-NNPSRKIF-------------QLLATKNALARLDWDANLPHPFPV 93
           N  +YGVH V+ AL  N   K++             + LAT+  ++ + W +        
Sbjct: 4   NDIVYGVHAVTEALLANTGNKLYLQEDLRGKNVEKVKELATEKKVS-ISWTSK------- 55

Query: 94  KTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAV------RNSQLLMVLDHVNDPHNI 147
           K++   T      + AVHQG  L  +      LD +        + LL++LD + DPHN+
Sbjct: 56  KSLSEMT------EGAVHQGFVLRVSEFAYSELDYILAKTRQEENPLLLILDGLTDPHNL 109

Query: 148 GAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGF 207
           G+ILR+A A +  G+I  K  +   + V+AK+A+GA+EH+P  R++NL+  L K+   GF
Sbjct: 110 GSILRTADATNVSGVIIPKHRTVGVTPVVAKTATGAIEHVPIARVTNLSQTLDKLKDEGF 169

Query: 208 QTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSN 267
            T G   +   P  +     KIALI+G EGKG+    ++    M  + M G +++LN S 
Sbjct: 170 WTFGTDMNG-TPCHKWNTKGKIALIIGNEGKGISSNIKKQVDEMITIPMNGHVQSLNASV 228

Query: 268 AAAVALY 274
           AAA+ +Y
Sbjct: 229 AAAILMY 235


>gi|182684414|ref|YP_001836161.1| spoU rRNA methylase family protein [Streptococcus pneumoniae
           CGSP14]
 gi|182629748|gb|ACB90696.1| spoU rRNA methylase family protein [Streptococcus pneumoniae
           CGSP14]
          Length = 253

 Score =  118 bits (296), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 80/247 (32%), Positives = 127/247 (51%), Gaps = 35/247 (14%)

Query: 48  NLFLYGVHTVSAAL-NNPSRKIF-------------QLLATKNALARLDWDANLPHPFPV 93
           N  +YGVH V+ AL  N   K++             + LAT+  ++ + W +        
Sbjct: 15  NDIVYGVHAVTEALLANTGNKLYLQEDLRGKNVEKVKELATEKKVS-ISWTSK------- 66

Query: 94  KTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAV------RNSQLLMVLDHVNDPHNI 147
           K++   T      + AVHQG  L  +      LD +        + LL++LD + DPHN+
Sbjct: 67  KSLSEMT------EGAVHQGFVLRVSEFAYSELDYILAKTRQEENPLLLILDGLTDPHNL 120

Query: 148 GAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGF 207
           G+ILR+A A +  G+I  K  +   + V+AK+A+GA+EH+P  R++NL+  L K+   GF
Sbjct: 121 GSILRTADATNVSGVIIPKHRTVGVTPVVAKTATGAIEHVPIARVTNLSQTLDKLKDEGF 180

Query: 208 QTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSN 267
            T G   +   P  +     KIALI+G EGKG+    ++    M  + M G +++LN S 
Sbjct: 181 WTFGTDMNG-TPCHKWNTKGKIALIIGNEGKGISSNIKKQVDEMITIPMNGHVQSLNASV 239

Query: 268 AAAVALY 274
           AAA+ +Y
Sbjct: 240 AAAILMY 246


>gi|119713240|gb|ABL97306.1| putative tRNA/rRNA methyltransferase [uncultured marine bacterium
           HF10_12C08]
          Length = 228

 Score =  118 bits (296), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 68/223 (30%), Positives = 123/223 (55%), Gaps = 8/223 (3%)

Query: 63  NPSRKIFQLLATKNALARLDWDANLPHPFPVKTV--PPQTIDKIVGKEAVHQGLALETAP 120
           N +R  +++  T  A  +L  +  L   + + T+    + ID ++   + HQG+ +    
Sbjct: 2   NKNRVKYEVYFTSEAERKLRSEVKL-ESYNIITIRKTREEIDLVLKGISNHQGICIRVEK 60

Query: 121 LLSPTL-DAVRN----SQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAV 175
           +  P L + ++N    + ++ +LD ++DP N+GAI RSA+AF  DGII T   S +E++ 
Sbjct: 61  IQPPHLTEFIKNLNKETSIIFLLDQLDDPQNVGAIFRSALAFDIDGIILTDHNSVAENSF 120

Query: 176 LAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGA 235
           LAK+AS A++ IP+ +I N++  ++ +   G+   GL  +++  +      +KI  ILG+
Sbjct: 121 LAKTASSAIDKIPFTKIKNISSCIKILKDQGYWIYGLDMEAQSSITDIAFPNKIVFILGS 180

Query: 236 EGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQN 278
           E KG+R  T         + M   +++LNVSNAAA+ ++   N
Sbjct: 181 ESKGMRRVTSSLCDENLKIKMSDNLESLNVSNAAAIMMFYISN 223


>gi|325479190|gb|EGC82287.1| RNA methyltransferase, TrmH family, group 3 [Anaerococcus prevotii
           ACS-065-V-Col13]
          Length = 234

 Score =  118 bits (295), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 58/192 (30%), Positives = 109/192 (56%), Gaps = 5/192 (2%)

Query: 91  FPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDHVNDPHNIGAI 150
             +  V  +  DKI   +  HQG+ +E        LD + + + L++LD + DPHN+GAI
Sbjct: 45  IEISFVDKRFFDKI---DINHQGVMIEVESFKYENLDDLSDEKRLIILDQIEDPHNLGAI 101

Query: 151 LRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTI 210
           +RSA +F  DG++  +R S S ++ + K+++GA+ +I   R+ NLT +++ +   GF   
Sbjct: 102 IRSAESFGFDGVVIPERRSASVTSTVYKTSAGAINNIKVYRVKNLTRSIKDLKDKGFWIY 161

Query: 211 GLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAA 270
           GL+ ++   +++     K+ L++G EG G+    ++    + ++ M G + +LN S AA 
Sbjct: 162 GLAGEADSSIDKADLTGKVGLVVGNEGSGISRLVRDNCDMLVNIPMLGRVNSLNASVAAG 221

Query: 271 VALY--ITQNHF 280
           +++Y  + QN F
Sbjct: 222 ISMYELLRQNGF 233


>gi|116516815|ref|YP_816752.1| TrmH family RNA methyltransferase group 3 [Streptococcus pneumoniae
           D39]
 gi|148992659|ref|ZP_01822327.1| pyridoxine biosynthesis protein [Streptococcus pneumoniae SP9-BS68]
 gi|148997484|ref|ZP_01825089.1| pyridoxine biosynthesis protein [Streptococcus pneumoniae
           SP11-BS70]
 gi|168483931|ref|ZP_02708883.1| RNA methyltransferase, TrmH family, group 3 [Streptococcus
           pneumoniae CDC1873-00]
 gi|168489618|ref|ZP_02713817.1| RNA methyltransferase, TrmH family, group 3 [Streptococcus
           pneumoniae SP195]
 gi|168575914|ref|ZP_02721829.1| RNA methyltransferase, TrmH family, group 3 [Streptococcus
           pneumoniae MLV-016]
 gi|169833851|ref|YP_001694873.1| RNA methyltransferase [Streptococcus pneumoniae Hungary19A-6]
 gi|116077391|gb|ABJ55111.1| TrmH family RNA methyltransferase group 3 [Streptococcus pneumoniae
           D39]
 gi|147756539|gb|EDK63580.1| pyridoxine biosynthesis protein [Streptococcus pneumoniae
           SP11-BS70]
 gi|147928676|gb|EDK79690.1| pyridoxine biosynthesis protein [Streptococcus pneumoniae SP9-BS68]
 gi|168996353|gb|ACA36965.1| RNA methyltransferase, TrmH family, group 3 [Streptococcus
           pneumoniae Hungary19A-6]
 gi|172042719|gb|EDT50765.1| RNA methyltransferase, TrmH family, group 3 [Streptococcus
           pneumoniae CDC1873-00]
 gi|183571884|gb|EDT92412.1| RNA methyltransferase, TrmH family, group 3 [Streptococcus
           pneumoniae SP195]
 gi|183578281|gb|EDT98809.1| RNA methyltransferase, TrmH family, group 3 [Streptococcus
           pneumoniae MLV-016]
 gi|332073764|gb|EGI84243.1| RNA 2'-O ribose methyltransferase substrate binding family protein
           [Streptococcus pneumoniae GA17570]
 gi|332200899|gb|EGJ14971.1| RNA 2'-O ribose methyltransferase substrate binding family protein
           [Streptococcus pneumoniae GA41317]
 gi|332201895|gb|EGJ15965.1| RNA 2'-O ribose methyltransferase substrate binding family protein
           [Streptococcus pneumoniae GA47368]
          Length = 242

 Score =  118 bits (295), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 80/247 (32%), Positives = 127/247 (51%), Gaps = 35/247 (14%)

Query: 48  NLFLYGVHTVSAAL-NNPSRKIF-------------QLLATKNALARLDWDANLPHPFPV 93
           N  +YGVH V+ AL  N   K++             + LAT+  ++ + W +        
Sbjct: 4   NDIVYGVHAVTEALLANTGNKLYLQEDLRGKNVEKVKELATEKKVS-ISWTSK------- 55

Query: 94  KTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAV------RNSQLLMVLDHVNDPHNI 147
           K++   T      + AVHQG  L  +      LD +        + LL++LD + DPHN+
Sbjct: 56  KSLSEMT------EGAVHQGFVLRVSEFAYSELDYILAKTRQEENPLLLILDGLTDPHNL 109

Query: 148 GAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGF 207
           G+ILR+A A +  G+I  K  +   + V+AK+A+GA+EH+P  R++NL+  L K+   GF
Sbjct: 110 GSILRTADATNVSGVIIPKHRAVGVTPVVAKTATGAIEHVPIARVTNLSQTLDKLKDEGF 169

Query: 208 QTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSN 267
            T G   +   P  +     KIALI+G EGKG+    ++    M  + M G +++LN S 
Sbjct: 170 WTFGTDMNG-TPCHKWNTKGKIALIIGNEGKGISSNIKKQVDEMITIPMNGHVQSLNASV 228

Query: 268 AAAVALY 274
           AAA+ +Y
Sbjct: 229 AAAILMY 235


>gi|293365120|ref|ZP_06611837.1| RNA methyltransferase [Streptococcus oralis ATCC 35037]
 gi|307702175|ref|ZP_07639135.1| spoU rRNA Methylase family protein [Streptococcus oralis ATCC
           35037]
 gi|291316570|gb|EFE57006.1| RNA methyltransferase [Streptococcus oralis ATCC 35037]
 gi|307624188|gb|EFO03165.1| spoU rRNA Methylase family protein [Streptococcus oralis ATCC
           35037]
          Length = 242

 Score =  118 bits (295), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 80/247 (32%), Positives = 128/247 (51%), Gaps = 35/247 (14%)

Query: 48  NLFLYGVHTVSAAL-NNPSRKIF-------------QLLATKNALARLDWDANLPHPFPV 93
           N  +YGVH V+ AL  N   K++             + LAT+  ++ + W +        
Sbjct: 4   NDIVYGVHAVTEALLANTGNKLYLQEDLRGKNVEKVKELATEKKVS-ISWTSK------- 55

Query: 94  KTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAV------RNSQLLMVLDHVNDPHNI 147
           K++   T      + AVHQG  L  +      LD +        + LL++LD + DPHN+
Sbjct: 56  KSLSEMT------EGAVHQGFVLRVSEFAYSELDHILAKTRQEENPLLLILDGLTDPHNL 109

Query: 148 GAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGF 207
           G+ILR+A A +  G+I  K  +   + V+AK+A+GA+EH+P  R++NL+  L K+ + GF
Sbjct: 110 GSILRTADATNVSGVIIPKHRAVGVTPVVAKTATGAIEHVPIARVTNLSQTLDKLKAEGF 169

Query: 208 QTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSN 267
            T G   +   P  +     KIALI+G EGKG+    ++    M  + M G +++LN S 
Sbjct: 170 WTFGTDMNG-TPCHKWNTKGKIALIIGNEGKGISSNIKKQVDEMITIPMNGHVQSLNASV 228

Query: 268 AAAVALY 274
           AAA+ +Y
Sbjct: 229 AAAILMY 235


>gi|306825520|ref|ZP_07458860.1| RNA methyltransferase [Streptococcus sp. oral taxon 071 str.
           73H25AP]
 gi|304432458|gb|EFM35434.1| RNA methyltransferase [Streptococcus sp. oral taxon 071 str.
           73H25AP]
          Length = 242

 Score =  118 bits (295), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 78/236 (33%), Positives = 125/236 (52%), Gaps = 13/236 (5%)

Query: 48  NLFLYGVHTVSAAL-NNPSRKIF--QLLATKNALARLDWDANLPHPFPVKTVPPQTIDKI 104
           N  +YGVH V+ AL  N   K++  + L  KN     +  A       +     +++ ++
Sbjct: 4   NDIVYGVHAVTEALLANTGNKLYLQEDLRGKNVEKVKELAAE--KKVSISWTSKKSLSEM 61

Query: 105 VGKEAVHQGLALETAPLLSPTLDAV------RNSQLLMVLDHVNDPHNIGAILRSAVAFS 158
             + AVHQG  L  +      LD +        + LL++LD + DPHN+G+ILR+A A +
Sbjct: 62  T-EGAVHQGFVLRVSEFAYSKLDHILAKTRQEENPLLLILDGLTDPHNLGSILRTADATN 120

Query: 159 CDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKK 218
             G+I  K  +   + V+AK+A+GA+EH+P  R++NL+  L K+   GF T G   +   
Sbjct: 121 VSGVIIPKHRAVGVTPVVAKTATGAIEHVPIARVTNLSQTLDKLKDEGFWTFGTDMNG-T 179

Query: 219 PLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
           P  +     KIALI+G EGKG+    ++    M  + M G +++LN S AAA+ +Y
Sbjct: 180 PCHKWNTKGKIALIIGNEGKGISSNIKKQVDEMITIPMNGHVQSLNASVAAAILMY 235


>gi|149011685|ref|ZP_01832881.1| TrmH family RNA methyltransferase group 3 [Streptococcus pneumoniae
           SP19-BS75]
 gi|147764116|gb|EDK71048.1| TrmH family RNA methyltransferase group 3 [Streptococcus pneumoniae
           SP19-BS75]
 gi|301794481|emb|CBW36920.1| SpoU rRNA methylase family protein [Streptococcus pneumoniae
           INV104]
 gi|332203287|gb|EGJ17355.1| RNA 2'-O ribose methyltransferase substrate binding family protein
           [Streptococcus pneumoniae GA47901]
          Length = 242

 Score =  118 bits (295), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 80/247 (32%), Positives = 127/247 (51%), Gaps = 35/247 (14%)

Query: 48  NLFLYGVHTVSAAL-NNPSRKIF-------------QLLATKNALARLDWDANLPHPFPV 93
           N  +YGVH V+ AL  N   K++             + LAT+  ++ + W +        
Sbjct: 4   NDIVYGVHAVTEALLANTGNKLYLQEDLRGKNVEKVKELATEKKVS-ISWTSK------- 55

Query: 94  KTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAV------RNSQLLMVLDHVNDPHNI 147
           K++   T      + AVHQG  L  +      LD +        + LL++LD + DPHN+
Sbjct: 56  KSLSEMT------EGAVHQGFVLRVSEFAYSELDYILAKTRQEENPLLLILDGLTDPHNL 109

Query: 148 GAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGF 207
           G+ILR+A A +  G+I  K  +   + V+AK+A+GA+EH+P  R++NL+  L K+   GF
Sbjct: 110 GSILRTADATNVSGVIIPKHRAVGVTPVVAKTATGAIEHVPIARVTNLSQTLDKLKDEGF 169

Query: 208 QTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSN 267
            T G   +   P  +     KIALI+G EGKG+    ++    M  + M G +++LN S 
Sbjct: 170 WTFGTDMNG-TPCHKWNTKGKIALIIGNEGKGISSNIKKQVDEMITIPMNGHVQSLNASV 228

Query: 268 AAAVALY 274
           AAA+ +Y
Sbjct: 229 AAAILMY 235


>gi|15903354|ref|NP_358904.1| tRNA (guanosine-2'-O-)-methyltransferase [Streptococcus pneumoniae
           R6]
 gi|307068107|ref|YP_003877073.1| hypothetical protein SPAP_1485 [Streptococcus pneumoniae AP200]
 gi|15458955|gb|AAL00115.1| tRNA (guanosine-2'-O-)-methyltransferase, TrmH family
           [Streptococcus pneumoniae R6]
 gi|306409644|gb|ADM85071.1| hypothetical protein SPAP_1485 [Streptococcus pneumoniae AP200]
          Length = 253

 Score =  118 bits (295), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 80/247 (32%), Positives = 127/247 (51%), Gaps = 35/247 (14%)

Query: 48  NLFLYGVHTVSAAL-NNPSRKIF-------------QLLATKNALARLDWDANLPHPFPV 93
           N  +YGVH V+ AL  N   K++             + LAT+  ++ + W +        
Sbjct: 15  NDIVYGVHAVTEALLANTGNKLYLQEDLRGKNVEKVKELATEKKVS-ISWTSK------- 66

Query: 94  KTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAV------RNSQLLMVLDHVNDPHNI 147
           K++   T      + AVHQG  L  +      LD +        + LL++LD + DPHN+
Sbjct: 67  KSLSEMT------EGAVHQGFVLRVSEFAYSELDYILAKTRQEENPLLLILDGLTDPHNL 120

Query: 148 GAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGF 207
           G+ILR+A A +  G+I  K  +   + V+AK+A+GA+EH+P  R++NL+  L K+   GF
Sbjct: 121 GSILRTADATNVSGVIIPKHRAVGVTPVVAKTATGAIEHVPIARVTNLSQTLDKLKDEGF 180

Query: 208 QTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSN 267
            T G   +   P  +     KIALI+G EGKG+    ++    M  + M G +++LN S 
Sbjct: 181 WTFGTDMNG-TPCHKWNTKGKIALIIGNEGKGISSNIKKQVDEMITIPMNGHVQSLNASV 239

Query: 268 AAAVALY 274
           AAA+ +Y
Sbjct: 240 AAAILMY 246


>gi|55820190|ref|YP_138632.1| tRNA/rRNA methyltransferase [Streptococcus thermophilus LMG 18311]
 gi|55822078|ref|YP_140519.1| tRNA/rRNA methyltransferase [Streptococcus thermophilus CNRZ1066]
 gi|116627048|ref|YP_819667.1| tRNA/rRNA methyltransferase [Streptococcus thermophilus LMD-9]
 gi|55736175|gb|AAV59817.1| tRNA/rRNA methyltransferase [Streptococcus thermophilus LMG 18311]
 gi|55738063|gb|AAV61704.1| tRNA/rRNA methyltransferase [Streptococcus thermophilus CNRZ1066]
 gi|116100325|gb|ABJ65471.1| rRNA methylase [Streptococcus thermophilus LMD-9]
 gi|312277511|gb|ADQ62168.1| RNA methyltransferase, TrmH family, group 3 [Streptococcus
           thermophilus ND03]
          Length = 247

 Score =  118 bits (295), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 80/234 (34%), Positives = 121/234 (51%), Gaps = 13/234 (5%)

Query: 50  FLYGVHTVSAALN-NPSRKIF--QLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVG 106
            +YGVH V+ +L  N   K++    L  KN  A     A       +   P +T+  + G
Sbjct: 11  IVYGVHAVTESLEANTGNKLYIQDDLRGKNVDAIKALAAE--KKVSISWTPKKTLSDMTG 68

Query: 107 KEAVHQGLALETAPL----LSPTLDAVRNSQ--LLMVLDHVNDPHNIGAILRSAVAFSCD 160
             AVHQG  L  +      LS  +D     +  L+++LD +NDPHN G+ILR+A A    
Sbjct: 69  G-AVHQGFVLRVSEFAYSDLSVIMDKAEQEENPLILILDGLNDPHNFGSILRTADATQVT 127

Query: 161 GIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPL 220
           G+I  K  +   + V+AK+++GA+EHIP  R++NL+  L K+   GF   G   D     
Sbjct: 128 GVIIPKHRAVGVTPVVAKTSTGAVEHIPIARVTNLSQTLDKLKEAGFWVFGTDMDGTASH 187

Query: 221 EQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
           +      K+ALI+G EGKG+    ++    M  + M G +++LN S AAAV +Y
Sbjct: 188 KWNTAG-KLALIIGNEGKGISANIKKQVDEMITIPMGGHVQSLNASVAAAVLMY 240


>gi|331266684|ref|YP_004326314.1| TrmH family RNA methyltransferase group 3 [Streptococcus oralis
           Uo5]
 gi|326683356|emb|CBZ00974.1| TrmH family RNA methyltransferase group 3 [Streptococcus oralis
           Uo5]
          Length = 260

 Score =  118 bits (295), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 80/247 (32%), Positives = 127/247 (51%), Gaps = 35/247 (14%)

Query: 48  NLFLYGVHTVSAAL-NNPSRKIF-------------QLLATKNALARLDWDANLPHPFPV 93
           N  +YGVH V+ AL  N   K++             + LAT+  ++ + W +        
Sbjct: 4   NDIVYGVHAVTEALLANTGNKLYLQEDLRGKNVEKVKELATEKKVS-ISWTSK------- 55

Query: 94  KTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAV------RNSQLLMVLDHVNDPHNI 147
           K++   T      + AVHQG  L  +      LD +        + LL++LD + DPHN+
Sbjct: 56  KSLSEMT------EGAVHQGFVLRVSEFAYSELDHILAKTRQEENPLLLILDGLTDPHNL 109

Query: 148 GAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGF 207
           G+ILR+A A +  G+I  K  +   + V+AK+A+GA+EH+P  R++NL+  L K+   GF
Sbjct: 110 GSILRTADATNVSGVIIPKHRAVGVTPVVAKTATGAIEHVPIARVTNLSQTLDKLKDEGF 169

Query: 208 QTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSN 267
            T G   +   P  +     KIALI+G EGKG+    ++    M  + M G +++LN S 
Sbjct: 170 WTFGTDMNG-TPCHKWNTKGKIALIIGNEGKGISSNIKKQVDEMITIPMNGHVQSLNASV 228

Query: 268 AAAVALY 274
           AAA+ +Y
Sbjct: 229 AAAILMY 235


>gi|251781697|ref|YP_002995999.1| 23S rRNA Gm2251 methyltransferase [Streptococcus dysgalactiae
           subsp. equisimilis GGS_124]
 gi|242390326|dbj|BAH80785.1| 23S rRNA Gm2251 methyltransferase [Streptococcus dysgalactiae
           subsp. equisimilis GGS_124]
          Length = 248

 Score =  118 bits (295), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 76/238 (31%), Positives = 133/238 (55%), Gaps = 17/238 (7%)

Query: 48  NLFLYGVHTVSAALN-NPSRKIF--QLLATKNA--LARLDWDANLPHPFPVKTVPPQTID 102
           N  +YGVH V+ +L+ N   K++  + L  KN   + RL  +  +     +   P +T+ 
Sbjct: 10  NDIVYGVHAVTESLHANTGNKLYIQEDLRGKNVDNIKRLATEKKVS----ISWTPKKTLS 65

Query: 103 KIVGKEAVHQGLALETAPLLSPTLDAV------RNSQLLMVLDHVNDPHNIGAILRSAVA 156
           ++  + AVHQG  L  +      LD +       ++ L+++LD + DPHN+G+ILR+A A
Sbjct: 66  EMT-EGAVHQGFVLRVSAFAYTELDVILEKAEQEDNPLILILDGLTDPHNLGSILRTADA 124

Query: 157 FSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDS 216
            +  G+I  K  +   + V++K+++GA+EH+P  R++NL+  L K+ + GF T G   + 
Sbjct: 125 TNVCGVIIPKHRAVGVTPVVSKTSTGAVEHVPIARVTNLSQTLDKLKAKGFWTYGTDMNG 184

Query: 217 KKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
             P  +   + K+ALI+G EGKG+    ++    M  + M G +++LN S AAA+ +Y
Sbjct: 185 -TPSHRWNTSGKLALIIGNEGKGISANIKKQVDEMITIPMNGHVQSLNASVAAAILMY 241


>gi|322374580|ref|ZP_08049094.1| RNA methyltransferase, TrmH family, group 3 [Streptococcus sp.
           C300]
 gi|321280080|gb|EFX57119.1| RNA methyltransferase, TrmH family, group 3 [Streptococcus sp.
           C300]
          Length = 253

 Score =  118 bits (295), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 80/247 (32%), Positives = 127/247 (51%), Gaps = 35/247 (14%)

Query: 48  NLFLYGVHTVSAAL-NNPSRKIF-------------QLLATKNALARLDWDANLPHPFPV 93
           N  +YGVH V+ AL  N   K++             + LAT+  ++ + W +        
Sbjct: 15  NDIVYGVHAVTEALLANTGNKLYLQEDLRGKNVEKVKELATEKKVS-ISWTSK------- 66

Query: 94  KTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAV------RNSQLLMVLDHVNDPHNI 147
           K++   T      + AVHQG  L  +      LD +        + LL++LD + DPHN+
Sbjct: 67  KSLSEMT------EGAVHQGFVLRVSEFAYSELDHILAKTRQEENPLLLILDGLTDPHNL 120

Query: 148 GAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGF 207
           G+ILR+A A +  G+I  K  +   + V+AK+A+GA+EH+P  R++NL+  L K+   GF
Sbjct: 121 GSILRTADATNVSGVIIPKHRAVGVTPVVAKTATGAIEHVPIARVTNLSQTLDKLKDQGF 180

Query: 208 QTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSN 267
            T G   +   P  +     KIALI+G EGKG+    ++    M  + M G +++LN S 
Sbjct: 181 WTFGTDMNG-TPCHKWNTKGKIALIIGNEGKGISSNIKKQVDEMITIPMNGHVQSLNASV 239

Query: 268 AAAVALY 274
           AAA+ +Y
Sbjct: 240 AAAILMY 246


>gi|88798926|ref|ZP_01114508.1| hypothetical protein MED297_12747 [Reinekea sp. MED297]
 gi|88778406|gb|EAR09599.1| hypothetical protein MED297_12747 [Reinekea sp. MED297]
          Length = 252

 Score =  118 bits (295), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 85/242 (35%), Positives = 129/242 (53%), Gaps = 14/242 (5%)

Query: 47  ENLFLYGVHTVSAALNNPSRKIFQLLATK---NALARLDWDANLPHPFPVKTVPPQTIDK 103
           E+L++YG+H V +AL+N   ++ ++L  K   +A  +   D         + V     D+
Sbjct: 3   ESLWIYGLHAVFSALDNHPERVKEVLLLKGRDDARMKKLLDQVTEVGVRYRLVSRDDFDR 62

Query: 104 IVGKEAV----HQG-LALETA-PLLSPT-----LDAVRNSQLLMVLDHVNDPHNIGAILR 152
            + K+ +    HQG LAL TA P+L        LD +    LL+VLD V DPHNIGA LR
Sbjct: 63  TLHKQQLKDIRHQGVLALTTAAPVLKENDLEALLDNLEEPPLLLVLDGVTDPHNIGACLR 122

Query: 153 SAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGL 212
           +  A    G+I  K  S + +A   K ASGA + +P+  ++NL   L+++   G    G 
Sbjct: 123 TCDAAGAHGLIVPKDKSATLTATAVKIASGATDTVPFFAVTNLARTLEELKQRGIWVYGT 182

Query: 213 SSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVA 272
           + ++   + Q      IAL++GAEGKGLR  T+E    + H+ M G + +LNVS AA V 
Sbjct: 183 AGEASSEIYQNRLQGPIALVMGAEGKGLRRLTREVCDELIHIPMAGDVSSLNVSVAAGVC 242

Query: 273 LY 274
           L+
Sbjct: 243 LF 244


>gi|289168211|ref|YP_003446480.1| tRNA (guanosine-2'-O-)-methyltransferase [Streptococcus mitis B6]
 gi|288907778|emb|CBJ22618.1| tRNA (guanosine-2'-O-)-methyltransferase [Streptococcus mitis B6]
          Length = 242

 Score =  118 bits (295), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 80/247 (32%), Positives = 127/247 (51%), Gaps = 35/247 (14%)

Query: 48  NLFLYGVHTVSAAL-NNPSRKIF-------------QLLATKNALARLDWDANLPHPFPV 93
           N  +YGVH V+ AL  N   K++             + LAT+  ++ + W +        
Sbjct: 4   NDIVYGVHAVTEALLANTGNKLYLQEDLRGKNVEKVKELATEKKVS-ISWTSK------- 55

Query: 94  KTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAV------RNSQLLMVLDHVNDPHNI 147
           K++   T      + AVHQG  L  +      LD +        + LL++LD + DPHN+
Sbjct: 56  KSLSEMT------EGAVHQGFVLRVSEFAYSELDHILEKTHQEENPLLLILDGLTDPHNL 109

Query: 148 GAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGF 207
           G+ILR+A A +  G+I  K  +   + V+AK+A+GA+EH+P  R++NL+  L K+   GF
Sbjct: 110 GSILRTADATNVSGVIIPKHRAVGVTPVVAKTATGAIEHVPIARVTNLSQTLDKLKDEGF 169

Query: 208 QTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSN 267
            T G   +   P  +     KIALI+G EGKG+    ++    M  + M G +++LN S 
Sbjct: 170 WTFGTDMNG-TPCHKWNTKGKIALIIGNEGKGISSNIKKQVDEMITIPMNGHVQSLNASV 228

Query: 268 AAAVALY 274
           AAA+ +Y
Sbjct: 229 AAAILMY 235


>gi|227489408|ref|ZP_03919724.1| tRNA/rRNA methyltransferase [Corynebacterium glucuronolyticum ATCC
           51867]
 gi|227541002|ref|ZP_03971051.1| tRNA/rRNA methyltransferase [Corynebacterium glucuronolyticum ATCC
           51866]
 gi|227090586|gb|EEI25898.1| tRNA/rRNA methyltransferase [Corynebacterium glucuronolyticum ATCC
           51867]
 gi|227183262|gb|EEI64234.1| tRNA/rRNA methyltransferase [Corynebacterium glucuronolyticum ATCC
           51866]
          Length = 302

 Score =  118 bits (295), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 66/213 (30%), Positives = 117/213 (54%), Gaps = 5/213 (2%)

Query: 64  PSRKIFQLLATKNALARLDWDANLP--HPFPVKTVPPQTIDKIVGKEAVHQGLALETAPL 121
           P+  +F  + TKN   RL    N+      P+  V  Q +D++ G   +HQG+ L+    
Sbjct: 73  PAVAMFVAIGTKND-QRLVEAVNIAASRSIPIVEVSKQKLDEMTGN-GLHQGIGLQIPEY 130

Query: 122 LSPTL-DAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSA 180
               L D + +  +++ LD++ DP N+GA++RS  AF  DG++  +R S S +AV  +S+
Sbjct: 131 HYADLEDLITHDGMVVFLDNITDPRNLGAVIRSVAAFGADGVVIPERRSASVTAVTWRSS 190

Query: 181 SGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGL 240
           +G    +P  +++N+T AL++    G+Q IGL +  +   +       + +++G+EGKGL
Sbjct: 191 AGTAARVPVAKVTNMTRALKQFQEAGYQAIGLDAGGEHTHDSYDGTGPVVIVVGSEGKGL 250

Query: 241 RPKTQETATSMAHLHMPGIIKALNVSNAAAVAL 273
               +ET  ++  + M G +++LN S AA V L
Sbjct: 251 SRLVKETCDTIVTIPMEGWVESLNASVAAGVVL 283


>gi|167582034|ref|ZP_02374908.1| RNA methyltransferase, TrmH family, group 3 [Burkholderia
           thailandensis TXDOH]
          Length = 247

 Score =  118 bits (295), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 67/169 (39%), Positives = 98/169 (57%), Gaps = 5/169 (2%)

Query: 111 HQGLA--LETAPL---LSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITT 165
           HQG+   +E  PL   L+  LD +    LL+VLD V DPHN+GA LR A A     II  
Sbjct: 69  HQGVVARVEDLPLAQNLAELLDGIAGPALLLVLDGVTDPHNLGACLRVADAAGAHAIIAP 128

Query: 166 KRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIK 225
           +  +   +A  AK ASGA + +PYI ++NL  AL+++   G   IG S D+   L     
Sbjct: 129 RDRAAGLNATAAKVASGAADTVPYITVTNLARALRELKDAGVWVIGTSDDATASLYDTKL 188

Query: 226 NDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
           +  +AL++GAEG+G+R  T++T   +  + M G +++LNVS A+ V LY
Sbjct: 189 DGPVALVMGAEGEGMRRLTRDTCDEVMFIPMAGSVESLNVSVASGVCLY 237


>gi|322392209|ref|ZP_08065670.1| 23S rRNA (guanosine-2'-O-)-methyltransferase RlmB [Streptococcus
           peroris ATCC 700780]
 gi|321144744|gb|EFX40144.1| 23S rRNA (guanosine-2'-O-)-methyltransferase RlmB [Streptococcus
           peroris ATCC 700780]
          Length = 242

 Score =  117 bits (294), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 79/238 (33%), Positives = 123/238 (51%), Gaps = 17/238 (7%)

Query: 48  NLFLYGVHTVSAAL-NNPSRKIF--QLLATKNA--LARLDWDANLPHPFPVKTVPPQTID 102
           N  +YGVH V+ AL  N   K++    L  KN   +  L  +  +   +  K    +  D
Sbjct: 4   NDIVYGVHAVTEALLANTGNKLYLQDDLRGKNVEKVKELATEKKVSISWTSKKSLSEMTD 63

Query: 103 KIVGKEAVHQGLALETAPLLSPTLDAV------RNSQLLMVLDHVNDPHNIGAILRSAVA 156
                 AVHQG  L  +      LD +        + LL++LD + DPHN+G+ILR+A A
Sbjct: 64  G-----AVHQGFVLRVSEFAYSELDQILAKTRQEENPLLLILDGLTDPHNLGSILRTADA 118

Query: 157 FSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDS 216
            +  G+I  K  S   + V+AK+A+GA+EH+P  R++NL+  L K+   GF   G   + 
Sbjct: 119 TNVSGVIIPKHRSVGVTPVVAKTATGAIEHVPIARVTNLSQTLDKLKDEGFWIFGTDMNG 178

Query: 217 KKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
             P  +   + KIALI+G EG+G+    ++    M  + M G +++LN S AAA+ +Y
Sbjct: 179 -TPCHKWNTSGKIALIIGNEGRGISSNIKKQVDEMITIPMDGHVQSLNASVAAAILMY 235


>gi|170698709|ref|ZP_02889775.1| RNA methyltransferase, TrmH family, group 3 [Burkholderia ambifaria
           IOP40-10]
 gi|171317519|ref|ZP_02906709.1| RNA methyltransferase, TrmH family, group 3 [Burkholderia ambifaria
           MEX-5]
 gi|170136413|gb|EDT04675.1| RNA methyltransferase, TrmH family, group 3 [Burkholderia ambifaria
           IOP40-10]
 gi|171097348|gb|EDT42193.1| RNA methyltransferase, TrmH family, group 3 [Burkholderia ambifaria
           MEX-5]
          Length = 247

 Score =  117 bits (294), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 78/234 (33%), Positives = 121/234 (51%), Gaps = 11/234 (4%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKI----V 105
            LYG H V+A L + +  + ++L  +    R   D    H      V     D+     +
Sbjct: 6   VLYGFHAVTARLRHDASTVAEVLYDQTRRDRRMQD--FLHAAKEAGVRLIAADETRLWGL 63

Query: 106 GKEAVHQGLA--LETAPL---LSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCD 160
                HQG+   +E  PL   LS  LD ++   LL+VLD V DPHN+GA LR A +    
Sbjct: 64  AHTERHQGVVARVEDVPLAQNLSELLDGIQGPALLLVLDGVTDPHNLGACLRVADSAGAH 123

Query: 161 GIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPL 220
            +I  +  +   +A  AK ASGA + +PYI ++NL  AL+++   G   IG S D+   L
Sbjct: 124 AVIAPRDRAVGLNATAAKVASGAADTVPYITVTNLARALRELKEAGVWVIGTSDDASATL 183

Query: 221 EQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
                +  +A+++GAEG+G+R  T++T   +  + M G +++LNVS A+ V LY
Sbjct: 184 YDTKLDGPVAIVMGAEGEGMRRLTRDTCDDVMSIPMAGSVESLNVSVASGVCLY 237


>gi|95930701|ref|ZP_01313434.1| RNA methyltransferase TrmH, group 3 [Desulfuromonas acetoxidans DSM
           684]
 gi|95133181|gb|EAT14847.1| RNA methyltransferase TrmH, group 3 [Desulfuromonas acetoxidans DSM
           684]
          Length = 244

 Score =  117 bits (294), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 72/240 (30%), Positives = 128/240 (53%), Gaps = 12/240 (5%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLATKNALARLD---WDANLPHPFPVKTVPPQTIDKIVG 106
           +L+G++ V  AL    RK+  L        RL+     A   H   VK    + +DK+VG
Sbjct: 4   YLFGLNAVFEALGQ-GRKVVALYVEAQRNPRLEEIVAQATERH-VAVKQCERRQLDKMVG 61

Query: 107 KEAVHQGL-----ALETAPLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDG 161
            +  HQG+     A +   L      + ++ +  ++LD + DPHN GA++RSA A  C G
Sbjct: 62  -DVRHQGVVAQVKAQDFVSLAQLLAQSSQSERFFLILDGITDPHNFGALIRSAAAAGCQG 120

Query: 162 IITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLE 221
           +I  K  S   + ++ K+A+G L ++   +++NL  A++++   G    GL+ +  + L 
Sbjct: 121 VIFAKDRSCPVTGIVEKTAAGTLGYVQLCQVTNLGRAIEELKKAGVWVYGLAGEEGQSLF 180

Query: 222 QEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY-ITQNHF 280
           +   +  IAL+ G+EG+G+RP  ++    +  + MPG +++LNVS A  +AL+ + +NH 
Sbjct: 181 EAPLSAPIALVAGSEGRGIRPLIRKLCDGLIAIPMPGRVESLNVSVATGIALFEVVRNHL 240


>gi|315612889|ref|ZP_07887800.1| RNA methyltransferase [Streptococcus sanguinis ATCC 49296]
 gi|315314999|gb|EFU63040.1| RNA methyltransferase [Streptococcus sanguinis ATCC 49296]
          Length = 242

 Score =  117 bits (294), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 79/238 (33%), Positives = 124/238 (52%), Gaps = 17/238 (7%)

Query: 48  NLFLYGVHTVSAAL-NNPSRKIF--QLLATKNA--LARLDWDANLPHPFPVKTVPPQTID 102
           N  +YGVH V+ AL  N   K++  + L  KN   +  L  +  +   +  K    +  +
Sbjct: 4   NDIVYGVHAVTEALLANTGNKLYLQEDLRGKNVEKVKELATEKRVSISWTSKKSLSEMTE 63

Query: 103 KIVGKEAVHQGLALETAPLLSPTLDAV------RNSQLLMVLDHVNDPHNIGAILRSAVA 156
                 AVHQG  L  +      LD +        + LL++LD + DPHN+G+ILR+A A
Sbjct: 64  G-----AVHQGFVLRVSEFAYSELDHILAKTRQEENPLLLILDGLTDPHNLGSILRTADA 118

Query: 157 FSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDS 216
            +  G+I  K  +   + V+AK+A+GA+EH+P  R++NL+  L K+   GF T G   + 
Sbjct: 119 TNVSGVIIPKHRAVGVTPVVAKTATGAIEHVPIARVTNLSQTLDKLKDEGFWTFGTDMNG 178

Query: 217 KKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
             P  +     KIALI+G EGKG+    ++    M  + M G +++LN S AAA+ +Y
Sbjct: 179 -TPCHKWNTKGKIALIIGNEGKGISSNIKKQVDEMITIPMNGHVQSLNASVAAAILMY 235


>gi|312796222|ref|YP_004029144.1| 23S rRNA Gm2251 methyltransferase [Burkholderia rhizoxinica HKI
           454]
 gi|312167997|emb|CBW75000.1| 23S rRNA Gm2251 methyltransferase (EC 2.1.1.-) [Burkholderia
           rhizoxinica HKI 454]
          Length = 253

 Score =  117 bits (294), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 78/233 (33%), Positives = 121/233 (51%), Gaps = 9/233 (3%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLL--ATKNALARLDW-DANLPHPFPVKTVPPQTIDKIVG 106
            LYG H V+A L + S  I ++L  AT+      D+  A       +       +  + G
Sbjct: 11  VLYGFHAVTARLRHDSSSIEEVLYDATRRDRRMQDFLQAAQSSGVRLIAADDARLHGLAG 70

Query: 107 KEAVHQGLALETAPL-----LSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDG 161
               HQG+      L     L+  LDA+    LL+VLD V DPHN+GA LR A A     
Sbjct: 71  THR-HQGVVARATDLPLAQNLAELLDALPGPALLLVLDGVTDPHNLGACLRVADAAGAHA 129

Query: 162 IITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLE 221
           +I  +  +   ++  AK ASGA E +PYI ++NL   L+++   G   IG + D+++ L 
Sbjct: 130 VIAPRDRAVGLNSTAAKVASGAAETVPYITVTNLARTLRELKDAGVWVIGTAGDAQRSLY 189

Query: 222 QEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
               +  +AL++GAEG+G+R  T+ET   + H+ M G + +LNVS A+ + L+
Sbjct: 190 DIALDGPVALVMGAEGEGMRRLTRETCDDLMHIPMMGSVGSLNVSVASGICLF 242


>gi|28198726|ref|NP_779040.1| tRNA/rRNA methyltransferase [Xylella fastidiosa Temecula1]
 gi|71897946|ref|ZP_00680151.1| RNA methyltransferase TrmH, group 3 [Xylella fastidiosa Ann-1]
 gi|182681419|ref|YP_001829579.1| RNA methyltransferase [Xylella fastidiosa M23]
 gi|52783310|sp|Q87D65|RLMB_XYLFT RecName: Full=23S rRNA (guanosine-2'-O-)-methyltransferase RlmB;
           AltName: Full=23S rRNA Gm2251 2'-O-methyltransferase
 gi|28056817|gb|AAO28689.1| tRNA/rRNA methyltransferase [Xylella fastidiosa Temecula1]
 gi|71732190|gb|EAO34245.1| RNA methyltransferase TrmH, group 3 [Xylella fastidiosa Ann-1]
 gi|182631529|gb|ACB92305.1| RNA methyltransferase, TrmH family, group 3 [Xylella fastidiosa
           M23]
 gi|307579865|gb|ADN63834.1| RNA methyltransferase [Xylella fastidiosa subsp. fastidiosa GB514]
          Length = 249

 Score =  117 bits (294), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 80/239 (33%), Positives = 126/239 (52%), Gaps = 13/239 (5%)

Query: 47  ENLFLYGVHTVSAALNNPSRKIFQLL---ATKNALARLDWDANLPHP-FPVKTVPPQTID 102
           +N ++ G++ V +++ N +  + ++L   A+KN+   LD + N       V+ V  Q +D
Sbjct: 4   KNQWIVGINAVVSSIENDAEHVREVLVEAASKNSRL-LDIEENARRKGIEVRRVTTQALD 62

Query: 103 KIVGKEAVHQGLALETAPL-------LSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAV 155
             VG    HQG+A   A +       L   +DA     LL+VLD V DPHN+GA LRSA 
Sbjct: 63  G-VGGGVRHQGVAARYAAVRLWEEHDLKDLVDAAGGQALLLVLDGVQDPHNLGACLRSAA 121

Query: 156 AFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSD 215
           A     +I  K  S   +A + K++SGA + +P I + NL  +L+++        GL+ +
Sbjct: 122 AAGVTAVIIPKDKSVGINATVRKTSSGAADRLPVIAVVNLARSLRELQKQDVWIYGLAGE 181

Query: 216 SKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
            +  L        +AL+LG E  GLR  T+E    +A + MPG +++LNVS AA V L+
Sbjct: 182 VETSLYALDLRGNVALVLGGEADGLRRLTREHCDVLARIPMPGEVESLNVSVAAGVTLF 240


>gi|71275861|ref|ZP_00652145.1| RNA methyltransferase TrmH, group 3 [Xylella fastidiosa Dixon]
 gi|71899357|ref|ZP_00681517.1| RNA methyltransferase TrmH, group 3 [Xylella fastidiosa Ann-1]
 gi|71163439|gb|EAO13157.1| RNA methyltransferase TrmH, group 3 [Xylella fastidiosa Dixon]
 gi|71730871|gb|EAO32942.1| RNA methyltransferase TrmH, group 3 [Xylella fastidiosa Ann-1]
          Length = 249

 Score =  117 bits (294), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 80/239 (33%), Positives = 126/239 (52%), Gaps = 13/239 (5%)

Query: 47  ENLFLYGVHTVSAALNNPSRKIFQLL---ATKNALARLDWDANLPHP-FPVKTVPPQTID 102
           +N ++ G++ V +++ N +  + ++L   A+KN+   LD + N       V+ V  Q +D
Sbjct: 4   KNQWIVGINAVVSSIENDAEHVREVLLEAASKNSRL-LDIEENARRKGIEVRRVTTQALD 62

Query: 103 KIVGKEAVHQGLALETAPL-------LSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAV 155
             VG    HQG+A   A +       L   +DA     LL+VLD V DPHN+GA LRSA 
Sbjct: 63  G-VGGGVRHQGVAARYAAVRLWEEHDLKDLVDAAGGQALLLVLDGVQDPHNLGACLRSAA 121

Query: 156 AFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSD 215
           A     +I  K  S   +A + K++SGA + +P I + NL  +L+++        GL+ +
Sbjct: 122 AAGVTAVIIPKDKSVGINATVRKTSSGAADRLPVIAVVNLARSLRELQKQDVWIYGLAGE 181

Query: 216 SKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
            +  L        +AL+LG E  GLR  T+E    +A + MPG +++LNVS AA V L+
Sbjct: 182 VETSLYALDLRGNVALVLGGEADGLRRLTREHCDVLARIPMPGEVESLNVSVAAGVTLF 240


>gi|269121680|ref|YP_003309857.1| RNA methyltransferase, TrmH family, group 3 [Sebaldella termitidis
           ATCC 33386]
 gi|268615558|gb|ACZ09926.1| RNA methyltransferase, TrmH family, group 3 [Sebaldella termitidis
           ATCC 33386]
          Length = 234

 Score =  117 bits (294), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 59/158 (37%), Positives = 94/158 (59%), Gaps = 2/158 (1%)

Query: 116 LETAPLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAV 175
           LE    L   L   R+  +++VLD + DP N GAI+RSA  F  DGII   R S S +  
Sbjct: 72  LELNEFLEKVLAKQRS--IVLVLDQIQDPRNFGAIIRSAECFGVDGIIIQDRNSVSVTET 129

Query: 176 LAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGA 235
           + KS++GA+EH+  I+++N++D++ K+  +G+   G  +D +     E   +K+ L+LG+
Sbjct: 130 VVKSSTGAIEHVDIIKVTNVSDSMDKLKKYGYFIYGAEADGETEYYNEPFPEKLCLVLGS 189

Query: 236 EGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVAL 273
           EGKG+R K +E    + ++ M G I +LNVS A  + L
Sbjct: 190 EGKGMRKKVKEHCDKILNIPMHGKINSLNVSVANGILL 227


>gi|171058586|ref|YP_001790935.1| RNA methyltransferase [Leptothrix cholodnii SP-6]
 gi|170776031|gb|ACB34170.1| RNA methyltransferase, TrmH family, group 3 [Leptothrix cholodnii
           SP-6]
          Length = 244

 Score =  117 bits (294), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 70/184 (38%), Positives = 105/184 (57%), Gaps = 8/184 (4%)

Query: 99  QTIDKIVGKEA---VHQGLALET---APL--LSPTLDAVRNSQLLMVLDHVNDPHNIGAI 150
           +T DK +G+ A    HQG+       AP+  L   LDAV    L++VLD V DPHN+GA 
Sbjct: 54  ETDDKRLGQMAGNTRHQGVVARVNVLAPIHSLDDLLDAVEGPPLVLVLDGVTDPHNLGAC 113

Query: 151 LRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTI 210
           LR A       +I  K ++   +A +AK ASGA E +PY  ++NL   L ++     + I
Sbjct: 114 LRVADGAGAHAVIAPKDHAVGVNATVAKVASGAAETVPYFMVTNLARTLNELKERDIRVI 173

Query: 211 GLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAA 270
           G S D+ + +     +  +A++LGAEG G+R  T++T   + H+ M G +++LNVS A+A
Sbjct: 174 GTSEDATQSIYDIDLSGPVAIVLGAEGPGMRQLTRKTCDELVHIPMRGAVESLNVSVASA 233

Query: 271 VALY 274
           V LY
Sbjct: 234 VCLY 237


>gi|167562889|ref|ZP_02355805.1| RNA methyltransferase, TrmH family, group 3 [Burkholderia
           oklahomensis EO147]
 gi|167570076|ref|ZP_02362950.1| RNA methyltransferase, TrmH family, group 3 [Burkholderia
           oklahomensis C6786]
          Length = 247

 Score =  117 bits (294), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 67/169 (39%), Positives = 98/169 (57%), Gaps = 5/169 (2%)

Query: 111 HQGLA--LETAPL---LSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITT 165
           HQG+   +E  PL   L+  LD +    LL+VLD V DPHN+GA LR A A     II  
Sbjct: 69  HQGVVARVEDLPLAQNLAELLDGISGPALLLVLDGVTDPHNLGACLRVADAAGAHAIIAP 128

Query: 166 KRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIK 225
           +  +   +A  AK ASGA + +PYI ++NL  AL+++   G   IG S D+   L     
Sbjct: 129 RDRAAGLNATAAKVASGAADTVPYITVTNLARALRELKDAGVWVIGTSDDATASLYDTKL 188

Query: 226 NDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
           +  +AL++GAEG+G+R  T++T   +  + M G +++LNVS A+ V LY
Sbjct: 189 DGPVALVMGAEGEGMRRLTRDTCDEVMFIPMVGSVESLNVSVASGVCLY 237


>gi|239997218|ref|ZP_04717742.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Alteromonas macleodii
           ATCC 27126]
          Length = 246

 Score =  117 bits (294), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 78/235 (33%), Positives = 117/235 (49%), Gaps = 12/235 (5%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLATKNA-LARLDWDANLPHPFPVKTVPPQT---IDKIV 105
           +LYG+H + + L     ++ ++L  K     RL    N    F +     Q     DK+ 
Sbjct: 6   WLYGLHAMQSVLEKEPERVMEVLVLKGRNDERLTNIVNQARRFGISVQFCQRKALDDKVS 65

Query: 106 GKEAVHQGLALETAP---LLSPTLDAVRNSQ---LLMVLDHVNDPHNIGAILRSAVAFSC 159
           G++  HQG+     P   L    LD +  S+   L++VLD V DPHN+GA LR+A     
Sbjct: 66  GEQ--HQGVVARAKPARVLDEADLDKILESEAQPLILVLDGVTDPHNLGACLRTADGAGV 123

Query: 160 DGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKP 219
             ++  K  S S +  + K A GA E +P I+I+NL   L+ +   G   +G + ++ K 
Sbjct: 124 HAVVVPKDKSASLNGTVRKVACGAAEVVPLIQITNLARTLKHLQDKGLWIVGTAGETDKT 183

Query: 220 LEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
           L         AL++GAEGKG+R  T+ET   +  L M G + +LNVS A  V LY
Sbjct: 184 LYDVDLKGPTALVMGAEGKGMRRLTKETCDELVKLPMAGSVTSLNVSVATGVCLY 238


>gi|330807239|ref|YP_004351701.1| 23S rRNA (guanosine-2-o-)-methyltransferase [Pseudomonas
           brassicacearum subsp. brassicacearum NFM421]
 gi|327375347|gb|AEA66697.1| Putative 23S rRNA (guanosine-2-o-)-methyltransferase [Pseudomonas
           brassicacearum subsp. brassicacearum NFM421]
          Length = 252

 Score =  117 bits (294), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 79/233 (33%), Positives = 121/233 (51%), Gaps = 10/233 (4%)

Query: 51  LYGVHTVSAALNNPSRKIFQL-LATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEA 109
           +YGVH V A L +  +++ Q+ LA   +  R+     L     V     +  +  V  E 
Sbjct: 6   IYGVHAVEALLRHHPKRVKQVWLAEGRSEPRVQALVELATQNKVAIGQAERREMDVWVEG 65

Query: 110 VHQGLALETAP-------LLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGI 162
           VHQG+  + +P       +L   LD    + LL+VLD V DPHN+GA LRSA A     +
Sbjct: 66  VHQGVVADVSPSQVWGEAMLDELLDRTEGAPLLLVLDGVTDPHNLGACLRSADAAGALAV 125

Query: 163 ITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPL-E 221
           I  K  S + +  + K A GA E IP + ++NL   L+K+   G   +G + +++  + +
Sbjct: 126 IVPKDKSATLTPAVRKVACGAAEVIPLVAVTNLARTLEKLQQRGLWVVGTAGEAEVSIYD 185

Query: 222 QEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
           Q++    I LI+GAEGKG+R  T+E    +  L M G + +LNVS A  V L+
Sbjct: 186 QDLTGPTI-LIMGAEGKGMRRLTREHCDYLVKLPMAGSVSSLNVSVATGVCLF 237


>gi|115351501|ref|YP_773340.1| RNA methyltransferase [Burkholderia ambifaria AMMD]
 gi|172060520|ref|YP_001808172.1| RNA methyltransferase [Burkholderia ambifaria MC40-6]
 gi|115281489|gb|ABI87006.1| 23S rRNA Gm-2251 2'-O-methyltransferase [Burkholderia ambifaria
           AMMD]
 gi|171993037|gb|ACB63956.1| RNA methyltransferase, TrmH family, group 3 [Burkholderia ambifaria
           MC40-6]
          Length = 247

 Score =  117 bits (293), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 78/234 (33%), Positives = 121/234 (51%), Gaps = 11/234 (4%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKI----V 105
            LYG H V+A L + +  + ++L  +    R   D    H      V     D+     +
Sbjct: 6   VLYGFHAVTARLRHDASTVAEVLYDQTRRDRRMQD--FLHTAKEAGVRLIAADETRLWGL 63

Query: 106 GKEAVHQGLA--LETAPL---LSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCD 160
                HQG+   +E  PL   LS  LD ++   LL+VLD V DPHN+GA LR A +    
Sbjct: 64  AHTERHQGVVARVEDVPLAQNLSELLDGIQGPALLLVLDGVTDPHNLGACLRVADSAGAH 123

Query: 161 GIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPL 220
            +I  +  +   +A  AK ASGA + +PYI ++NL  AL+++   G   IG S D+   L
Sbjct: 124 AVIAPRDRAVGLNATAAKVASGAADTVPYITVTNLARALRELKEAGVWIIGTSDDASATL 183

Query: 221 EQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
                +  +A+++GAEG+G+R  T++T   +  + M G +++LNVS A+ V LY
Sbjct: 184 YDTKLDGPVAIVMGAEGEGMRRLTRDTCDDVMSIPMAGSVESLNVSVASGVCLY 237


>gi|237747635|ref|ZP_04578115.1| RNA methyltransferase [Oxalobacter formigenes OXCC13]
 gi|229378997|gb|EEO29088.1| RNA methyltransferase [Oxalobacter formigenes OXCC13]
          Length = 249

 Score =  117 bits (293), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 70/236 (29%), Positives = 124/236 (52%), Gaps = 9/236 (3%)

Query: 47  ENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDA-NLPHPFPVKTVPPQT--IDK 103
           +N  ++G H V++ L + +  + +L        R   D   +     V+ +      +DK
Sbjct: 2   KNKVIFGFHAVTSRLRHEASSVEELYVDAERSDRRMQDLLKVAKAAGVRIIQADGARLDK 61

Query: 104 IVGKEAVHQGLALETAPL-----LSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFS 158
           +VG    HQG+    AP+     L   LDA+  + LL+VLD + DPHN+GA LR A +  
Sbjct: 62  MVGTRR-HQGVVAMAAPVSLARNLDELLDAIEGAPLLLVLDGITDPHNLGACLRVADSVG 120

Query: 159 CDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKK 218
              +I  K  +   +A + K ASGA E +PYI ++NL   L+++       +G + D+++
Sbjct: 121 AHAVIAPKDRAVGINATVQKVASGAAETVPYITVTNLARTLRQLQERDIWVVGTTDDAEE 180

Query: 219 PLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
            L +   +  +A ++G+EG+G+R  T+E    +  + M G +++LN+S A+ + LY
Sbjct: 181 SLYEPDYSGGVAFVMGSEGEGIRRLTRENCDQLVAIPMFGSVESLNISVASGICLY 236


>gi|322390887|ref|ZP_08064395.1| 23S rRNA (guanosine-2'-O-)-methyltransferase RlmB [Streptococcus
           parasanguinis ATCC 903]
 gi|321142400|gb|EFX37870.1| 23S rRNA (guanosine-2'-O-)-methyltransferase RlmB [Streptococcus
           parasanguinis ATCC 903]
          Length = 242

 Score =  117 bits (293), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 81/241 (33%), Positives = 126/241 (52%), Gaps = 23/241 (9%)

Query: 48  NLFLYGVHTVSAALN-NPSRKIF--QLLATKN-----ALARLDWDANLPHPFPVKTVPPQ 99
           N  +YGVH V+ AL  N   K++  + L  KN     ALA             +   P +
Sbjct: 4   NDIVYGVHAVTEALQANTGNKLYIQEDLRGKNVDKIKALAA-------EKKVSISWTPKK 56

Query: 100 TIDKIVGKEAVHQGLALETAPLLSPTLDAV------RNSQLLMVLDHVNDPHNIGAILRS 153
           T+ ++  + AVHQG  L  A      L A+        + LL++LD + DPHN+G+ILR+
Sbjct: 57  TLQEMT-EGAVHQGFVLRVAAFAYTDLAAILKQTAQEENPLLLILDGLTDPHNLGSILRT 115

Query: 154 AVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLS 213
           A A +  G+I  K  +   + V++K+++GA+EHIP  R++NL+  L K+   GF   G  
Sbjct: 116 ADATNVSGVIIPKHRAVGVTPVVSKTSTGAVEHIPIARVTNLSQTLDKLKEEGFWIFGTD 175

Query: 214 SDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVAL 273
            +   P  Q     K+ALI+G EGKG+    ++    M  + M G +++LN S AAA+ +
Sbjct: 176 MNG-TPSHQWNTAGKLALIIGNEGKGISANIKKQVDEMITIPMNGHVQSLNASVAAAILM 234

Query: 274 Y 274
           Y
Sbjct: 235 Y 235


>gi|270158538|ref|ZP_06187195.1| TrmH family RNA methyltransferase [Legionella longbeachae D-4968]
 gi|289166630|ref|YP_003456768.1| enzyme [Legionella longbeachae NSW150]
 gi|269990563|gb|EEZ96817.1| TrmH family RNA methyltransferase [Legionella longbeachae D-4968]
 gi|288859803|emb|CBJ13784.1| putative enzyme [Legionella longbeachae NSW150]
          Length = 250

 Score =  117 bits (293), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 79/240 (32%), Positives = 123/240 (51%), Gaps = 21/240 (8%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQ-TIDKIVG-- 106
           ++YG+H VSA L NP R       TK     LD + N       K +     I+K+    
Sbjct: 5   YVYGLHAVSALLANPHRM------TKKLYVSLDREDNRLQEIIDKAMQANINIEKVSMHK 58

Query: 107 -----KEAVHQGLALETAPL-------LSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSA 154
                 +  HQG+    + L       L   L++ ++  L+++LD + DPHN+GA LR+A
Sbjct: 59  MNQRFADFTHQGVVACASSLPEYNESHLLALLESSKHPALILILDGITDPHNLGACLRTA 118

Query: 155 VAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSS 214
            A   D ++  K  S S + V++K A GA E +P +R++NL  +++ +   G    G + 
Sbjct: 119 DATGVDFVMIPKDKSASITPVVSKVACGAAESVPLVRVTNLVRSIKLLKEHGVWVYGAAG 178

Query: 215 DSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
           ++   L Q      IA++LGAEG+GLR  T+E   S+  L M G + +LNVS A  V+LY
Sbjct: 179 EATGTLYQTDCTSAIAIVLGAEGEGLRRLTRENCDSLFSLPMLGSVDSLNVSVATGVSLY 238


>gi|167589923|ref|ZP_02382311.1| RNA methyltransferase TrmH, group 3 [Burkholderia ubonensis Bu]
          Length = 247

 Score =  117 bits (293), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 79/234 (33%), Positives = 121/234 (51%), Gaps = 11/234 (4%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKI----V 105
            LYG H V+A L + +  + ++L  +    R   D    H      V     D+     +
Sbjct: 6   VLYGFHAVTARLRHDASTVAEVLYDQTRRDRRMQD--FLHAAKEAGVRLIAADETRLWGL 63

Query: 106 GKEAVHQGLA--LETAPL---LSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCD 160
                HQG+   +E  PL   LS  LD ++   LL+VLD V DPHN+GA LR A A    
Sbjct: 64  AHTERHQGVVARVEDIPLAQNLSELLDGIQGPALLLVLDGVTDPHNLGACLRVADAAGAH 123

Query: 161 GIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPL 220
            +I  +  +   +A  AK ASGA + +PYI ++NL  AL+++   G   IG S ++   L
Sbjct: 124 AVIAPRDRAVGLNATAAKVASGAADTVPYITVTNLARALRELKEAGVWIIGTSDEASATL 183

Query: 221 EQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
                +  +AL++GAEG+G+R  T++T   +  + M G +++LNVS A+ V LY
Sbjct: 184 YDTKLDGPVALVMGAEGEGMRRLTRDTCDEVMSIPMAGSVESLNVSVASGVCLY 237


>gi|70734080|ref|YP_257720.1| RNA methyltransferase [Pseudomonas fluorescens Pf-5]
 gi|68348379|gb|AAY95985.1| RNA methyltransferase, TrmH family, group 3 [Pseudomonas
           fluorescens Pf-5]
          Length = 254

 Score =  117 bits (293), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 79/235 (33%), Positives = 125/235 (53%), Gaps = 14/235 (5%)

Query: 51  LYGVHTVSAALNNPSRKIFQL-LATKNALARLDWDANLP--HPFPVKTVPPQTIDKIVGK 107
           +YGVH V A L +  +++ Q+ LA   +  R+    +L   +   V     + +D  V  
Sbjct: 7   IYGVHAVEALLRHHPKRVKQIWLAEGRSDPRVQVLVDLAAQNRVSVGQAERREMDAWV-- 64

Query: 108 EAVHQGLALETAP-------LLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCD 160
           E VHQG+  E +P       +L   LD    + LL+VLD V DPHN+GA LR+A A    
Sbjct: 65  EGVHQGVVAEVSPSQVWGEAMLDELLDRTEGAPLLLVLDGVTDPHNLGACLRTADAAGAL 124

Query: 161 GIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPL 220
            ++  K  S + +  + K A GA E IP + ++NL   L+K+   G   +G + ++++ L
Sbjct: 125 AVLVPKDKSATLTPTVRKVACGAAEVIPLVAVTNLARTLEKLQQRGLWIVGTAGEAEQEL 184

Query: 221 -EQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
            +Q++    I +I+GAEGKG+R  T+E    +  L M G + +LNVS A  V L+
Sbjct: 185 YDQDLTGPTI-IIMGAEGKGMRRLTREHCDYLVRLPMAGSVSSLNVSVATGVCLF 238


>gi|329767864|ref|ZP_08259378.1| RNA methyltransferase [Gemella haemolysans M341]
 gi|328838652|gb|EGF88251.1| RNA methyltransferase [Gemella haemolysans M341]
          Length = 271

 Score =  117 bits (293), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 80/267 (29%), Positives = 137/267 (51%), Gaps = 18/267 (6%)

Query: 23  LRRNHRDYKKMQSFNQKSRHTSQPENL-----FLYGVHTVSAALNNP---SRKIFQLLAT 74
           +++N++ YK+++  N++ +   Q   +      + G + +  A+ +    ++ +FQ    
Sbjct: 1   MKKNNKHYKELRLKNKEQKSQVQTAEVDLDKEVIAGRNAILEAIKSGREINKILFQEGIE 60

Query: 75  KNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNS-- 132
           K  L  +   AN       + VP + +D    +   HQG+    AP     LD V N+  
Sbjct: 61  KGRLKSIFAIAN-EKKIICQEVPKRKLDNSTTER--HQGVIAYVAPYSYFELDEVVNNLE 117

Query: 133 ----QLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIP 188
                 L++LDH+ DPHN+GAI+R+A A     II  KR +   S    K+++GA+EH+P
Sbjct: 118 INKDTTLLILDHIEDPHNLGAIIRTAEASGVKAIIIPKRRAAVVSQTAVKASAGAIEHMP 177

Query: 189 YIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDK-IALILGAEGKGLRPKTQET 247
            IR+SNLTDA++K+   GF   G +   +     +I  D  +A+++G EG+G+       
Sbjct: 178 VIRVSNLTDAIKKLKEKGFWIAGTTLAERSEDYTKIAKDVPLAIVIGNEGEGMSKVVTNE 237

Query: 248 ATSMAHLHMPGIIKALNVSNAAAVALY 274
              + HL M G I++LN S AA + +Y
Sbjct: 238 CDFLYHLPMLGKIQSLNASVAAGIIMY 264


>gi|319946269|ref|ZP_08020509.1| 23S rRNA (guanosine-2'-O-)-methyltransferase RlmB [Streptococcus
           australis ATCC 700641]
 gi|319747651|gb|EFV99904.1| 23S rRNA (guanosine-2'-O-)-methyltransferase RlmB [Streptococcus
           australis ATCC 700641]
          Length = 242

 Score =  117 bits (293), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 77/237 (32%), Positives = 128/237 (54%), Gaps = 13/237 (5%)

Query: 47  ENLFLYGVHTVSAAL-NNPSRKIF--QLLATKNALARLDWDANLPHPFPVKTVPPQTIDK 103
           +N  +YGVH V+ AL  N   K++    L  KN     D  A+      +   P +T+ +
Sbjct: 3   KNDIVYGVHAVTEALIANTGNKLYIQDDLRGKNVEKIKDLAAD--KKVSISWTPKKTLQE 60

Query: 104 IVGKEAVHQGLALETAPLLSPTLDAV------RNSQLLMVLDHVNDPHNIGAILRSAVAF 157
           +  + AVHQG  L  +      L+ +      +++ LL++LD + DPHN+G+ILR+A A 
Sbjct: 61  MT-EGAVHQGFVLRVSEFAYTDLNEILTQVANQDNPLLLILDGLTDPHNLGSILRTADAT 119

Query: 158 SCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSK 217
              G+I  K  +   + V+AK+++GA+EH+P  R++NL+  L K+   GF   G   +  
Sbjct: 120 QVAGVIIPKHRAVGVTPVVAKTSTGAVEHVPIARVTNLSQTLDKLKEAGFWIFGTDMNG- 178

Query: 218 KPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
            P  +   + K+ALI+G EGKG+    ++    M  + M G +++LN S AAA+ +Y
Sbjct: 179 TPSHKWNTSGKLALIIGNEGKGISTNIKKQVDEMITIPMQGHVQSLNASVAAAILMY 235


>gi|317495868|ref|ZP_07954231.1| RNA methyltransferase [Gemella moribillum M424]
 gi|316914045|gb|EFV35528.1| RNA methyltransferase [Gemella moribillum M424]
          Length = 270

 Score =  117 bits (293), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 79/266 (29%), Positives = 138/266 (51%), Gaps = 17/266 (6%)

Query: 23  LRRNHRDYKKMQSFNQKSRHTSQPE----NLFLYGVHTVSAALNNP---SRKIFQLLATK 75
           +++N++ YK+++S N++ ++    E       + G + +  A+ +    ++ +FQ    K
Sbjct: 1   MKKNNKYYKELRSKNKEEKNNQNTEVDADKEVIAGRNAILEAIKSGREINKILFQEGIEK 60

Query: 76  NALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRN---- 131
             L  +   AN       + VP + +D    +   HQG+    AP     LD V N    
Sbjct: 61  GRLKAIFSIAN-EKKIVCQEVPKRKLDNSTTER--HQGVIAFVAPYNYFELDEVLNKIEI 117

Query: 132 --SQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPY 189
             +  L++LDH+ DPHN+GAI+RSA A    G+I  KR +   S    K+++GA+EH+P 
Sbjct: 118 NKNTTLLLLDHIEDPHNLGAIIRSAEASGVKGVIIPKRRAAVVSQTAVKASAGAIEHMPV 177

Query: 190 IRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKND-KIALILGAEGKGLRPKTQETA 248
           IR+S+L DA++K+   GF   G +   +     +I  D  + +++G EG+G+        
Sbjct: 178 IRVSSLIDAIKKLKEKGFWIAGTTLTERSEDYTKIAKDVPLVIVVGNEGEGMSKVVTNEC 237

Query: 249 TSMAHLHMPGIIKALNVSNAAAVALY 274
             + HL M G +++LNVS AA + +Y
Sbjct: 238 DFLYHLPMLGKVQSLNVSVAAGIVMY 263


>gi|306829232|ref|ZP_07462422.1| RNA methyltransferase [Streptococcus mitis ATCC 6249]
 gi|304428318|gb|EFM31408.1| RNA methyltransferase [Streptococcus mitis ATCC 6249]
          Length = 242

 Score =  117 bits (293), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 77/236 (32%), Positives = 125/236 (52%), Gaps = 13/236 (5%)

Query: 48  NLFLYGVHTVSAAL-NNPSRKIF--QLLATKNALARLDWDANLPHPFPVKTVPPQTIDKI 104
           N  +YGVH V+ AL  N   K++  + +  KN     +  A       +     +++ ++
Sbjct: 4   NDIVYGVHAVTEALLANTGNKLYLQEDIRGKNVEKVKELAAE--KKVSISWTSKKSLSEM 61

Query: 105 VGKEAVHQGLALETAPLLSPTLDAV------RNSQLLMVLDHVNDPHNIGAILRSAVAFS 158
             + AVHQG  L  +      LD +        + LL++LD + DPHN+G+ILR+A A +
Sbjct: 62  T-EGAVHQGFVLRVSEFAYSELDHILAKTRQEENPLLLILDGLTDPHNLGSILRTADATN 120

Query: 159 CDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKK 218
             G+I  K  +   + V+AK+A+GA+EH+P  R++NL+  L K+   GF T G   +   
Sbjct: 121 VSGVIIPKHRAVGVTPVVAKTATGAIEHVPIARVTNLSQTLDKLKDEGFWTFGTDMNG-T 179

Query: 219 PLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
           P  +     KIALI+G EGKG+    ++    M  + M G +++LN S AAA+ +Y
Sbjct: 180 PCHKWNTKGKIALIIGNEGKGISSNIKKQVDEMITIPMNGHVQSLNASVAAAILMY 235


>gi|229917377|ref|YP_002886023.1| RNA methyltransferase, TrmH family, group 3 [Exiguobacterium sp.
           AT1b]
 gi|229468806|gb|ACQ70578.1| RNA methyltransferase, TrmH family, group 3 [Exiguobacterium sp.
           AT1b]
          Length = 250

 Score =  117 bits (293), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 78/235 (33%), Positives = 125/235 (53%), Gaps = 12/235 (5%)

Query: 50  FLYGVHTVSAALNNPS--RKIFQLLAT-KNALARLDWDANLPHPFPVKTVPPQTIDKIVG 106
           FLYG + V  AL +     K+F +    K  LA++   AN      V  VP   ++K+ G
Sbjct: 8   FLYGRNPVLEALRSGRDMNKVFIMEGQQKGPLAQIIAMAN-EASVQVSFVPKTKLEKMAG 66

Query: 107 KEAVHQGLALETAPLLSPTLDAV-------RNSQLLMVLDHVNDPHNIGAILRSAVAFSC 159
            E  HQG+    A     T++ +         + L ++LD + DPHN+G+ILR+A A   
Sbjct: 67  SEH-HQGVVAAVAAYEYKTVEDMFALAASKEETPLFILLDELEDPHNLGSILRTADAVGA 125

Query: 160 DGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKP 219
            GII  KR S   +  +AK+++GA+EHIP  R++NLT  L+++   G   +G  +   + 
Sbjct: 126 HGIIIPKRRSVGLTQTVAKASTGAIEHIPVARVTNLTRTLEELKEKGLWVVGTDAKESQD 185

Query: 220 LEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
             +   N  + +++G+EGKG+    +E+   + HL M G + +LN S AAA+ LY
Sbjct: 186 YRRLDGNMPLVVVIGSEGKGMSRLVRESCDFLVHLPMVGHVTSLNASVAAALLLY 240


>gi|149007272|ref|ZP_01830930.1| pyridoxine biosynthesis protein [Streptococcus pneumoniae
           SP18-BS74]
 gi|307126973|ref|YP_003879004.1| RNA methyltransferase, TrmH family, group 3 [Streptococcus
           pneumoniae 670-6B]
 gi|147761076|gb|EDK68044.1| pyridoxine biosynthesis protein [Streptococcus pneumoniae
           SP18-BS74]
 gi|306484035|gb|ADM90904.1| RNA methyltransferase, TrmH family, group 3 [Streptococcus
           pneumoniae 670-6B]
          Length = 242

 Score =  117 bits (293), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 80/247 (32%), Positives = 126/247 (51%), Gaps = 35/247 (14%)

Query: 48  NLFLYGVHTVSAAL-NNPSRKIF-------------QLLATKNALARLDWDANLPHPFPV 93
           N  +YGVH V+ AL  N   K++             + LAT+  ++ + W +        
Sbjct: 4   NDIVYGVHAVTEALLANTGNKLYLQEDLRGKNVEKVKELATEKKVS-ISWTSK------- 55

Query: 94  KTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAV------RNSQLLMVLDHVNDPHNI 147
           K++   T      + AVHQG  L  +      LD +        + LL++LD + DPHN+
Sbjct: 56  KSLSEMT------EGAVHQGFVLRVSEFAYSELDYILAKTRQEENPLLLILDGLTDPHNL 109

Query: 148 GAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGF 207
           G+ILR+A A +  G+I  K  +   + V+AK+A+GA+EH+P  R++NL   L K+   GF
Sbjct: 110 GSILRTADATNVSGVIIPKHRAVGVTPVVAKTATGAIEHVPIARVTNLNQTLYKLKDEGF 169

Query: 208 QTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSN 267
            T G   +   P  +     KIALI+G EGKG+    ++    M  + M G +++LN S 
Sbjct: 170 WTFGTDMNG-TPCHKWNTKGKIALIIGNEGKGISSNIKKQVDEMITIPMNGHVQSLNASV 228

Query: 268 AAAVALY 274
           AAA+ +Y
Sbjct: 229 AAAILMY 235


>gi|302039376|ref|YP_003799698.1| RNA methyltransferase, TrmH family, group 3 [Candidatus Nitrospira
           defluvii]
 gi|300607440|emb|CBK43773.1| RNA methyltransferase, TrmH family, group 3 [Candidatus Nitrospira
           defluvii]
          Length = 246

 Score =  117 bits (293), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 73/237 (30%), Positives = 128/237 (54%), Gaps = 17/237 (7%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLATK-----NALARLDWDANLPHPFPVKTVPPQTIDKI 104
            +YG+H V  AL    R I +LL          ++RL  +  +P    V+  P   +D++
Sbjct: 1   MIYGLHAVREALRAGVRPIQRLLVLGTDRQFGEISRLAREQRVP----VRVEPRAALDRL 56

Query: 105 VGKEAVHQGL-ALETAPLLSPTLDAVRNSQ------LLMVLDHVNDPHNIGAILRSAVAF 157
           V     HQG+  +  A   +   D + ++Q      LL++LD V DPHN+GAILR+A A 
Sbjct: 57  V-PSGHHQGVVGVVAAKAYAEPDDILASAQVEGQTPLLVLLDGVEDPHNLGAILRTAEAS 115

Query: 158 SCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSK 217
              G+   +R +   ++V+AK+++GA++++P  R+ NL+  ++++   G     L +++ 
Sbjct: 116 GVQGVFIPERRAVGLTSVVAKASAGAVDYMPVGRVPNLSRLIERLQDAGIWVYALDAEAP 175

Query: 218 KPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
           K   +   +  +AL+ G EG G+RP  ++     AH+ M G + +LNVS +AA+ LY
Sbjct: 176 KAYTELDFSGPVALVFGGEGTGVRPGVRDACDEAAHIPMLGKVSSLNVSASAAIVLY 232


>gi|153005091|ref|YP_001379416.1| RNA methyltransferase [Anaeromyxobacter sp. Fw109-5]
 gi|152028664|gb|ABS26432.1| RNA methyltransferase, TrmH family, group 3 [Anaeromyxobacter sp.
           Fw109-5]
          Length = 245

 Score =  117 bits (292), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 68/189 (35%), Positives = 109/189 (57%), Gaps = 8/189 (4%)

Query: 93  VKTVPPQTIDKIVGKEAVHQGLALETAPL----LSPTLDAVRNSQ---LLMVLDHVNDPH 145
           V++ P   +D++ G +  HQG+    A      +   L A R S    L++VLD V DPH
Sbjct: 50  VRSAPRAKLDRLAGTDR-HQGVVAMVADFRYAEVEDLLAAARASGRPPLVVVLDGVEDPH 108

Query: 146 NIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSW 205
           N+GAI+RSA A    G++  K  +   +  +AK+++GA+E  P  R++N++  L+ +   
Sbjct: 109 NLGAIIRSAHALGAHGVVIPKDRAVGVTPAVAKASAGAVERCPVARVTNVSKTLEALKEA 168

Query: 206 GFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNV 265
           G  ++ L++D   PL        IAL+LG+EG+GLRP  ++T    A + M G + +L+V
Sbjct: 169 GIWSVALAADGDAPLGAVDLTGPIALVLGSEGEGLRPLVRKTCDHSARIPMSGDLDSLSV 228

Query: 266 SNAAAVALY 274
           S +AAVALY
Sbjct: 229 SASAAVALY 237


>gi|325271218|ref|ZP_08137763.1| RNA methyltransferase [Pseudomonas sp. TJI-51]
 gi|324103621|gb|EGC00923.1| RNA methyltransferase [Pseudomonas sp. TJI-51]
          Length = 248

 Score =  117 bits (292), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 73/234 (31%), Positives = 119/234 (50%), Gaps = 12/234 (5%)

Query: 51  LYGVHTVSAALNNPSRKIFQLLATKNA---LARLDWDANLPHPFPVKTVPPQTIDKIVGK 107
           +YGVH V A L +  +++ Q+  ++       +        +   V     + +D  V  
Sbjct: 7   IYGVHAVQALLQHHPKRVKQIWLSEGRSEPRLQALLALAAENRVAVGQAERREMDAWV-- 64

Query: 108 EAVHQGLALETAP-------LLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCD 160
           E VHQG+  E +P       +L   L+      L++VLD V DPHN+GA LR+A A    
Sbjct: 65  EGVHQGVVAEVSPSQVWGELMLEEMLERTETPPLILVLDGVTDPHNLGACLRTADAAGAT 124

Query: 161 GIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPL 220
            +I  K  S + + V+ K A GA E IP + ++NL   L+K+   G   +G + ++++ +
Sbjct: 125 AVIVPKDKSATLTPVVRKVACGAAEVIPLVAVTNLARTLEKLQQRGLWVVGTAGEAEQEI 184

Query: 221 EQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
            Q+     + +I+GAEGKG+R  T+E    +  L M G + +LNVS A  V L+
Sbjct: 185 YQQDLTGPLVMIMGAEGKGMRRLTREHCDFLVKLPMSGSVSSLNVSVATGVCLF 238


>gi|76810371|ref|YP_333368.1| RNA methyltransferase [Burkholderia pseudomallei 1710b]
 gi|217423817|ref|ZP_03455318.1| RNA methyltransferase, TrmH family, group 3 [Burkholderia
           pseudomallei 576]
 gi|238563304|ref|ZP_00439092.2| RNA methyltransferase, TrmH family, group 3 [Burkholderia mallei
           GB8 horse 4]
 gi|242316025|ref|ZP_04815041.1| RNA methyltransferase, TrmH family, group 3 [Burkholderia
           pseudomallei 1106b]
 gi|251767767|ref|ZP_02268341.2| RNA methyltransferase, TrmH family, group 3 [Burkholderia mallei
           PRL-20]
 gi|254197285|ref|ZP_04903707.1| RNA methyltransferase, TrmH family, group 3 [Burkholderia
           pseudomallei S13]
 gi|76579824|gb|ABA49299.1| RNA methyltransferase, TrmH family, group 3 [Burkholderia
           pseudomallei 1710b]
 gi|169654026|gb|EDS86719.1| RNA methyltransferase, TrmH family, group 3 [Burkholderia
           pseudomallei S13]
 gi|217393675|gb|EEC33696.1| RNA methyltransferase, TrmH family, group 3 [Burkholderia
           pseudomallei 576]
 gi|238520972|gb|EEP84427.1| RNA methyltransferase, TrmH family, group 3 [Burkholderia mallei
           GB8 horse 4]
 gi|242139264|gb|EES25666.1| RNA methyltransferase, TrmH family, group 3 [Burkholderia
           pseudomallei 1106b]
 gi|243061768|gb|EES43954.1| RNA methyltransferase, TrmH family, group 3 [Burkholderia mallei
           PRL-20]
          Length = 260

 Score =  117 bits (292), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 66/169 (39%), Positives = 98/169 (57%), Gaps = 5/169 (2%)

Query: 111 HQGLA--LETAPL---LSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITT 165
           HQG+   +E  PL   L+  LD +    LL+VLD V DPHN+GA LR A A     II  
Sbjct: 82  HQGVVARVEDLPLAQNLAELLDGIAGPALLLVLDGVTDPHNLGACLRVADAAGAHAIIAP 141

Query: 166 KRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIK 225
           +  +   +A  AK ASGA + +PYI ++NL  AL+++   G   IG S D+   +     
Sbjct: 142 RDRAAGLNATAAKVASGAADTVPYITVTNLARALRELKDAGVWVIGTSDDATASVYDTKL 201

Query: 226 NDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
           +  +AL++GAEG+G+R  T++T   +  + M G +++LNVS A+ V LY
Sbjct: 202 DGPVALVMGAEGEGMRRLTRDTCDEVMFIPMAGSVESLNVSVASGVCLY 250


>gi|134282338|ref|ZP_01769043.1| RNA methyltransferase, TrmH family, group 3 [Burkholderia
           pseudomallei 305]
 gi|134246376|gb|EBA46465.1| RNA methyltransferase, TrmH family, group 3 [Burkholderia
           pseudomallei 305]
          Length = 260

 Score =  117 bits (292), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 66/169 (39%), Positives = 98/169 (57%), Gaps = 5/169 (2%)

Query: 111 HQGLA--LETAPL---LSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITT 165
           HQG+   +E  PL   L+  LD +    LL+VLD V DPHN+GA LR A A     II  
Sbjct: 82  HQGVVARVEDLPLAQNLAELLDGIAGPALLLVLDGVTDPHNLGACLRVADAAGAHAIIAP 141

Query: 166 KRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIK 225
           +  +   +A  AK ASGA + +PYI ++NL  AL+++   G   IG S D+   +     
Sbjct: 142 RDRAAGLNATAAKVASGAADTVPYITVTNLARALRELKDAGVWVIGTSDDATASVYDTKL 201

Query: 226 NDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
           +  +AL++GAEG+G+R  T++T   +  + M G +++LNVS A+ V LY
Sbjct: 202 DGPVALVMGAEGEGMRRLTRDTCDEVMFIPMAGSVESLNVSVASGVCLY 250


>gi|257871416|ref|ZP_05651069.1| RNA methyltransferase [Enterococcus gallinarum EG2]
 gi|257805580|gb|EEV34402.1| RNA methyltransferase [Enterococcus gallinarum EG2]
          Length = 275

 Score =  117 bits (292), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 81/260 (31%), Positives = 133/260 (51%), Gaps = 15/260 (5%)

Query: 24  RRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAAL-NNPSRKIFQLLATKNALARLD 82
           R+N    K+    N +   T   +  F++G H V  AL      K+F  +A      ++D
Sbjct: 11  RQNTVKNKQHTRKNFREETTELIDENFVFGYHAVIEALKEGRGNKLF--MAEDARGEKID 68

Query: 83  W--DANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAV----RNSQLLM 136
              +A      PVK VP Q +D++   + VHQ + L   P    +LD +    +     +
Sbjct: 69  GLKEAARAQSVPVKWVPKQKLDQM-SNQGVHQSVILAITPYEYLSLDELLAQTKEQSFYL 127

Query: 137 VLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLT 196
           +LD++ DPHN G+ILR+A A   DGII  K  +   + V+ K+++GA+EHIP  R++NL+
Sbjct: 128 ILDNLEDPHNFGSILRTADASGVDGIIIPKHRAVGITPVVVKTSTGAVEHIPIARVTNLS 187

Query: 197 DALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIA--LILGAEGKGLRPKTQETATSMAHL 254
            A+Q++   GF   G      K  +  + N + A  LI+G EG+G+    ++    M  +
Sbjct: 188 QAIQQLKQAGFWIFGTDM---KGTDYRLWNAQGAAGLIIGNEGRGMSEGLKKDVDEMLTI 244

Query: 255 HMPGIIKALNVSNAAAVALY 274
            M G +++LN S AA + +Y
Sbjct: 245 PMTGHVQSLNASVAAGLLMY 264


>gi|192360670|ref|YP_001983449.1| TrmH family RNA methyltransferase [Cellvibrio japonicus Ueda107]
 gi|190686835|gb|ACE84513.1| RNA methyltransferase, TrmH family, group 3 [Cellvibrio japonicus
           Ueda107]
          Length = 249

 Score =  117 bits (292), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 76/236 (32%), Positives = 117/236 (49%), Gaps = 13/236 (5%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLATKNA----LARLDWDANLPHPFPVKTVPPQTIDKIV 105
            +YG+H V A L +  +++ ++   +      L ++   A L +      V    +D +V
Sbjct: 5   LVYGLHAVQALLKSAPQRVLEIYVLQGRQDQRLQKIAHAAEL-NQIHCNLVSRNKLDDMV 63

Query: 106 GKEAVHQGLALETAP-------LLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFS 158
            +E  HQG+     P        L   L+ +     L+VLD V DPHN+GA +RSA A  
Sbjct: 64  SEEN-HQGVVARCTPGETYDEAYLFSLLETLDEPPFLLVLDGVTDPHNLGACMRSAEAAG 122

Query: 159 CDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKK 218
              +I  K  S   + V  K A GA E +P+I ++NL   L+K+   G    G + ++ +
Sbjct: 123 VHAVIAPKDKSAGLTPVARKVACGAAEVLPFIPVTNLARTLKKLQEKGIWLFGAAGEASQ 182

Query: 219 PLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
            L Q      IA+++GAEG GLR  TQET   + H+ M G + +LNVS A  V L+
Sbjct: 183 SLYQTRLTGPIAILMGAEGDGLRRLTQETCDQLMHIPMAGSVSSLNVSVATGVCLF 238


>gi|78066159|ref|YP_368928.1| RNA methyltransferase TrmH, group 3 [Burkholderia sp. 383]
 gi|77966904|gb|ABB08284.1| 23S rRNA Gm-2251 2'-O-methyltransferase [Burkholderia sp. 383]
          Length = 247

 Score =  117 bits (292), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 78/234 (33%), Positives = 122/234 (52%), Gaps = 11/234 (4%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKI----V 105
            LYG H V+A L + +  + ++L  +    R   D    H      V     D+     +
Sbjct: 6   VLYGFHAVTARLRHDASTVAEVLYDQTRRDRRMQD--FLHTAKEAGVRLIAADETRLWGL 63

Query: 106 GKEAVHQGLA--LETAPL---LSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCD 160
                HQG+   +E  PL   LS  LD ++   LL+VLD V DPHN+GA LR A +    
Sbjct: 64  AHTERHQGVVARVEDIPLAQNLSELLDGIQGPALLLVLDGVTDPHNLGACLRVADSAGAH 123

Query: 161 GIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPL 220
            +I  +  +   +A  AK ASGA + +PYI ++NL  AL+++   G   IG S ++   L
Sbjct: 124 AVIAPRDRAVGLNATAAKVASGAADTVPYITVTNLARALRELKEAGVWIIGTSDEASATL 183

Query: 221 EQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
            +   +  +AL++GAEG+G+R  T++T   +  + M G +++LNVS A+ V LY
Sbjct: 184 YETKLDGPVALVMGAEGEGMRRLTRDTCDEVMSIPMAGSVESLNVSVASGVCLY 237


>gi|146283972|ref|YP_001174125.1| RNA methyltransferase [Pseudomonas stutzeri A1501]
 gi|145572177|gb|ABP81283.1| RNA methyltransferase, TrmH family, group 3 [Pseudomonas stutzeri
           A1501]
 gi|327482300|gb|AEA85610.1| RNA methyltransferase [Pseudomonas stutzeri DSM 4166]
          Length = 251

 Score =  116 bits (291), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 75/232 (32%), Positives = 117/232 (50%), Gaps = 8/232 (3%)

Query: 51  LYGVHTVSAALNNPSRKIFQL-LATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEA 109
           +YG+H V A L +  +++ Q+ LA      R+     L     V     +  +     E 
Sbjct: 7   IYGLHAVEALLRHHPKRVKQVWLAEGRGDPRVQVLIELAAQARVSVGQCERREMDAWVEG 66

Query: 110 VHQGLALETAP-------LLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGI 162
           VHQG+  + +P       +L   LD      LL+VLD V DPHN+GA LR+A A     +
Sbjct: 67  VHQGVVADVSPSQVWGEAMLDELLDRAEGPPLLLVLDGVTDPHNLGACLRTADAAGALAV 126

Query: 163 ITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQ 222
           I  K  S + +A + K A GA E IP + ++NL   L+K+   G   +G + ++++ L  
Sbjct: 127 IVPKDKSATLNATVRKVACGAAEVIPLVAVTNLARTLEKLQQKGLWVVGTAGEAEQSLYA 186

Query: 223 EIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
           +     I L++GAEG+G+R  T+E    +  L M G + +LNVS A  V L+
Sbjct: 187 QDLTGPIVLVMGAEGRGMRRLTREHCDYLVRLPMAGSVSSLNVSVATGVCLF 238


>gi|161524858|ref|YP_001579870.1| RNA methyltransferase [Burkholderia multivorans ATCC 17616]
 gi|189350392|ref|YP_001946020.1| TrmH family RNA methyltransferase [Burkholderia multivorans ATCC
           17616]
 gi|221197831|ref|ZP_03570877.1| RNA methyltransferase, TrmH family, group 3 [Burkholderia
           multivorans CGD2M]
 gi|221204611|ref|ZP_03577628.1| RNA methyltransferase, TrmH family, group 3 [Burkholderia
           multivorans CGD2]
 gi|221213042|ref|ZP_03586018.1| RNA methyltransferase, TrmH family, group 3 [Burkholderia
           multivorans CGD1]
 gi|160342287|gb|ABX15373.1| RNA methyltransferase, TrmH family, group 3 [Burkholderia
           multivorans ATCC 17616]
 gi|189334414|dbj|BAG43484.1| TrmH family RNA methyltransferase [Burkholderia multivorans ATCC
           17616]
 gi|221167255|gb|EED99725.1| RNA methyltransferase, TrmH family, group 3 [Burkholderia
           multivorans CGD1]
 gi|221175468|gb|EEE07898.1| RNA methyltransferase, TrmH family, group 3 [Burkholderia
           multivorans CGD2]
 gi|221181763|gb|EEE14164.1| RNA methyltransferase, TrmH family, group 3 [Burkholderia
           multivorans CGD2M]
          Length = 247

 Score =  116 bits (291), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 78/234 (33%), Positives = 121/234 (51%), Gaps = 11/234 (4%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKI----V 105
            LYG H V+A L + +  + ++L  +    R   D    H      V     D+     +
Sbjct: 6   VLYGFHAVTARLRHDAATVVEVLYDQTRRDRRMQD--FLHAAKEAGVRLIAADETRLWGL 63

Query: 106 GKEAVHQGLA--LETAPL---LSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCD 160
                HQG+   +E  PL   LS  LD ++   LL+VLD V DPHN+GA LR A A    
Sbjct: 64  AHTERHQGVVARVEDLPLAQNLSELLDGIQGPALLLVLDGVTDPHNLGACLRVADAAGAH 123

Query: 161 GIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPL 220
            +I  +  +   +A  AK ASGA + +PYI ++NL  AL+++   G   IG S ++   L
Sbjct: 124 AVIAPRDRAVGLNATAAKVASGAADTVPYITVTNLARALRELKEAGVWIIGTSDEASATL 183

Query: 221 EQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
                +  +A+++GAEG+G+R  T++T   +  + M G +++LNVS A+ V LY
Sbjct: 184 YDTKLDGPVAIVMGAEGEGMRRLTRDTCDEVMSIPMAGSVESLNVSVASGVCLY 237


>gi|322420271|ref|YP_004199494.1| TrmH family RNA methyltransferase [Geobacter sp. M18]
 gi|320126658|gb|ADW14218.1| RNA methyltransferase, TrmH family, group 3 [Geobacter sp. M18]
          Length = 249

 Score =  116 bits (291), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 72/234 (30%), Positives = 125/234 (53%), Gaps = 11/234 (4%)

Query: 50  FLYGVHTVSAALNNPSRKIFQL-LATKNALARLDWDANLP--HPFPVKTVPPQTIDKIVG 106
            +YG++    AL   SRKIF+L +A  +A  RL+    L      PV+      ++++ G
Sbjct: 6   IIYGLNPAMEALRG-SRKIFELFVAGTSADKRLEKLLKLAAERKVPVRQREKGDLNRLCG 64

Query: 107 KEAVHQGLALETAPLLSPTLDAV------RNSQLLMVLDHVNDPHNIGAILRSAVAFSCD 160
            E  HQG+AL+  P     LD V        + L++VLD V DPHN+GA++RSA     +
Sbjct: 65  TEH-HQGVALKVEPFPYADLDDVLEGLQGEGNGLILVLDSVQDPHNLGALIRSAACAGAN 123

Query: 161 GIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPL 220
            ++  K  +   +AV+ K+++GA E +   +++N++ AL+ +   GF   G    +K  L
Sbjct: 124 AVVIPKDRAAGVTAVVEKASAGATETVAVAQVTNISQALETLKKAGFWIYGADGSAKHTL 183

Query: 221 EQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
            Q+     +AL++G EG+G+RP  ++    +  + + G + +LN S A  + L+
Sbjct: 184 YQQDFTGPVALVIGGEGEGIRPLVRKGCDEVVSIPLQGGVNSLNASVAGGIFLF 237


>gi|226196377|ref|ZP_03791959.1| RNA methyltransferase, TrmH family, group 3 [Burkholderia
           pseudomallei Pakistan 9]
 gi|254297770|ref|ZP_04965223.1| RNA methyltransferase, TrmH family, group 3 [Burkholderia
           pseudomallei 406e]
 gi|157807881|gb|EDO85051.1| RNA methyltransferase, TrmH family, group 3 [Burkholderia
           pseudomallei 406e]
 gi|225931594|gb|EEH27599.1| RNA methyltransferase, TrmH family, group 3 [Burkholderia
           pseudomallei Pakistan 9]
          Length = 231

 Score =  116 bits (291), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 66/169 (39%), Positives = 98/169 (57%), Gaps = 5/169 (2%)

Query: 111 HQGLA--LETAPL---LSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITT 165
           HQG+   +E  PL   L+  LD +    LL+VLD V DPHN+GA LR A A     II  
Sbjct: 53  HQGVVARVEDLPLAQNLAELLDGIAGPALLLVLDGVTDPHNLGACLRVADAAGAHAIIAP 112

Query: 166 KRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIK 225
           +  +   +A  AK ASGA + +PYI ++NL  AL+++   G   IG S D+   +     
Sbjct: 113 RDRAAGLNATAAKVASGAADTVPYITVTNLARALRELKDAGVWVIGTSDDATASVYDTKL 172

Query: 226 NDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
           +  +AL++GAEG+G+R  T++T   +  + M G +++LNVS A+ V LY
Sbjct: 173 DGPVALVMGAEGEGMRRLTRDTCDEVMFIPMAGSVESLNVSVASGVCLY 221


>gi|53719486|ref|YP_108472.1| putative tRNA/rRNA methyltransferase [Burkholderia pseudomallei
           K96243]
 gi|53723479|ref|YP_102933.1| RNA methyltransferase [Burkholderia mallei ATCC 23344]
 gi|121601104|ref|YP_993068.1| RNA methyltransferase [Burkholderia mallei SAVP1]
 gi|124385837|ref|YP_001026152.1| RNA methyltransferase [Burkholderia mallei NCTC 10229]
 gi|126440617|ref|YP_001058836.1| RNA methyltransferase [Burkholderia pseudomallei 668]
 gi|126449600|ref|YP_001080577.1| RNA methyltransferase [Burkholderia mallei NCTC 10247]
 gi|126453075|ref|YP_001066084.1| RNA methyltransferase [Burkholderia pseudomallei 1106a]
 gi|167719760|ref|ZP_02402996.1| RNA methyltransferase, TrmH family, group 3 [Burkholderia
           pseudomallei DM98]
 gi|167738755|ref|ZP_02411529.1| RNA methyltransferase, TrmH family, group 3 [Burkholderia
           pseudomallei 14]
 gi|167815979|ref|ZP_02447659.1| RNA methyltransferase, TrmH family, group 3 [Burkholderia
           pseudomallei 91]
 gi|167824352|ref|ZP_02455823.1| RNA methyltransferase, TrmH family, group 3 [Burkholderia
           pseudomallei 9]
 gi|167845895|ref|ZP_02471403.1| RNA methyltransferase, TrmH family, group 3 [Burkholderia
           pseudomallei B7210]
 gi|167894463|ref|ZP_02481865.1| RNA methyltransferase, TrmH family, group 3 [Burkholderia
           pseudomallei 7894]
 gi|167902867|ref|ZP_02490072.1| RNA methyltransferase, TrmH family, group 3 [Burkholderia
           pseudomallei NCTC 13177]
 gi|167911108|ref|ZP_02498199.1| RNA methyltransferase, TrmH family, group 3 [Burkholderia
           pseudomallei 112]
 gi|167919128|ref|ZP_02506219.1| RNA methyltransferase, TrmH family, group 3 [Burkholderia
           pseudomallei BCC215]
 gi|254177694|ref|ZP_04884349.1| RNA methyltransferase, TrmH family, group 3 [Burkholderia mallei
           ATCC 10399]
 gi|254179938|ref|ZP_04886537.1| RNA methyltransferase, TrmH family, group 3 [Burkholderia
           pseudomallei 1655]
 gi|254188656|ref|ZP_04895167.1| RNA methyltransferase, TrmH family, group 3 [Burkholderia
           pseudomallei Pasteur 52237]
 gi|254199876|ref|ZP_04906242.1| RNA methyltransferase, TrmH family, group 3 [Burkholderia mallei
           FMH]
 gi|254206204|ref|ZP_04912556.1| RNA methyltransferase, TrmH family, group 3 [Burkholderia mallei
           JHU]
 gi|254259237|ref|ZP_04950291.1| RNA methyltransferase, TrmH family, group 3 [Burkholderia
           pseudomallei 1710a]
 gi|254358375|ref|ZP_04974648.1| RNA methyltransferase, TrmH family, group 3 [Burkholderia mallei
           2002721280]
 gi|52209900|emb|CAH35872.1| putative tRNA/rRNA methyltransferase [Burkholderia pseudomallei
           K96243]
 gi|52426902|gb|AAU47495.1| RNA methyltransferase, TrmH family, group 3 [Burkholderia mallei
           ATCC 23344]
 gi|121229914|gb|ABM52432.1| RNA methyltransferase, TrmH family, group 3 [Burkholderia mallei
           SAVP1]
 gi|124293857|gb|ABN03126.1| RNA methyltransferase, TrmH family, group 3 [Burkholderia mallei
           NCTC 10229]
 gi|126220110|gb|ABN83616.1| RNA methyltransferase, TrmH family, group 3 [Burkholderia
           pseudomallei 668]
 gi|126226717|gb|ABN90257.1| RNA methyltransferase, TrmH family, group 3 [Burkholderia
           pseudomallei 1106a]
 gi|126242470|gb|ABO05563.1| RNA methyltransferase, TrmH family, group 3 [Burkholderia mallei
           NCTC 10247]
 gi|147749472|gb|EDK56546.1| RNA methyltransferase, TrmH family, group 3 [Burkholderia mallei
           FMH]
 gi|147753647|gb|EDK60712.1| RNA methyltransferase, TrmH family, group 3 [Burkholderia mallei
           JHU]
 gi|148027502|gb|EDK85523.1| RNA methyltransferase, TrmH family, group 3 [Burkholderia mallei
           2002721280]
 gi|157936335|gb|EDO92005.1| RNA methyltransferase, TrmH family, group 3 [Burkholderia
           pseudomallei Pasteur 52237]
 gi|160698733|gb|EDP88703.1| RNA methyltransferase, TrmH family, group 3 [Burkholderia mallei
           ATCC 10399]
 gi|184210478|gb|EDU07521.1| RNA methyltransferase, TrmH family, group 3 [Burkholderia
           pseudomallei 1655]
 gi|254217926|gb|EET07310.1| RNA methyltransferase, TrmH family, group 3 [Burkholderia
           pseudomallei 1710a]
          Length = 247

 Score =  116 bits (291), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 66/169 (39%), Positives = 98/169 (57%), Gaps = 5/169 (2%)

Query: 111 HQGLA--LETAPL---LSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITT 165
           HQG+   +E  PL   L+  LD +    LL+VLD V DPHN+GA LR A A     II  
Sbjct: 69  HQGVVARVEDLPLAQNLAELLDGIAGPALLLVLDGVTDPHNLGACLRVADAAGAHAIIAP 128

Query: 166 KRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIK 225
           +  +   +A  AK ASGA + +PYI ++NL  AL+++   G   IG S D+   +     
Sbjct: 129 RDRAAGLNATAAKVASGAADTVPYITVTNLARALRELKDAGVWVIGTSDDATASVYDTKL 188

Query: 226 NDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
           +  +AL++GAEG+G+R  T++T   +  + M G +++LNVS A+ V LY
Sbjct: 189 DGPVALVMGAEGEGMRRLTRDTCDEVMFIPMAGSVESLNVSVASGVCLY 237


>gi|237812095|ref|YP_002896546.1| RNA methyltransferase, TrmH family, group 3 [Burkholderia
           pseudomallei MSHR346]
 gi|237503283|gb|ACQ95601.1| RNA methyltransferase, TrmH family, group 3 [Burkholderia
           pseudomallei MSHR346]
          Length = 247

 Score =  116 bits (291), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 66/169 (39%), Positives = 98/169 (57%), Gaps = 5/169 (2%)

Query: 111 HQGLA--LETAPL---LSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITT 165
           HQG+   +E  PL   L+  LD +    LL+VLD V DPHN+GA LR A A     II  
Sbjct: 69  HQGVVARVEDLPLAQNLAELLDGIAGPALLLVLDGVTDPHNLGACLRVADAAGAHAIIAP 128

Query: 166 KRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIK 225
           +  +   +A  AK ASGA + +PYI ++NL  AL+++   G   IG S D+   +     
Sbjct: 129 RDRAAGLNATAAKVASGAADTVPYITVTNLARALRELKDAGVWVIGTSDDATASVYDTKL 188

Query: 226 NDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
           +  +AL++GAEG+G+R  T++T   +  + M G +++LNVS A+ V LY
Sbjct: 189 DGPVALVMGAEGEGMRRLTRDTCDEVMFIPMAGRVESLNVSVASGVCLY 237


>gi|258512689|ref|YP_003186123.1| RNA methyltransferase, TrmH family, group 3 [Alicyclobacillus
           acidocaldarius subsp. acidocaldarius DSM 446]
 gi|257479415|gb|ACV59734.1| RNA methyltransferase, TrmH family, group 3 [Alicyclobacillus
           acidocaldarius subsp. acidocaldarius DSM 446]
          Length = 255

 Score =  116 bits (291), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 65/187 (34%), Positives = 108/187 (57%), Gaps = 8/187 (4%)

Query: 93  VKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAV--RNSQ---LLMVLDHVNDPHNI 147
           V+ VP   +D++    + HQG+  + AP     LD V  R++    L++VLD + DPHN 
Sbjct: 65  VQFVPRSRLDEMA---SAHQGVIAQVAPYAYVDLDDVIRRDTGFAPLVVVLDEIADPHNF 121

Query: 148 GAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGF 207
           GAILR+A A    G++  KR     + V+AK+A+GALE +P  R++N+  ALQ++   G+
Sbjct: 122 GAILRTAEASGAQGVVIGKRRQAQVTDVVAKAAAGALETLPVARVANVAQALQRLKQAGY 181

Query: 208 QTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSN 267
             +G   ++K P  +       A+++G+EG+G+R   +E    +  + + G +++LN S 
Sbjct: 182 WIVGADVEAKVPYTEVDYRGPTAVVIGSEGQGMRRWVREQCDFLVSIPILGRVQSLNASV 241

Query: 268 AAAVALY 274
           AA V LY
Sbjct: 242 AAGVLLY 248


>gi|107022620|ref|YP_620947.1| RNA methyltransferase TrmH, group 3 [Burkholderia cenocepacia AU
           1054]
 gi|116689569|ref|YP_835192.1| RNA methyltransferase [Burkholderia cenocepacia HI2424]
 gi|105892809|gb|ABF75974.1| 23S rRNA Gm-2251 2'-O-methyltransferase [Burkholderia cenocepacia
           AU 1054]
 gi|116647658|gb|ABK08299.1| 23S rRNA Gm-2251 2'-O-methyltransferase [Burkholderia cenocepacia
           HI2424]
          Length = 247

 Score =  116 bits (291), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 78/234 (33%), Positives = 121/234 (51%), Gaps = 11/234 (4%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKI----V 105
            LYG H V+A L + +  + ++L  +    R   D    H      V     D+     +
Sbjct: 6   VLYGFHAVTARLRHDASTVAEVLYDQTRRDRRMQD--FLHAAKEAGVRLIAADETRLWGL 63

Query: 106 GKEAVHQGLA--LETAPL---LSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCD 160
                HQG+   +E  PL   LS  LD +    LL+VLD V DPHN+GA LR A +    
Sbjct: 64  AHTERHQGVVARVEDMPLAQNLSELLDGINGPALLLVLDGVTDPHNLGACLRVADSAGAH 123

Query: 161 GIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPL 220
            +I  +  +   +A  AK ASGA + +PYI ++NL  AL+++   G   IG S ++   L
Sbjct: 124 AVIAPRDRAVGLNATAAKVASGAADTVPYITVTNLARALRELKEAGVWIIGTSDEASATL 183

Query: 221 EQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
            +   +  +AL++GAEG+G+R  T++T   +  + M G +++LNVS A+ V LY
Sbjct: 184 YETKLDGPVALVMGAEGEGMRRLTRDTCDEVMSIPMAGSVESLNVSVASGVCLY 237


>gi|123968445|ref|YP_001009303.1| RNA methyltransferase TrmH, group 3 [Prochlorococcus marinus str.
           AS9601]
 gi|123198555|gb|ABM70196.1| RNA methyltransferase TrmH, group 3 [Prochlorococcus marinus str.
           AS9601]
          Length = 335

 Score =  116 bits (291), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 83/276 (30%), Positives = 143/276 (51%), Gaps = 19/276 (6%)

Query: 16  KDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPENL------FLYGVHTVSAALNNPSRKIF 69
           KDS ++ L+R    +K     + K+   +Q  N       +++G H+V  AL++  R I 
Sbjct: 57  KDSTFSSLKRKKPTFKSNIGLHNKNPDINQEFNNKKNFDDWIWGKHSVYEALSSE-RAIN 115

Query: 70  QLLATKNALARLDWDANLPHPFPVKTVPPQTID----KIVGKEAVHQGLALETAPLLSPT 125
           ++  T    +  D    L      K V  + +       +   A HQG+AL+ A   + +
Sbjct: 116 RIWCTSEIFSS-DKFYILLKDLKSKGVLIEEVSWNRLSQLTYGASHQGIALQLACSRTIS 174

Query: 126 LDAVRN-------SQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAK 178
           L+ + +       + +++ LD + DPHN+GAI+RSA AF C GII  +R S   +  +AK
Sbjct: 175 LEQLIDFSRHNCANPIILALDGITDPHNVGAIIRSAEAFDCKGIIIPQRRSAGLTGTVAK 234

Query: 179 SASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGK 238
            A+GALEH+   R+ NL  AL+++   GF  +GLS D +  +   ++   + +I+G+E K
Sbjct: 235 VAAGALEHVQVSRVVNLNRALEELKKNGFIVVGLSGDGQLSISNFLEKAPLVVIVGSEEK 294

Query: 239 GLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
           G+   TQ+    +  + + G   +LN S AAA++L+
Sbjct: 295 GISLLTQKKCDFLLSIPLRGKTSSLNASVAAAISLF 330


>gi|269123132|ref|YP_003305709.1| RNA methyltransferase, TrmH family, group 3 [Streptobacillus
           moniliformis DSM 12112]
 gi|268314458|gb|ACZ00832.1| RNA methyltransferase, TrmH family, group 3 [Streptobacillus
           moniliformis DSM 12112]
          Length = 232

 Score =  116 bits (291), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 50/147 (34%), Positives = 92/147 (62%)

Query: 127 DAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEH 186
           + +++   +++LD + DP N GAI+RS   F   GII   R +   +  + KS++GA+EH
Sbjct: 81  ELMKDESTIVILDQIQDPRNFGAIIRSCECFGVSGIIMQDRNNVKVTETVVKSSTGAIEH 140

Query: 187 IPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQE 246
           +  ++++N+ D+++K+  +G+   G  ++ +K   +E    K AL+LG+EGKG+R + +E
Sbjct: 141 VDIVQVTNIADSIEKLQKYGYFVYGAEANGEKFYYEEKYPKKKALVLGSEGKGMRKRVRE 200

Query: 247 TATSMAHLHMPGIIKALNVSNAAAVAL 273
           +  S+  +H+ G I +LNVS AA + L
Sbjct: 201 SCDSILKIHLKGEINSLNVSVAAGILL 227


>gi|322388153|ref|ZP_08061757.1| 23S rRNA (guanosine-2'-O-)-methyltransferase RlmB [Streptococcus
           infantis ATCC 700779]
 gi|321140825|gb|EFX36326.1| 23S rRNA (guanosine-2'-O-)-methyltransferase RlmB [Streptococcus
           infantis ATCC 700779]
          Length = 242

 Score =  116 bits (290), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 78/247 (31%), Positives = 128/247 (51%), Gaps = 35/247 (14%)

Query: 48  NLFLYGVHTVSAAL-NNPSRKIF-------------QLLATKNALARLDWDANLPHPFPV 93
           N  +YGVH V+ AL  N   K++             + LAT+  ++ + W +        
Sbjct: 4   NDIVYGVHAVTEALLANTGNKLYLQDDLRGKNVEKVKELATEKKVS-ISWTSK------- 55

Query: 94  KTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAV------RNSQLLMVLDHVNDPHNI 147
           K++   T      + AVHQG  L  +      L+ +        + LL++LD + DPHN+
Sbjct: 56  KSLSEMT------EGAVHQGFVLRVSEFAYTELEQILAQTRQEENPLLLILDGLTDPHNL 109

Query: 148 GAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGF 207
           G+ILR+A A +  G+I  K  +   + V+AK+A+GA+EH+P  R++NL+  L K+   GF
Sbjct: 110 GSILRTADATNVSGVIIPKHRAVGVTPVVAKTATGAIEHVPIARVTNLSQTLDKLKEEGF 169

Query: 208 QTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSN 267
            T G   +   P  +   + K+ALI+G EGKG+    ++    M  + M G +++LN S 
Sbjct: 170 WTFGTDMNG-TPCHKWNTSGKVALIIGNEGKGISSNIKKQVDEMITIPMNGHVQSLNASV 228

Query: 268 AAAVALY 274
           AAA+ +Y
Sbjct: 229 AAAILMY 235


>gi|257879805|ref|ZP_05659458.1| RNA methyltransferase TrmH [Enterococcus faecium 1,230,933]
 gi|257882531|ref|ZP_05662184.1| RNA methyltransferase TrmH [Enterococcus faecium 1,231,502]
 gi|257891646|ref|ZP_05671299.1| RNA methyltransferase TrmH [Enterococcus faecium 1,231,410]
 gi|257894123|ref|ZP_05673776.1| RNA methyltransferase TrmH [Enterococcus faecium 1,231,408]
 gi|257814033|gb|EEV42791.1| RNA methyltransferase TrmH [Enterococcus faecium 1,230,933]
 gi|257818189|gb|EEV45517.1| RNA methyltransferase TrmH [Enterococcus faecium 1,231,502]
 gi|257828006|gb|EEV54632.1| RNA methyltransferase TrmH [Enterococcus faecium 1,231,410]
 gi|257830502|gb|EEV57109.1| RNA methyltransferase TrmH [Enterococcus faecium 1,231,408]
          Length = 289

 Score =  116 bits (290), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 75/265 (28%), Positives = 127/265 (47%), Gaps = 12/265 (4%)

Query: 20  YAKLRRNHRDYKKMQSFNQKSRHTSQP--ENLFLYGVHTVSAALNNP-SRKIFQLLATKN 76
           +   ++N    KK    NQ     ++   E+ F++G H    AL      K+F    ++ 
Sbjct: 18  FEDKKQNRYSNKKQTGRNQSVSDQNEEALEDNFVFGHHAAVEALQQGRGNKLFLQEDSRG 77

Query: 77  ALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAV------- 129
                  +       PVK VP Q ++ +     VHQG+ L   P    +LD +       
Sbjct: 78  EKVEELKEIAREQAVPVKWVPKQKLETL-SDHGVHQGVVLAITPYEYLSLDQLIERTKEK 136

Query: 130 RNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPY 189
           +     ++LD + DPHN G+ILR+A A   DG+I  K  +   + ++ K+++GA+EH+P 
Sbjct: 137 KEDPFFLILDSIEDPHNFGSILRTADASGVDGVIIPKHRAVGITPIVTKTSTGAVEHVPV 196

Query: 190 IRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETAT 249
            R++NL  A+Q++   GF   G         +   K   IAL++G EGKG+ P  ++   
Sbjct: 197 ARVTNLVQAVQQLKETGFWVFGTDMTGTNFQKWNAKGS-IALVIGNEGKGMSPGLKKEMD 255

Query: 250 SMAHLHMPGIIKALNVSNAAAVALY 274
            +  + M G +++LN S AA + +Y
Sbjct: 256 ELLTIPMTGHVQSLNASVAAGLLMY 280


>gi|312867923|ref|ZP_07728127.1| RNA methyltransferase, TrmH family, group 3 [Streptococcus
           parasanguinis F0405]
 gi|311096327|gb|EFQ54567.1| RNA methyltransferase, TrmH family, group 3 [Streptococcus
           parasanguinis F0405]
          Length = 242

 Score =  116 bits (290), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 80/241 (33%), Positives = 126/241 (52%), Gaps = 23/241 (9%)

Query: 48  NLFLYGVHTVSAALN-NPSRKIF--QLLATKN-----ALARLDWDANLPHPFPVKTVPPQ 99
           N  +YGVH V+ AL  N   K++  + L  KN     ALA             +   P +
Sbjct: 4   NDIVYGVHAVTEALQANTGNKLYIQEDLRGKNVDKIKALAA-------EKKVSISWTPKK 56

Query: 100 TIDKIVGKEAVHQGLALETAPLLSPTLDAV------RNSQLLMVLDHVNDPHNIGAILRS 153
           T+ ++  + AVHQG  L  A      L A+        + LL++LD + DPHN+G+I+R+
Sbjct: 57  TLQEMT-EGAVHQGFVLRVAAFAYTDLAAILKQTAKEENPLLLILDGLTDPHNLGSIIRT 115

Query: 154 AVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLS 213
           A A +  G+I  K  +   + V++K+++GA+EHIP  R++NL+  L K+   GF   G  
Sbjct: 116 ADATNVSGVIIPKHRAVGVTPVVSKTSTGAVEHIPIARVTNLSQTLDKLKEEGFWIFGTD 175

Query: 214 SDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVAL 273
            +   P  Q     K+ALI+G EGKG+    ++    M  + M G +++LN S AAA+ +
Sbjct: 176 MNG-TPSHQWNTAGKLALIIGNEGKGISANIKKQVDEMITIPMNGHVQSLNASVAAAILM 234

Query: 274 Y 274
           Y
Sbjct: 235 Y 235


>gi|261206630|ref|ZP_05921328.1| RNA methyltransferase TrmH [Enterococcus faecium TC 6]
 gi|289564991|ref|ZP_06445445.1| RNA methyltransferase, TrmH family, group 3 [Enterococcus faecium
           D344SRF]
 gi|294614952|ref|ZP_06694843.1| RNA methyltransferase, TrmH family, group 3 [Enterococcus faecium
           E1636]
 gi|260079123|gb|EEW66816.1| RNA methyltransferase TrmH [Enterococcus faecium TC 6]
 gi|289163198|gb|EFD11044.1| RNA methyltransferase, TrmH family, group 3 [Enterococcus faecium
           D344SRF]
 gi|291592238|gb|EFF23856.1| RNA methyltransferase, TrmH family, group 3 [Enterococcus faecium
           E1636]
          Length = 286

 Score =  116 bits (290), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 75/261 (28%), Positives = 126/261 (48%), Gaps = 12/261 (4%)

Query: 24  RRNHRDYKKMQSFNQKSRHTSQP--ENLFLYGVHTVSAALNNP-SRKIFQLLATKNALAR 80
           ++N    KK    NQ     ++   E+ F++G H    AL      K+F    ++     
Sbjct: 19  KQNRYSNKKQTGRNQSVSDQNEEALEDNFVFGHHAAVEALQQGRGNKLFLQEDSRGEKVE 78

Query: 81  LDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAV-------RNSQ 133
              +       PVK VP Q ++ +     VHQG+ L   P    +LD +       +   
Sbjct: 79  ELKEIAREQAVPVKWVPKQKLETL-SDHGVHQGVVLAITPYEYLSLDQLIERTKEKKEDL 137

Query: 134 LLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRIS 193
             ++LD + DPHN G+ILR+A A   DG+I  K  +   + ++ K+++GA+EH+P  R++
Sbjct: 138 FFLILDSIEDPHNFGSILRTADASGVDGVIIPKHRAVGITPIVTKTSTGAVEHVPVARVT 197

Query: 194 NLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAH 253
           NL  A+Q++   GF   G         +   K   IAL++G EGKG+ P  ++    +  
Sbjct: 198 NLVQAVQQLKETGFWVFGTDMTGTNFQKWNAKGS-IALVIGNEGKGMSPGLKKEMDELLT 256

Query: 254 LHMPGIIKALNVSNAAAVALY 274
           + M G +++LN S AA + +Y
Sbjct: 257 IPMTGHVQSLNASVAAGLLMY 277


>gi|307729459|ref|YP_003906683.1| RNA methyltransferase, TrmH family, group 3 [Burkholderia sp.
           CCGE1003]
 gi|307583994|gb|ADN57392.1| RNA methyltransferase, TrmH family, group 3 [Burkholderia sp.
           CCGE1003]
          Length = 247

 Score =  116 bits (290), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 62/169 (36%), Positives = 98/169 (57%), Gaps = 5/169 (2%)

Query: 111 HQGLALETAPL-----LSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITT 165
           HQG+      L     L+  LD +  S LL+VLD V DPHN+GA LR A A     +I  
Sbjct: 69  HQGVVARAGDLPLAQNLAELLDGINGSPLLLVLDGVTDPHNLGACLRVADAAGAHAVIAP 128

Query: 166 KRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIK 225
           +  +   +A  AK ASGA + +PYI ++NL  AL+++   G   +G S ++ K L +   
Sbjct: 129 RDRAVGLNATAAKVASGAADTVPYITVTNLARALRELKEAGVWIVGTSGEATKSLYETEL 188

Query: 226 NDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
           +  +A+++GAEG+G+R  T++T   +  + M G +++LNVS A+ V L+
Sbjct: 189 DGPVAIVMGAEGEGMRRLTRDTCDVVMQIPMAGTVESLNVSVASGVCLF 237


>gi|148549961|ref|YP_001270063.1| RNA methyltransferase [Pseudomonas putida F1]
 gi|148514019|gb|ABQ80879.1| RNA methyltransferase, TrmH family, group 3 [Pseudomonas putida F1]
          Length = 248

 Score =  116 bits (290), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 78/234 (33%), Positives = 124/234 (52%), Gaps = 12/234 (5%)

Query: 51  LYGVHTVSAALNNPSRKIFQL-LATKNALARLDWDANLP--HPFPVKTVPPQTIDKIVGK 107
           +YGVH V A L +  +++ Q+ L+   +  RL+    L   +  PV     + +D  V  
Sbjct: 7   IYGVHAVQALLQHHPKRVKQIWLSEGRSEPRLETLLALAAENRVPVGQAERREMDAWV-- 64

Query: 108 EAVHQGLALETAP-------LLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCD 160
           E VHQG+  E +P       +L   L+      L++VLD V DPHN+GA LR+A A    
Sbjct: 65  EGVHQGVVAEVSPSQVWGELMLEELLERTETPPLILVLDGVTDPHNLGACLRTADAAGAT 124

Query: 161 GIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPL 220
            +I  K  S + + V+ K A GA E IP + ++NL   L+K+   G   +G + ++++ +
Sbjct: 125 AVIVPKDKSATLTPVVRKVACGAAEVIPLVAVTNLARTLEKLQQRGLWVVGTAGEAEQEI 184

Query: 221 EQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
            Q+     + +I+GAEGKG+R  T+E    +  L M G + +LNVS A  V L+
Sbjct: 185 YQQDLTGPLVMIMGAEGKGMRRLTREHCDFLVKLPMAGSVSSLNVSVATGVCLF 238


>gi|172036714|ref|YP_001803215.1| RNA methyltransferase TrmH, group 3 [Cyanothece sp. ATCC 51142]
 gi|171698168|gb|ACB51149.1| RNA methyltransferase TrmH, group 3 [Cyanothece sp. ATCC 51142]
          Length = 292

 Score =  116 bits (290), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 75/244 (30%), Positives = 124/244 (50%), Gaps = 19/244 (7%)

Query: 45  QPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKI 104
           Q E+  +YG H+V AAL +  R++ ++  T     RL +D    +           ID++
Sbjct: 41  QSEDDLIYGRHSVLAALES-DRQLNRIWITN----RLHYDPRFHNLIQASKAKGAVIDEV 95

Query: 105 -------VGKEAVHQGLALETAPLLSPTLD-------AVRNSQLLMVLDHVNDPHNIGAI 150
                  +   A HQG+A + AP     LD       A  +  ++++ D + DPHN+GAI
Sbjct: 96  SLQRLSQITNGANHQGVAAQVAPYTYHELDELITQAKANSDEPVIVIADGIADPHNLGAI 155

Query: 151 LRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTI 210
           +R+A A  C G+I  +R +   ++ ++K ++GALE  P  R+ NL+ AL+ + + GF   
Sbjct: 156 IRTAEAMGCQGLIIPQRRAAGVTSTVSKVSAGALESFPVARVVNLSRALETLKAEGFWIY 215

Query: 211 GLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAA 270
           G  ++  K L+       I L++G+EG GL   TQ     +  + + G   +LN S AAA
Sbjct: 216 GTVAEGGKRLQDFDFRGAIGLVIGSEGSGLSLLTQRCCDELISIPLEGKTPSLNASVAAA 275

Query: 271 VALY 274
           + LY
Sbjct: 276 INLY 279


>gi|69245491|ref|ZP_00603455.1| RNA methyltransferase TrmH, group 3 [Enterococcus faecium DO]
 gi|258614231|ref|ZP_05712001.1| RNA methyltransferase [Enterococcus faecium DO]
 gi|260559479|ref|ZP_05831660.1| RNA methyltransferase TrmH [Enterococcus faecium C68]
 gi|293564126|ref|ZP_06678532.1| RNA methyltransferase, TrmH family, group 3 [Enterococcus faecium
           E1162]
 gi|293570062|ref|ZP_06681142.1| RNA methyltransferase, TrmH family, group 3 [Enterococcus faecium
           E1071]
 gi|294618280|ref|ZP_06697862.1| RNA methyltransferase, TrmH family, group 3 [Enterococcus faecium
           E1679]
 gi|294623062|ref|ZP_06701949.1| RNA methyltransferase, TrmH family, group 3 [Enterococcus faecium
           U0317]
 gi|314940061|ref|ZP_07847244.1| RNA methyltransferase, TrmH family, group 3 [Enterococcus faecium
           TX0133a04]
 gi|314942532|ref|ZP_07849371.1| RNA methyltransferase, TrmH family, group 3 [Enterococcus faecium
           TX0133C]
 gi|314949362|ref|ZP_07852703.1| RNA methyltransferase, TrmH family, group 3 [Enterococcus faecium
           TX0082]
 gi|314952822|ref|ZP_07855794.1| RNA methyltransferase, TrmH family, group 3 [Enterococcus faecium
           TX0133A]
 gi|314993745|ref|ZP_07859090.1| RNA methyltransferase, TrmH family, group 3 [Enterococcus faecium
           TX0133B]
 gi|314994810|ref|ZP_07859942.1| RNA methyltransferase, TrmH family, group 3 [Enterococcus faecium
           TX0133a01]
 gi|68195742|gb|EAN10179.1| RNA methyltransferase TrmH, group 3 [Enterococcus faecium DO]
 gi|260074578|gb|EEW62899.1| RNA methyltransferase TrmH [Enterococcus faecium C68]
 gi|291587434|gb|EFF19318.1| RNA methyltransferase, TrmH family, group 3 [Enterococcus faecium
           E1071]
 gi|291595496|gb|EFF26807.1| RNA methyltransferase, TrmH family, group 3 [Enterococcus faecium
           E1679]
 gi|291597535|gb|EFF28699.1| RNA methyltransferase, TrmH family, group 3 [Enterococcus faecium
           U0317]
 gi|291604044|gb|EFF33572.1| RNA methyltransferase, TrmH family, group 3 [Enterococcus faecium
           E1162]
 gi|313590994|gb|EFR69839.1| RNA methyltransferase, TrmH family, group 3 [Enterococcus faecium
           TX0133a01]
 gi|313591845|gb|EFR70690.1| RNA methyltransferase, TrmH family, group 3 [Enterococcus faecium
           TX0133B]
 gi|313595056|gb|EFR73901.1| RNA methyltransferase, TrmH family, group 3 [Enterococcus faecium
           TX0133A]
 gi|313598753|gb|EFR77598.1| RNA methyltransferase, TrmH family, group 3 [Enterococcus faecium
           TX0133C]
 gi|313640661|gb|EFS05241.1| RNA methyltransferase, TrmH family, group 3 [Enterococcus faecium
           TX0133a04]
 gi|313644193|gb|EFS08773.1| RNA methyltransferase, TrmH family, group 3 [Enterococcus faecium
           TX0082]
          Length = 286

 Score =  116 bits (290), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 75/265 (28%), Positives = 127/265 (47%), Gaps = 12/265 (4%)

Query: 20  YAKLRRNHRDYKKMQSFNQKSRHTSQP--ENLFLYGVHTVSAALNNP-SRKIFQLLATKN 76
           +   ++N    KK    NQ     ++   E+ F++G H    AL      K+F    ++ 
Sbjct: 15  FEDKKQNRYSNKKQTGRNQSVSDQNEEALEDNFVFGHHAAVEALQQGRGNKLFLQEDSRG 74

Query: 77  ALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAV------- 129
                  +       PVK VP Q ++ +     VHQG+ L   P    +LD +       
Sbjct: 75  EKVEELKEIAREQAVPVKWVPKQKLETL-SDHGVHQGVVLAITPYEYLSLDQLIERTKEK 133

Query: 130 RNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPY 189
           +     ++LD + DPHN G+ILR+A A   DG+I  K  +   + ++ K+++GA+EH+P 
Sbjct: 134 KEDPFFLILDSIEDPHNFGSILRTADASGVDGVIIPKHRAVGITPIVTKTSTGAVEHVPV 193

Query: 190 IRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETAT 249
            R++NL  A+Q++   GF   G         +   K   IAL++G EGKG+ P  ++   
Sbjct: 194 ARVTNLVQAVQQLKETGFWVFGTDMTGTNFQKWNAKGS-IALVIGNEGKGMSPGLKKEMD 252

Query: 250 SMAHLHMPGIIKALNVSNAAAVALY 274
            +  + M G +++LN S AA + +Y
Sbjct: 253 ELLTIPMTGHVQSLNASVAAGLLMY 277


>gi|94989283|ref|YP_597384.1| 23S rRNA Gm2251 methyltransferase [Streptococcus pyogenes MGAS9429]
 gi|94993172|ref|YP_601271.1| 23S rRNA Gm2251 methyltransferase [Streptococcus pyogenes MGAS2096]
 gi|94542791|gb|ABF32840.1| 23S rRNA Gm2251 methyltransferase [Streptococcus pyogenes MGAS9429]
 gi|94546680|gb|ABF36727.1| 23S rRNA Gm2251 methyltransferase [Streptococcus pyogenes MGAS2096]
          Length = 257

 Score =  116 bits (290), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 79/247 (31%), Positives = 127/247 (51%), Gaps = 35/247 (14%)

Query: 48  NLFLYGVHTVSAALN-NPSRKIF-------------QLLATKNALARLDWDANLPHPFPV 93
           N  +YGVH V+ +L  N   K++             + LAT+  +A + W        P 
Sbjct: 19  NDIVYGVHAVTESLQANTGNKLYIQEDLRGKKVDNIKSLATQKKVA-ISWT-------PK 70

Query: 94  KTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAV------RNSQLLMVLDHVNDPHNI 147
           KT+   T        AVHQG  L  +      +D +        + L+++LD + DPHN+
Sbjct: 71  KTLSQMT------DGAVHQGFVLRVSAFAYTDVDEILEIAEQEANPLILILDGLTDPHNL 124

Query: 148 GAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGF 207
           G+ILR+A A +  G+I  K  S   + V++K+++GA+EHIP  R++NL+  L K+ S GF
Sbjct: 125 GSILRTADATNVCGVIIPKHRSVGVTPVVSKTSTGAVEHIPIARVTNLSQTLDKLKSRGF 184

Query: 208 QTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSN 267
              G   +   P +    N K+AL++G EGKG+    ++    M  + M G +++LN S 
Sbjct: 185 WIFGTDMNG-TPSDCWNTNGKLALVIGNEGKGISTNIKKQVDEMITIPMNGHVQSLNASV 243

Query: 268 AAAVALY 274
           AAA+ +Y
Sbjct: 244 AAAILMY 250


>gi|113868323|ref|YP_726812.1| rRNA methylase [Ralstonia eutropha H16]
 gi|113527099|emb|CAJ93444.1| rRNA methylase [Ralstonia eutropha H16]
          Length = 247

 Score =  116 bits (290), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 75/236 (31%), Positives = 119/236 (50%), Gaps = 9/236 (3%)

Query: 47  ENLFLYGVHTVSAALNNPSRKIFQL-LATKNALARLDWDANLPHPFPVKT--VPPQTIDK 103
           +N  L G H V+A L   ++ +  + + +     R+     L     V+   V  + +  
Sbjct: 3   KNKLLIGFHAVTARLRQDAKGVTDVYIESARRDRRMQDFVRLAESLGVRLHPVDAERLRG 62

Query: 104 IVGKEAVHQGLALETAPL-----LSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFS 158
           + G +  HQG+      +     L   LD +  + LL+VLD V DPHN+GA LR A    
Sbjct: 63  MAGTDR-HQGVVARAEDVALALNLDELLDGIEGTPLLLVLDGVTDPHNLGACLRVADGAG 121

Query: 159 CDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKK 218
              +I  K  S   +A +AK ASGA E +PYI ++NL   L+++   G   IG +  ++K
Sbjct: 122 AHAVIAPKDRSVGLNATVAKVASGAAETVPYITVTNLARTLRELQERGIWVIGTADGTEK 181

Query: 219 PLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
            L         A+++GAEG+G+R  T+ET   +  + M G +++LNVS A+ V LY
Sbjct: 182 SLYDIDFKGPTAIVMGAEGEGMRRLTRETCDELVGIPMAGGVESLNVSVASGVCLY 237


>gi|306826620|ref|ZP_07459925.1| RNA methyltransferase [Streptococcus pyogenes ATCC 10782]
 gi|304431198|gb|EFM34202.1| RNA methyltransferase [Streptococcus pyogenes ATCC 10782]
          Length = 248

 Score =  116 bits (290), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 79/247 (31%), Positives = 127/247 (51%), Gaps = 35/247 (14%)

Query: 48  NLFLYGVHTVSAALN-NPSRKIF-------------QLLATKNALARLDWDANLPHPFPV 93
           N  +YGVH V+ +L  N   K++             + LAT+  +A + W        P 
Sbjct: 10  NDIVYGVHAVTESLQANTGNKLYIQEDLRGKKVDNIKSLATQKKVA-ISWT-------PK 61

Query: 94  KTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAV------RNSQLLMVLDHVNDPHNI 147
           KT+   T        AVHQG  L  +      +D +        + L+++LD + DPHN+
Sbjct: 62  KTLSQMT------DGAVHQGFVLRVSAFAYTDVDEILEIAEQEANPLILILDGLTDPHNL 115

Query: 148 GAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGF 207
           G+ILR+A A +  G+I  K  S   + V++K+++GA+EHIP  R++NL+  L K+ S GF
Sbjct: 116 GSILRTADATNVCGVIIPKHRSVGVTPVVSKTSTGAVEHIPIARVTNLSQTLDKLKSRGF 175

Query: 208 QTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSN 267
              G   +   P +    N K+AL++G EGKG+    ++    M  + M G +++LN S 
Sbjct: 176 WIFGTDMNG-TPSDCWNTNGKLALVIGNEGKGISTNIKKQVDEMITIPMNGHVQSLNASV 234

Query: 268 AAAVALY 274
           AAA+ +Y
Sbjct: 235 AAAILMY 241


>gi|26991558|ref|NP_746983.1| RNA methyltransferase [Pseudomonas putida KT2440]
 gi|52783313|sp|Q88DE7|RLMB_PSEPK RecName: Full=23S rRNA (guanosine-2'-O-)-methyltransferase RlmB;
           AltName: Full=23S rRNA Gm2251 2'-O-methyltransferase
 gi|24986644|gb|AAN70447.1|AE016686_1 RNA methyltransferase, TrmH family, group 3 [Pseudomonas putida
           KT2440]
          Length = 248

 Score =  116 bits (290), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 78/234 (33%), Positives = 124/234 (52%), Gaps = 12/234 (5%)

Query: 51  LYGVHTVSAALNNPSRKIFQL-LATKNALARLDWDANLP--HPFPVKTVPPQTIDKIVGK 107
           +YGVH V A L +  +++ Q+ L+   +  RL+    L   +  PV     + +D  V  
Sbjct: 7   IYGVHAVQALLQHHPKRVKQIWLSEGRSEPRLETLLALAAENRVPVGQAERREMDAWV-- 64

Query: 108 EAVHQGLALETAP-------LLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCD 160
           E VHQG+  E +P       +L   L+      L++VLD V DPHN+GA LR+A A    
Sbjct: 65  EGVHQGVVAEVSPSQVWGELMLEELLERTETPPLILVLDGVTDPHNLGACLRTADAAGAT 124

Query: 161 GIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPL 220
            +I  K  S + + V+ K A GA E IP + ++NL   L+K+   G   +G + ++++ +
Sbjct: 125 AVIVPKDKSATLTPVVRKVACGAAEVIPLVAVTNLARTLEKLQQRGLWVVGTAGEAEQEI 184

Query: 221 EQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
            Q+     + +I+GAEGKG+R  T+E    +  L M G + +LNVS A  V L+
Sbjct: 185 YQQDLTGPLVMIMGAEGKGMRRLTREHCDFLVKLPMAGSVSSLNVSVATGVCLF 238


>gi|197122685|ref|YP_002134636.1| RNA methyltransferase, TrmH family, group 3 [Anaeromyxobacter sp.
           K]
 gi|196172534|gb|ACG73507.1| RNA methyltransferase, TrmH family, group 3 [Anaeromyxobacter sp.
           K]
          Length = 256

 Score =  116 bits (290), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 65/189 (34%), Positives = 109/189 (57%), Gaps = 8/189 (4%)

Query: 93  VKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTL-DAVRNSQ------LLMVLDHVNDPH 145
           V+  P   +D++ G +  HQG+    A      L D +  +Q      LL+VLD V DPH
Sbjct: 50  VRGAPRAKLDRLAGTDR-HQGVVAVVADFRYAELEDLLARAQAGGRPPLLVVLDGVEDPH 108

Query: 146 NIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSW 205
           N+GAI+RSA A    G++  +  +   +  +AK+++GA+E  P  R++N+   L+++   
Sbjct: 109 NLGAIIRSAHALGAHGVVIPRDRAVGVTPAVAKASAGAVERCPVARVTNVAKTLERLKEA 168

Query: 206 GFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNV 265
           G  ++ L++D ++PL +       AL+LG+EG+G+RP  + T    A + M G + +L+V
Sbjct: 169 GIWSVALAADGERPLGEADLKGPTALVLGSEGEGIRPLVRRTCDLSARIPMSGDLDSLSV 228

Query: 266 SNAAAVALY 274
           S +AAVALY
Sbjct: 229 SASAAVALY 237


>gi|241888871|ref|ZP_04776177.1| RNA methyltransferase, TrmH family, group 3 [Gemella haemolysans
           ATCC 10379]
 gi|241864547|gb|EER68923.1| RNA methyltransferase, TrmH family, group 3 [Gemella haemolysans
           ATCC 10379]
          Length = 271

 Score =  115 bits (289), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 82/267 (30%), Positives = 138/267 (51%), Gaps = 18/267 (6%)

Query: 23  LRRNHRDYKKMQSFNQKSRHTSQ-PE----NLFLYGVHTVSAALNNP---SRKIFQLLAT 74
           +++N++ YK+++  N++ +   Q PE       + G + +  A+ +    ++ +FQ    
Sbjct: 1   MKKNNKHYKELRLKNKEQKPQVQTPEVDLDKEVIAGRNAILEAIKSGREINKILFQEGIE 60

Query: 75  KNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNS-- 132
           K  L  +   AN       + VP + +D    +   HQG+    AP     LD V N+  
Sbjct: 61  KGRLKSIFAIAN-EKKIICQEVPKRKLDNSTTER--HQGVIAYVAPYSYFELDEVVNNLE 117

Query: 133 ----QLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIP 188
                 L++LDH+ DPHN+GAI+R+A A     II  KR +   S    K+++GA+EH+P
Sbjct: 118 INKDTTLLILDHIEDPHNLGAIIRTAEASGVKAIIIPKRRAAVVSQTAVKASAGAIEHMP 177

Query: 189 YIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKND-KIALILGAEGKGLRPKTQET 247
            IR+SNLTDA++K+   GF   G +   +     +I  D  +A+++G EG+G+       
Sbjct: 178 VIRVSNLTDAIKKLKEKGFWIAGTTLAERSEDYTKIAKDVPLAIVIGNEGEGMSKVVTNE 237

Query: 248 ATSMAHLHMPGIIKALNVSNAAAVALY 274
              + HL M G I++LN S AA + +Y
Sbjct: 238 CDFLYHLPMLGKIQSLNASVAAGIIMY 264


>gi|197334845|ref|YP_002157109.1| RNA methyltransferase, TrmH family, group 3 [Vibrio fischeri MJ11]
 gi|197316335|gb|ACH65782.1| RNA methyltransferase, TrmH family, group 3 [Vibrio fischeri MJ11]
          Length = 247

 Score =  115 bits (289), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 77/244 (31%), Positives = 128/244 (52%), Gaps = 26/244 (10%)

Query: 48  NLFLYGVHTVSAALN-NPSR--KIF--------QLLATKNALARLDWDANLPHPFPVKTV 96
           N +++G+H   A L  +P+R  ++F        +LL   N L +L         F ++ +
Sbjct: 3   NDYIFGIHAAKAVLERDPARFIEVFVLKGRQDDRLLPILNELTQLG--------FKIQEL 54

Query: 97  PPQTIDKIVGKEAVHQGLALETAP---LLSPTLDAV---RNSQLLMVLDHVNDPHNIGAI 150
           P +T+D    K A HQG+     P   L    LD +    ++ LL+VLD V DPHN+GA 
Sbjct: 55  PRKTLDD-KAKGANHQGIIARVTPAKQLNEHDLDDIVSQTDNPLLLVLDGVTDPHNLGAC 113

Query: 151 LRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTI 210
           LR+A A     +I  K  S S +A ++K A GA E +P +R++NL   ++ +   G   +
Sbjct: 114 LRNADAAGVAAVIVPKDKSASMTATVSKVACGAAETVPLVRVTNLARTMRALQEKGVWFV 173

Query: 211 GLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAA 270
           G + ++   + Q      +A+++GAEG G+R  T+ET   +  + M G + +LNVS A+ 
Sbjct: 174 GTAGEATHDVFQSKLTGPLAIVMGAEGDGMRRLTRETCDDLIKIPMAGSVSSLNVSVASG 233

Query: 271 VALY 274
           + L+
Sbjct: 234 ICLF 237


>gi|332995266|gb|AEF05321.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Alteromonas sp. SN2]
          Length = 245

 Score =  115 bits (289), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 78/236 (33%), Positives = 121/236 (51%), Gaps = 14/236 (5%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLATKNA-LARLDWDANLPHPFPVKTVPPQT---IDKIV 105
           +LYG+H + + L     ++ +++  K     RL    N    F +     Q     DK+ 
Sbjct: 6   WLYGLHAMQSVLEQEPERVMEVMVLKGRNDERLTNIVNQARRFGISVQFCQRKALDDKVN 65

Query: 106 GKEAVHQGLALETAP---LLSPTLDAVRNSQ---LLMVLDHVNDPHNIGAILRSAVAFSC 159
           G++  HQG+     P   +    LD + + +   LL+VLD + DPHN+GA LR+A     
Sbjct: 66  GEQ--HQGVVARAKPARVMDEADLDRILDKESKPLLLVLDGITDPHNLGACLRTADGAGV 123

Query: 160 DGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKP 219
             ++  K  S S +  + K A GA E IP I+++NL   L+ +   G   +G + ++ K 
Sbjct: 124 HAVVVPKDKSASLNGTVRKVACGAAEVIPLIQVTNLARTLKHLQDKGLWIVGTAGETDKT 183

Query: 220 LEQEIKNDK-IALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
           L  +IK D   AL++GAEGKG+R  T+ET   +  L M G + +LNVS A  V LY
Sbjct: 184 L-YDIKLDGPTALVMGAEGKGMRRLTKETCDELVKLPMAGSVSSLNVSVATGVCLY 238


>gi|257886070|ref|ZP_05665723.1| RNA methyltransferase TrmH [Enterococcus faecium 1,231,501]
 gi|257821926|gb|EEV49056.1| RNA methyltransferase TrmH [Enterococcus faecium 1,231,501]
          Length = 286

 Score =  115 bits (289), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 75/265 (28%), Positives = 127/265 (47%), Gaps = 12/265 (4%)

Query: 20  YAKLRRNHRDYKKMQSFNQKSRHTSQP--ENLFLYGVHTVSAALNNP-SRKIFQLLATKN 76
           +   ++N    KK    NQ     ++   E+ F++G H    AL      K+F    ++ 
Sbjct: 15  FEDKKQNRYPNKKQTGRNQSVSDQNEEALEDNFVFGHHVAVEALQQGRGNKLFLQEDSRG 74

Query: 77  ALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAV------- 129
                  +       PVK VP Q ++ +     VHQG+ L   P    +LD +       
Sbjct: 75  EKVEELKEIAREQAVPVKWVPKQKLETL-SDHGVHQGVVLAITPYEYLSLDQLIERTKEK 133

Query: 130 RNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPY 189
           +     ++LD + DPHN G+ILR+A A   DG+I  K  +   + ++ K+++GA+EH+P 
Sbjct: 134 KEDPFFLILDSIEDPHNFGSILRTADASGVDGVIIPKHRAVGITPIVTKTSTGAVEHVPV 193

Query: 190 IRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETAT 249
            R++NL  A+Q++   GF   G         +   K   IAL++G EGKG+ P  ++   
Sbjct: 194 ARVTNLVQAVQQLKETGFWVFGTDMTGTNFQKWNAKGS-IALVIGNEGKGMSPGLKKEMD 252

Query: 250 SMAHLHMPGIIKALNVSNAAAVALY 274
            +  + M G +++LN S AA + +Y
Sbjct: 253 ELLTIPMTGHVQSLNASVAAGLLMY 277


>gi|167035924|ref|YP_001671155.1| RNA methyltransferase [Pseudomonas putida GB-1]
 gi|166862412|gb|ABZ00820.1| RNA methyltransferase, TrmH family, group 3 [Pseudomonas putida
           GB-1]
          Length = 248

 Score =  115 bits (289), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 78/234 (33%), Positives = 124/234 (52%), Gaps = 12/234 (5%)

Query: 51  LYGVHTVSAALNNPSRKIFQL-LATKNALARLDWDANLP--HPFPVKTVPPQTIDKIVGK 107
           +YGVH V A L +  +++ Q+ L+   +  RL+    L   +  PV     + +D  V  
Sbjct: 7   IYGVHAVQALLQHHPKRVKQIWLSEGRSEPRLETLLALAAENRVPVGQAERRELDAWV-- 64

Query: 108 EAVHQGLALETAP-------LLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCD 160
           E VHQG+  E +P       +L   L+      L++VLD V DPHN+GA LR+A A    
Sbjct: 65  EGVHQGVVAEVSPSQVWGELMLEELLERTETPPLILVLDGVTDPHNLGACLRTADAAGAT 124

Query: 161 GIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPL 220
            +I  K  S + + V+ K A GA E IP + ++NL   L+K+   G   +G + ++++ +
Sbjct: 125 AVIVPKDKSATLTPVVRKVACGAAEVIPLVAVTNLARTLEKLQQRGLWVVGTAGEAEQEI 184

Query: 221 EQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
            Q+     + +I+GAEGKG+R  T+E    +  L M G + +LNVS A  V L+
Sbjct: 185 YQQDLTGPLVVIMGAEGKGMRRLTREHCDFLVKLPMAGSVSSLNVSVATGVCLF 238


>gi|170732873|ref|YP_001764820.1| RNA methyltransferase [Burkholderia cenocepacia MC0-3]
 gi|169816115|gb|ACA90698.1| RNA methyltransferase, TrmH family, group 3 [Burkholderia
           cenocepacia MC0-3]
          Length = 247

 Score =  115 bits (289), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 78/234 (33%), Positives = 121/234 (51%), Gaps = 11/234 (4%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKI----V 105
            LYG H V+A L + +  + ++L  +    R   D    H      V     D+     +
Sbjct: 6   VLYGFHAVTARLRHDASTVAEVLYDQTRRDRRMQD--FLHAAKEAGVRLIAADETRLWGL 63

Query: 106 GKEAVHQGLA--LETAPL---LSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCD 160
                HQG+   +E  PL   LS  LD +    LL+VLD V DPHN+GA LR A +    
Sbjct: 64  AHTERHQGVVARVEDMPLAQNLSELLDGINGPALLLVLDGVTDPHNLGACLRVADSAGAH 123

Query: 161 GIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPL 220
            +I  +  +   +A  AK ASGA + +PYI ++NL  AL+++   G   IG S ++   L
Sbjct: 124 AVIAPRDRAVGLNATAAKVASGAADTVPYITVTNLARALRELKEAGVWIIGTSDEAPATL 183

Query: 221 EQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
            +   +  +AL++GAEG+G+R  T++T   +  + M G +++LNVS A+ V LY
Sbjct: 184 YETKLDGPVALVMGAEGEGMRRLTRDTCDEVMSIPMAGSVESLNVSVASGVCLY 237


>gi|308271789|emb|CBX28397.1| Putative trmH family tRNA/rRNA methyltransferase yacO [uncultured
           Desulfobacterium sp.]
          Length = 270

 Score =  115 bits (289), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 76/256 (29%), Positives = 137/256 (53%), Gaps = 15/256 (5%)

Query: 28  RDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATK---NALARLDWD 84
           R++K ++    KSR       + LYG+H V  A+    RK++++   K   + L R    
Sbjct: 3   RNFKSLE----KSRLEMDKSEI-LYGIHPVFEAVRAGRRKVYEIYIAKQKDSTLLRNISK 57

Query: 85  ANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETA--PLLS--PTLDAV--RNSQLLMVL 138
              P   P+ +V P  + KI G +   Q +A + +  PL++    L+++  +N   L++L
Sbjct: 58  LAEPAKIPLISVKPDHLTKITGSD-FQQNIAAKVSEYPLIAFEDILNSITQKNYDFLLLL 116

Query: 139 DHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDA 198
           D V DP N+GA+ R+A+     GI+ TK  S S +  ++K+++GALEHI   +++N+  +
Sbjct: 117 DTVVDPQNLGALARTALCAGVSGIVITKDRSASPTPAVSKASAGALEHIFLSKVTNMVSS 176

Query: 199 LQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPG 258
           +++M   G   +G+ + +  P+        IAL++G+EGKG+R   +     +  +   G
Sbjct: 177 IKEMKDRGIWVVGMDAMADMPVFSCDLKGPIALVIGSEGKGIRQLVKANCDFLVSIPQKG 236

Query: 259 IIKALNVSNAAAVALY 274
            + +LN S A AVA+Y
Sbjct: 237 EVSSLNASAAGAVAMY 252


>gi|38234534|ref|NP_940301.1| SpoU rRNA methylase family protein [Corynebacterium diphtheriae
           NCTC 13129]
 gi|38200797|emb|CAE50501.1| SpoU rRNA Methylase family protein [Corynebacterium diphtheriae]
          Length = 313

 Score =  115 bits (289), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 73/266 (27%), Positives = 135/266 (50%), Gaps = 15/266 (5%)

Query: 21  AKLRRNHRDYKKMQSFNQK--SRHTSQPENLFLYGVHTVSAALNN--PSRKIFQLLATKN 76
           A+ R  H  YKK     ++   RH  +  +  + G + V   L+   P+  ++ +  TKN
Sbjct: 40  AEDREYHAAYKKKMERKRRDQGRHVKEETSELVVGRNPVVECLHAKVPATTLYIVEGTKN 99

Query: 77  ALARLDWDANLPHP--FPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPT-------LD 127
              RL     + H    P+  VP   +D + G   +HQG+ L+  P    T       ++
Sbjct: 100 D-NRLSEAVQIAHSRGIPMIEVPRHEMDLMTGN-GMHQGIGLQIPPYKYTTVFDLIGRIN 157

Query: 128 AVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHI 187
           +     +++VLD++ DP N+GA++RS  AF   G++  +R S S +AV  ++++G    +
Sbjct: 158 STGEDGMVVVLDNITDPRNLGAVIRSVAAFGGHGVVIPERRSASVTAVAWRTSAGTAARL 217

Query: 188 PYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQET 247
           P  + +N+T A+Q+    G+Q +GL +     L+    +  + +++G+EGKG+    ++ 
Sbjct: 218 PVAKATNITRAVQEFQQNGYQVVGLDAGGDATLDNYDGSGPVVIVVGSEGKGISRLVRDN 277

Query: 248 ATSMAHLHMPGIIKALNVSNAAAVAL 273
             S+  + M G +++LN S AA V L
Sbjct: 278 CDSLMSIPMAGWVESLNASVAAGVVL 303


>gi|296877290|ref|ZP_06901330.1| RNA methyltransferase [Streptococcus parasanguinis ATCC 15912]
 gi|296431810|gb|EFH17617.1| RNA methyltransferase [Streptococcus parasanguinis ATCC 15912]
          Length = 242

 Score =  115 bits (289), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 80/241 (33%), Positives = 125/241 (51%), Gaps = 23/241 (9%)

Query: 48  NLFLYGVHTVSAALN-NPSRKIF--QLLATKN-----ALARLDWDANLPHPFPVKTVPPQ 99
           N  +YGVH V+ AL  N   K++  + L  KN     ALA             +   P +
Sbjct: 4   NDIVYGVHAVTEALQANTGNKLYIQEDLRGKNVDKIKALAA-------EKKVSISWTPKK 56

Query: 100 TIDKIVGKEAVHQGLALETAPLLSPTLDAV------RNSQLLMVLDHVNDPHNIGAILRS 153
           T+ ++  + AVHQG  L  A      L  +        + LL++LD + DPHN+G+ILR+
Sbjct: 57  TLQEMT-EGAVHQGFVLRVAAFAYTDLAVILKQTVQEENPLLLILDGLTDPHNLGSILRT 115

Query: 154 AVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLS 213
           A A +  G+I  K  +   + V++K+++GA+EHIP  R++NL+  L K+   GF   G  
Sbjct: 116 ADATNVSGVIIPKHRAVGVTPVVSKTSTGAVEHIPIARVTNLSQTLDKLKEEGFWIFGTD 175

Query: 214 SDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVAL 273
            +   P  Q     K+ALI+G EGKG+    ++    M  + M G +++LN S AAA+ +
Sbjct: 176 MNG-TPSHQWNTAGKLALIIGNEGKGISANIKKQVDEMITIPMNGHVQSLNASVAAAILM 234

Query: 274 Y 274
           Y
Sbjct: 235 Y 235


>gi|298484907|ref|ZP_07003006.1| 23S rRNA (guanosine-2'-O-) -methyltransferase rlmB [Pseudomonas
           savastanoi pv. savastanoi NCPPB 3335]
 gi|298160594|gb|EFI01616.1| 23S rRNA (guanosine-2'-O-) -methyltransferase rlmB [Pseudomonas
           savastanoi pv. savastanoi NCPPB 3335]
          Length = 253

 Score =  115 bits (289), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 79/232 (34%), Positives = 115/232 (49%), Gaps = 8/232 (3%)

Query: 51  LYGVHTVSAAL-NNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEA 109
           +YGVH V A L ++P R     LA      R+     L     V     +  +     E 
Sbjct: 7   IYGVHAVEALLRHHPKRVKHIWLAEGRNDPRVQTLVALAGENRVTIGQAERREMDAWVEG 66

Query: 110 VHQGLALETAP-------LLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGI 162
           VHQG+  + +P       +L   LD    S LL+VLD V DPHN+GA LR+A A     +
Sbjct: 67  VHQGVVADVSPSQVWGEAMLDELLDRSEGSPLLLVLDGVTDPHNLGACLRTADAAGALAV 126

Query: 163 ITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQ 222
           I  K  S + +  + K A GA E IP + ++NL  AL+K+   G   +G + +++  L Q
Sbjct: 127 IVPKDKSATLTPAVRKVACGAAEVIPLVAVTNLARALEKLQQRGLWVVGTAGEAEVELYQ 186

Query: 223 EIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
           +       +I+GAEGKG+R  T+E    +  L M G + +LNVS A  V L+
Sbjct: 187 QDLTGPTIIIMGAEGKGMRRLTREHCDYLVRLPMAGSVSSLNVSVATGVCLF 238


>gi|293553641|ref|ZP_06674265.1| RNA methyltransferase, TrmH family, group 3 [Enterococcus faecium
           E1039]
 gi|291602216|gb|EFF32444.1| RNA methyltransferase, TrmH family, group 3 [Enterococcus faecium
           E1039]
          Length = 286

 Score =  115 bits (289), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 75/265 (28%), Positives = 127/265 (47%), Gaps = 12/265 (4%)

Query: 20  YAKLRRNHRDYKKMQSFNQKSRHTSQP--ENLFLYGVHTVSAALNNP-SRKIFQLLATKN 76
           +   ++N    KK    NQ     ++   E+ F++G H    AL      K+F    ++ 
Sbjct: 15  FEDKKQNRYPNKKQTGRNQSVSDQNEEALEDNFVFGHHAAVEALQQGRGNKLFLQEDSRG 74

Query: 77  ALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAV------- 129
                  +       PVK VP Q ++ +     VHQG+ L   P    +LD +       
Sbjct: 75  EKVEELKEIAREQAVPVKWVPKQKLETL-SDHGVHQGVVLAITPYEYLSLDQLIERTKEK 133

Query: 130 RNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPY 189
           +     ++LD + DPHN G+ILR+A A   DG+I  K  +   + ++ K+++GA+EH+P 
Sbjct: 134 KEDPFFLILDSIEDPHNFGSILRTADASGVDGVIIPKHRAVGITPIVTKTSTGAVEHVPV 193

Query: 190 IRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETAT 249
            R++NL  A+Q++   GF   G         +   K   IAL++G EGKG+ P  ++   
Sbjct: 194 ARVTNLVQAVQQLKETGFWVFGTDMTGTNFQKWNAKGS-IALVIGNEGKGMSPGLKKEMD 252

Query: 250 SMAHLHMPGIIKALNVSNAAAVALY 274
            +  + M G +++LN S AA + +Y
Sbjct: 253 ELLTIPMTGHVQSLNASVAAGLLMY 277


>gi|114778983|ref|ZP_01453770.1| RNA methyltransferase, TrmH family, group 3 [Mariprofundus
           ferrooxydans PV-1]
 gi|114550782|gb|EAU53352.1| RNA methyltransferase, TrmH family, group 3 [Mariprofundus
           ferrooxydans PV-1]
          Length = 247

 Score =  115 bits (289), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 66/201 (32%), Positives = 112/201 (55%), Gaps = 16/201 (7%)

Query: 75  KNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQL 134
           K ALARL     +PH   V  +       +   EA  + + +ETAP++            
Sbjct: 53  KEALARLA--EGVPHQGVVAKMVAAGAQAVPTFEAWLKTVDMETAPMV------------ 98

Query: 135 LMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPS-ESAVLAKSASGALEHIPYIRIS 193
            ++LD V DPHN+GA +R+A A  C  +I  K ++    S V+AK+A GAL  +P +R+ 
Sbjct: 99  -LLLDQVTDPHNLGACVRTAEAAGCAAVIVLKDHAADVHSPVVAKAACGALSRLPVLRVI 157

Query: 194 NLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAH 253
           N+   ++++   GF T+GL+ +++  +     +   A+++G+E KG+R   +ET   + H
Sbjct: 158 NMKRCIEQLQQQGFWTVGLAGEAELSIYDAKLSGATAVVMGSEDKGVRRLVRETCDQLIH 217

Query: 254 LHMPGIIKALNVSNAAAVALY 274
           + MPG++++LNVS A  VAL+
Sbjct: 218 IPMPGVVESLNVSVATGVALF 238


>gi|329914600|ref|ZP_08276137.1| 23S rRNA (guanosine-2'-O-) -methyltransferase rlmB
           [Oxalobacteraceae bacterium IMCC9480]
 gi|327545100|gb|EGF30394.1| 23S rRNA (guanosine-2'-O-) -methyltransferase rlmB
           [Oxalobacteraceae bacterium IMCC9480]
          Length = 242

 Score =  115 bits (288), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 75/233 (32%), Positives = 119/233 (51%), Gaps = 9/233 (3%)

Query: 50  FLYGVHTVSAALNNPSRKIFQL-LATKNALARLDWDANLPHPFPVKTVPP--QTIDKIVG 106
            ++G H V+A L + +  + ++ + T     R+           V+ +    Q +  +VG
Sbjct: 1   MIFGFHAVTARLRHEASTVEEIYVDTARHDQRMKDMLKAAAAVKVRVIQADDQRLSNMVG 60

Query: 107 KEAVHQGLALETAPL-----LSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDG 161
               HQG+  +   +     L   LDA+    LL+VLD + DPHN+GA LR A       
Sbjct: 61  TRR-HQGVVAKAGEVSLARNLDELLDAIDGPPLLLVLDGITDPHNLGACLRVADGAGAHA 119

Query: 162 IITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLE 221
           +I  K  +   +A  AK ASGA E +PYI ++NL   L+ +   G   IG + D+++ L 
Sbjct: 120 VIAPKDRAVGLNATAAKVASGAAESVPYITVTNLARTLRDLKDRGIWLIGTTEDAEQTLY 179

Query: 222 QEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
           Q       ALI+G+EG+G+R  T ET   + H+ M G +++LNVS A+ V L+
Sbjct: 180 QGDFTGPTALIMGSEGEGMRRLTTETCDFLVHIPMFGAVESLNVSVASGVCLF 232


>gi|327472394|gb|EGF17825.1| 23S rRNA (guanosine-2'-O-)-methyltransferase RlmB [Streptococcus
           sanguinis SK408]
          Length = 242

 Score =  115 bits (288), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 75/235 (31%), Positives = 121/235 (51%), Gaps = 9/235 (3%)

Query: 47  ENLFLYGVHTVSAALN-NPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIV 105
           +N  +YGVH V+ AL  N   K++     +        D        +   P +T+ ++ 
Sbjct: 3   KNDIVYGVHAVTEALAANTGNKLYIQDDLRGKKVDKIKDLAAEKKVSISWTPKKTLQEMT 62

Query: 106 GKEAVHQGLALETAPLLSPTLDAV------RNSQLLMVLDHVNDPHNIGAILRSAVAFSC 159
              AVHQG  L  A       +A+       ++ LL++LD + DPHN+G+ILR+A A + 
Sbjct: 63  -DGAVHQGFVLRVAEFAYTDFEALLKKAEQEDNPLLLILDGLTDPHNLGSILRTADATNV 121

Query: 160 DGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKP 219
            G+I  K  +   + V+AK+++GA+EHIP  R++NL+  L K+   GF   G       P
Sbjct: 122 AGVIIPKHRAVGVTPVVAKTSTGAVEHIPIARVTNLSQTLDKLKEAGFWIFGTDMQG-TP 180

Query: 220 LEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
             +     K+ALI+G EGKG+    ++    M  + M G +++LN S AAA+ +Y
Sbjct: 181 SHKWNTTGKLALIIGNEGKGISSNIKKQVDEMISIPMNGHVQSLNASVAAAILMY 235


>gi|332359265|gb|EGJ37086.1| tRNA (guanosine-2'-O-)-methyltransferase [Streptococcus sanguinis
           SK49]
          Length = 242

 Score =  115 bits (288), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 75/235 (31%), Positives = 121/235 (51%), Gaps = 9/235 (3%)

Query: 47  ENLFLYGVHTVSAALN-NPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIV 105
           +N  +YGVH V+ AL  N   K++     +        D        +   P +T+ ++ 
Sbjct: 3   KNDIVYGVHAVTEALAANTGNKLYIQDDLRGKKVDKIKDLAAEKKVSISWTPKKTLQEMT 62

Query: 106 GKEAVHQGLALETAPLLSPTLDAV------RNSQLLMVLDHVNDPHNIGAILRSAVAFSC 159
              AVHQG  L  A       +A+       ++ LL++LD + DPHN+G+ILR+A A + 
Sbjct: 63  -DGAVHQGFVLRVAEFAYTDFEALLKKAEQEDNPLLLILDGLTDPHNLGSILRTADATNV 121

Query: 160 DGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKP 219
            G+I  K  +   + V+AK+++GA+EHIP  R++NL+  L K+   GF   G       P
Sbjct: 122 TGVIIPKHRAVGVTPVVAKTSTGAIEHIPIARVTNLSQTLDKLKEAGFWIFGTDMQG-TP 180

Query: 220 LEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
             +     K+ALI+G EGKG+    ++    M  + M G +++LN S AAA+ +Y
Sbjct: 181 SHKWNTAGKLALIIGNEGKGISSNIKKQVDEMISIPMNGHVQSLNASVAAAILMY 235


>gi|325517967|gb|EGC97790.1| RNA methyltransferase [Burkholderia sp. TJI49]
          Length = 247

 Score =  115 bits (288), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 65/169 (38%), Positives = 98/169 (57%), Gaps = 5/169 (2%)

Query: 111 HQGLA--LETAPL---LSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITT 165
           HQG+   +E  PL   LS  LD +    LL+VLD V DPHN+GA LR A A     +I  
Sbjct: 69  HQGVVARVEDIPLAQNLSELLDGINGPALLLVLDGVTDPHNLGACLRVADAAGAHAVIAP 128

Query: 166 KRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIK 225
           +  +   +A  AK ASGA + +PYI ++NL  AL+++   G   IG S ++   L     
Sbjct: 129 RDRAVGLNATAAKVASGAADTVPYITVTNLARALRELKDAGVWIIGTSDEASATLHDTRL 188

Query: 226 NDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
           +  +A+++GAEG+G+R  T++T   +  + M G +++LNVS A+ V LY
Sbjct: 189 DGPVAIVMGAEGEGMRRLTRDTCDEVMSIPMAGSVESLNVSVASGVCLY 237


>gi|220917468|ref|YP_002492772.1| RNA methyltransferase, TrmH family, group 3 [Anaeromyxobacter
           dehalogenans 2CP-1]
 gi|219955322|gb|ACL65706.1| RNA methyltransferase, TrmH family, group 3 [Anaeromyxobacter
           dehalogenans 2CP-1]
          Length = 256

 Score =  115 bits (288), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 65/189 (34%), Positives = 109/189 (57%), Gaps = 8/189 (4%)

Query: 93  VKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTL-DAVRNSQ------LLMVLDHVNDPH 145
           V+  P   +D++ G +  HQG+    A      L D +  +Q      LL+VLD V DPH
Sbjct: 50  VRAAPRAKLDRLAGTDR-HQGVVAVVADFRYAELEDLLARAQAGGRPPLLVVLDGVEDPH 108

Query: 146 NIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSW 205
           N+GAI+RSA A    G++  +  +   +  +AK+++GA+E  P  R++N+   L+++   
Sbjct: 109 NLGAIIRSAHALGSHGVVIPRDRAVGVTPAVAKASAGAVERCPVARVTNVAKTLERLKEA 168

Query: 206 GFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNV 265
           G  ++ L++D ++PL +       AL+LG+EG+G+RP  + T    A + M G + +L+V
Sbjct: 169 GIWSVALAADGERPLGEVDLKGPTALVLGSEGEGIRPLVRRTCDLSARIPMSGDLDSLSV 228

Query: 266 SNAAAVALY 274
           S +AAVALY
Sbjct: 229 SASAAVALY 237


>gi|307247018|ref|ZP_07529072.1| 23S rRNA (guanosine-2'-O-)-methyltransferase rlmB [Actinobacillus
           pleuropneumoniae serovar 2 str. S1536]
 gi|306856470|gb|EFM88619.1| 23S rRNA (guanosine-2'-O-)-methyltransferase rlmB [Actinobacillus
           pleuropneumoniae serovar 2 str. S1536]
          Length = 259

 Score =  115 bits (288), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 82/245 (33%), Positives = 122/245 (49%), Gaps = 33/245 (13%)

Query: 51  LYGVHTVSAALNNPSRKIFQLLATK-----------NALARLDWDANLPHPFPVKTVPPQ 99
           +YG+H V A L+N   ++ ++L  K           N L RL           V+ V  Q
Sbjct: 17  IYGIHAVKAFLDNAPERLIEVLVLKGREDKRLTPLLNELQRLG--------ISVQQVNRQ 68

Query: 100 TIDKIVGKEAVHQGLALETAP---LLSPTLDAV---RNSQLLMVLDHVNDPHNIGAILRS 153
           T+D     E VHQG+  +  P   L    LDA+   + +  L++LD V DPHN+GA LR+
Sbjct: 69  TLDNKAQGE-VHQGIIAKVVPQKELNEHDLDAILAQKQNPFLLILDGVTDPHNLGACLRT 127

Query: 154 AVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDA---LQKMHS-WGFQT 209
           A A   D +I  K  S   ++   K A GA E +P IR++NL      LQ+ H+ W    
Sbjct: 128 ADAAGVDAVIVPKDKSAQLTSTARKVACGAAETVPLIRVTNLARTMRELQEQHNIW---I 184

Query: 210 IGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAA 269
           +G + ++   + Q      IAL++GAEG G+R  T+E    +  + M G + +LNVS A 
Sbjct: 185 VGTAGEATSGIYQAKLTGAIALVMGAEGDGMRRLTREHCDQLISIPMAGSVSSLNVSVAT 244

Query: 270 AVALY 274
            V L+
Sbjct: 245 GVCLF 249


>gi|322386796|ref|ZP_08060420.1| 23S rRNA (guanosine-2'-O-)-methyltransferase RlmB [Streptococcus
           cristatus ATCC 51100]
 gi|321269078|gb|EFX52014.1| 23S rRNA (guanosine-2'-O-)-methyltransferase RlmB [Streptococcus
           cristatus ATCC 51100]
          Length = 243

 Score =  115 bits (288), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 79/237 (33%), Positives = 126/237 (53%), Gaps = 13/237 (5%)

Query: 47  ENLFLYGVHTVSAAL-NNPSRKIF--QLLATKNALARLDWDANLPHPFPVKTVPPQTIDK 103
           +N  +YGVH V+ AL  N   K++    L  KN     D  A       +   P +T+ +
Sbjct: 3   KNDIVYGVHAVTEALMANTGNKLYIQDDLRGKNVSKIKDLAA--AKKVSISWSPKKTLQE 60

Query: 104 IVGKEAVHQGLALETAPLLSPTL-DAVRNSQ-----LLMVLDHVNDPHNIGAILRSAVAF 157
           +    AVHQG  L  +      L D ++ ++     LL++LD + DPHN+G+ILR+A A 
Sbjct: 61  MT-DGAVHQGFVLRVSEFAYADLADVLKKAEQEENPLLLILDGLTDPHNLGSILRTADAT 119

Query: 158 SCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSK 217
           +  G+I  K  +   + V+AK+++GA+EHIP  R++NL+  L K+   GF   G      
Sbjct: 120 NVTGVIIPKHRAVGVTPVVAKTSTGAIEHIPIARVTNLSQTLDKLKEAGFWIFGTDMQG- 178

Query: 218 KPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
            P+ +     K+ALI+G EGKG+    ++    M  + M G +++LN S AAA+ +Y
Sbjct: 179 TPVHKWNTAGKLALIIGNEGKGISSNIKKQVDEMLTIPMNGHVQSLNASVAAAILMY 235


>gi|307249241|ref|ZP_07531238.1| 23S rRNA (guanosine-2'-O-)-methyltransferase rlmB [Actinobacillus
           pleuropneumoniae serovar 4 str. M62]
 gi|307251563|ref|ZP_07533470.1| 23S rRNA (guanosine-2'-O-)-methyltransferase rlmB [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
 gi|306858765|gb|EFM90824.1| 23S rRNA (guanosine-2'-O-)-methyltransferase rlmB [Actinobacillus
           pleuropneumoniae serovar 4 str. M62]
 gi|306861027|gb|EFM93033.1| 23S rRNA (guanosine-2'-O-)-methyltransferase rlmB [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
          Length = 259

 Score =  115 bits (288), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 82/245 (33%), Positives = 122/245 (49%), Gaps = 33/245 (13%)

Query: 51  LYGVHTVSAALNNPSRKIFQLLATK-----------NALARLDWDANLPHPFPVKTVPPQ 99
           +YG+H V A L+N   ++ ++L  K           N L RL           V+ V  Q
Sbjct: 17  IYGIHAVKAFLDNAPERLIEVLVLKGREDKRLTPLLNELQRLG--------ISVQQVNRQ 68

Query: 100 TIDKIVGKEAVHQGLALETAP---LLSPTLDAV---RNSQLLMVLDHVNDPHNIGAILRS 153
           T+D     E VHQG+  +  P   L    LDA+   + +  L++LD V DPHN+GA LR+
Sbjct: 69  TLDNKAQGE-VHQGIIAKVVPQKELNEHDLDAILAQKQNPFLLILDGVTDPHNLGACLRT 127

Query: 154 AVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDA---LQKMHS-WGFQT 209
           A A   D +I  K  S   ++   K A GA E +P IR++NL      LQ+ H+ W    
Sbjct: 128 ADAAGVDAVIVPKDKSAQLTSTARKVACGAAETVPLIRVTNLARTMRELQEQHNIW---I 184

Query: 210 IGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAA 269
           +G + ++   + Q      IAL++GAEG G+R  T+E    +  + M G + +LNVS A 
Sbjct: 185 VGTAGEATSGIYQAKLTGAIALVMGAEGDGMRRLTREHCDQLISIPMAGSVSSLNVSVAT 244

Query: 270 AVALY 274
            V L+
Sbjct: 245 GVCLF 249


>gi|270293024|ref|ZP_06199235.1| RNA methyltransferase, TrmH family protein [Streptococcus sp. M143]
 gi|270279003|gb|EFA24849.1| RNA methyltransferase, TrmH family protein [Streptococcus sp. M143]
          Length = 253

 Score =  115 bits (288), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 77/236 (32%), Positives = 124/236 (52%), Gaps = 13/236 (5%)

Query: 48  NLFLYGVHTVSAAL-NNPSRKIF--QLLATKNALARLDWDANLPHPFPVKTVPPQTIDKI 104
           N  +YGVH V+ AL  N   K++    L  KN     +  A       +     +++ ++
Sbjct: 15  NDIVYGVHAVTEALLANTGNKLYLQDDLRGKNVEKVKELAA--EKKVSISWTSKKSLSEM 72

Query: 105 VGKEAVHQGLALETAPLLSPTLDAV------RNSQLLMVLDHVNDPHNIGAILRSAVAFS 158
             + AVHQG  L  +      L+ +        + LL++LD + DPHN+G+ILR+A A +
Sbjct: 73  T-EGAVHQGFVLRVSEFAYSELEHILAKTRQEENPLLLILDGLTDPHNLGSILRTADATN 131

Query: 159 CDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKK 218
             G+I  K  +   + V+AK+A+GA+EH+P  R++NL+  L K+   GF T G   +   
Sbjct: 132 VSGVIIPKHRAVGVTPVVAKTATGAIEHVPIARVTNLSQTLDKLKDEGFWTFGTDMNG-T 190

Query: 219 PLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
           P  +     KIALI+G EGKG+    ++    M  + M G +++LN S AAA+ +Y
Sbjct: 191 PCHKWNTKGKIALIIGNEGKGISSNIKKQVDEMITIPMNGHVQSLNASVAAAILMY 246


>gi|313500862|gb|ADR62228.1| 23S rRNA (guanosine-2'-O-)-methyltransferase rlmB [Pseudomonas
           putida BIRD-1]
          Length = 248

 Score =  115 bits (288), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 78/234 (33%), Positives = 123/234 (52%), Gaps = 12/234 (5%)

Query: 51  LYGVHTVSAALNNPSRKIFQL-LATKNALARLDWDANLP--HPFPVKTVPPQTIDKIVGK 107
           +YGVH V A L +  +++ Q+ L+   +  RL+    L   +  PV     + +D  V  
Sbjct: 7   IYGVHAVQALLQHHPKRVKQIWLSEGRSEPRLETLLALAAENRVPVGQAERREMDAWV-- 64

Query: 108 EAVHQGLALETAP-------LLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCD 160
           E VHQG+  E +P       +L   L+      L++VLD V DPHN+GA LR+A A    
Sbjct: 65  EGVHQGVVAEVSPSQVWGELMLEELLERTETPPLILVLDGVTDPHNLGACLRTADAAGAT 124

Query: 161 GIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPL 220
            +I  K  S + + V+ K A GA E IP + ++NL   L+K+   G   +G + ++ + +
Sbjct: 125 AVIVPKDKSATLTPVVRKVACGAAEVIPLVAVTNLARTLEKLQQRGLWVVGTAGEADQEI 184

Query: 221 EQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
            Q+     + +I+GAEGKG+R  T+E    +  L M G + +LNVS A  V L+
Sbjct: 185 YQQDLTGPLVMIMGAEGKGMRRLTREHCDFLVKLPMAGSVSSLNVSVATGVCLF 238


>gi|52078591|ref|YP_077382.1| putative tRNA/rRNA methyltransferase YacO [Bacillus licheniformis
           ATCC 14580]
 gi|52783952|ref|YP_089781.1| YacO [Bacillus licheniformis ATCC 14580]
 gi|52001802|gb|AAU21744.1| putative tRNA/rRNA methyltransferase YacO [Bacillus licheniformis
           ATCC 14580]
 gi|52346454|gb|AAU39088.1| YacO [Bacillus licheniformis ATCC 14580]
          Length = 249

 Score =  115 bits (288), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 69/235 (29%), Positives = 127/235 (54%), Gaps = 13/235 (5%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLATKNAL---ARLDWDANLPHPFPVKTVPPQTIDKIVG 106
           ++ G + V   L +  R++++L   +N +   A+   D    +   +  VP + +D++V 
Sbjct: 7   YVIGKNAVIETLKS-GRELYKLWMAENTVKGQAQQVVDLAAKNGVTIHYVPRKKLDQMVS 65

Query: 107 KEAVHQGLALETAPLLSPTLDAV------RNSQ-LLMVLDHVNDPHNIGAILRSAVAFSC 159
            +  HQG+  + A      LD +      RN Q  ++VLD + DPHN+G+I+R+A A   
Sbjct: 66  GQ--HQGVVAQVAAYEYAELDDLFQKAEDRNEQPFILVLDEIEDPHNLGSIMRTADAVGA 123

Query: 160 DGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKP 219
            GI+  KR +   +  +AK+++GA+EHIP ++++NL+  L++M   G   +G  +  ++ 
Sbjct: 124 HGIVIPKRRAVGLTTTVAKASTGAIEHIPVVKVTNLSRTLEEMKGRGIWVVGTDASGQQD 183

Query: 220 LEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
                 N  +AL++G+EGKG+    +E    +  L M G + +LN S AA + +Y
Sbjct: 184 YRSLDGNMPLALVIGSEGKGMGRLVKEKCDFLIRLPMAGKVTSLNASVAAGLLMY 238


>gi|170692230|ref|ZP_02883393.1| RNA methyltransferase, TrmH family, group 3 [Burkholderia graminis
           C4D1M]
 gi|170142660|gb|EDT10825.1| RNA methyltransferase, TrmH family, group 3 [Burkholderia graminis
           C4D1M]
          Length = 247

 Score =  115 bits (288), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 61/169 (36%), Positives = 98/169 (57%), Gaps = 5/169 (2%)

Query: 111 HQGLALETAPL-----LSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITT 165
           HQG+      +     L+  LD +  S LL+VLD V DPHN+GA LR A A     +I  
Sbjct: 69  HQGVVARAGDMPLAQNLAELLDGINGSPLLLVLDGVTDPHNLGACLRVADAAGAHAVIAP 128

Query: 166 KRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIK 225
           +  +   +A  AK ASGA + +PYI ++NL  AL+++   G   +G + ++KK L +   
Sbjct: 129 RDRAVGLNATAAKVASGAADTVPYITVTNLARALRELKEAGVWIVGTAGEAKKSLYETEL 188

Query: 226 NDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
           +  +A+++GAEG+G+R  T +T   +  + M G +++LNVS A+ V L+
Sbjct: 189 DGPVAIVMGAEGEGMRRLTHDTCDIVMQIPMAGTVESLNVSVASGVCLF 237


>gi|221133725|ref|ZP_03560030.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Glaciecola sp.
           HTCC2999]
          Length = 247

 Score =  115 bits (288), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 76/234 (32%), Positives = 120/234 (51%), Gaps = 10/234 (4%)

Query: 50  FLYGVHTVSAALNNPSRKIFQL-LATKNALARLDWDANLPHP--FPVKTVPPQTIDKIVG 106
           +LYG+H ++A L    ++I +L +A      RL    NL       ++    + +D    
Sbjct: 7   WLYGIHALTAVLEREPQRILELYIAKGRDDERLHKLINLARKEGISIQFCNKKVLDDKSK 66

Query: 107 KEAVHQGLALETAP---LLSPTLDAVRNSQ---LLMVLDHVNDPHNIGAILRSAVAFSCD 160
            E+ HQG+     P   L    LD + +      L+VLD V DPHN+GA+LRSA A   D
Sbjct: 67  GES-HQGVVARAYPAKVLTETDLDTIISQSAKPFLLVLDGVTDPHNLGAVLRSADAAGVD 125

Query: 161 GIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPL 220
            +I  K  S S +A + K A GA + IP I+++NL   L ++       +G + ++++ +
Sbjct: 126 AVIVPKDKSASLNATVRKVACGAADVIPLIQVTNLARTLSELQEQQIWVVGTAGEARQSV 185

Query: 221 EQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
                   +AL++GAEGKG+R  T+E    +  L M G + +LNVS A  + LY
Sbjct: 186 FDCDMAGPVALVMGAEGKGMRRLTRERCDELIKLPMLGTVSSLNVSVATGICLY 239


>gi|94311029|ref|YP_584239.1| RNA methyltransferase TrmH, group 3 [Cupriavidus metallidurans
           CH34]
 gi|93354881|gb|ABF08970.1| RNA methyltransferase TrmH, group 3 [Cupriavidus metallidurans
           CH34]
          Length = 247

 Score =  115 bits (288), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 77/233 (33%), Positives = 117/233 (50%), Gaps = 9/233 (3%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLATKNALARLDWD-ANLPHPFPVKTVPPQTIDKIVGKE 108
            L G H V+A L   ++ +  +    N   R   D   L     V T+ P   +++ G  
Sbjct: 6   LLIGFHAVNARLRQNAQSVSDIYIEANRRDRRMQDFIRLAESLGV-TLHPVDAERLRGMA 64

Query: 109 AV--HQGLA-----LETAPLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDG 161
               HQG+      +  A  L   LD +  + LL++LD V DPHN+GA LR A       
Sbjct: 65  GTDRHQGVVARADDVSLALNLDELLDGIEGTPLLLLLDGVTDPHNLGACLRVADGAGAHA 124

Query: 162 IITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLE 221
           +I  K  S   +A +AK ASGA E +PYI ++NL   L+++   G   IG +  ++K L 
Sbjct: 125 VIAPKDRSVGLNATVAKVASGAAETVPYITVTNLARTLRELQERGIWVIGTADGTEKALY 184

Query: 222 QEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
                   A+++GAEG+G+R  T+ET   +  + M G +++LNVS A+ V LY
Sbjct: 185 DVDLKGPTAIVMGAEGEGMRRLTRETCDELVAIPMAGGVESLNVSVASGVCLY 237


>gi|206559920|ref|YP_002230684.1| putative tRNA/rRNA methyltransferase [Burkholderia cenocepacia
           J2315]
 gi|198035961|emb|CAR51853.1| putative tRNA/rRNA methyltransferase [Burkholderia cenocepacia
           J2315]
          Length = 247

 Score =  115 bits (287), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 65/169 (38%), Positives = 99/169 (58%), Gaps = 5/169 (2%)

Query: 111 HQGLA--LETAPL---LSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITT 165
           HQG+   +E  PL   LS  LD +    LL+VLD V DPHN+GA LR A +     +I  
Sbjct: 69  HQGVVARVEDMPLAQNLSELLDGINGPALLLVLDGVTDPHNLGACLRVADSAGAHAVIAP 128

Query: 166 KRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIK 225
           +  +   +A  AK ASGA + +PYI ++NL  AL+++   G   IG S ++   L +   
Sbjct: 129 RDRAVGLNATAAKVASGAADTVPYITVTNLARALRELKEAGVWIIGTSDEAPATLYETKL 188

Query: 226 NDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
           +  +AL++GAEG+G+R  T++T   +  + M G +++LNVS A+ V LY
Sbjct: 189 DGPVALVMGAEGEGMRRLTRDTCDEVMSIPMAGSVESLNVSVASGVCLY 237


>gi|262037386|ref|ZP_06010850.1| RNA methyltransferase, TrmH family, group 3 [Leptotrichia
           goodfellowii F0264]
 gi|261748548|gb|EEY35923.1| RNA methyltransferase, TrmH family, group 3 [Leptotrichia
           goodfellowii F0264]
          Length = 244

 Score =  115 bits (287), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 51/158 (32%), Positives = 88/158 (55%), Gaps = 2/158 (1%)

Query: 116 LETAPLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAV 175
           LE        L   ++  ++++LD + DP N GAI+RSA  F  DGI+   R +   +  
Sbjct: 84  LELTEFFEKVL--AKDKSIVVILDQIQDPRNFGAIIRSAECFGVDGIVIQDRNNVKVTET 141

Query: 176 LAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGA 235
           + KS++GA+EH+  I+++N++D + K   +G++  G  +D +    +E    K+ L+LG+
Sbjct: 142 VVKSSTGAIEHVDIIKVTNISDTIDKFKKYGYKVYGAEADGENLYYEESYPKKVCLVLGS 201

Query: 236 EGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVAL 273
           EG G+R K +E       +H+ G   +LNVS A  + L
Sbjct: 202 EGNGMRKKVREHCDKTLKIHLKGQTNSLNVSVAGGIIL 239


>gi|254521763|ref|ZP_05133818.1| RNA methyltransferase, TrmH family, group 3 [Stenotrophomonas sp.
           SKA14]
 gi|219719354|gb|EED37879.1| RNA methyltransferase, TrmH family, group 3 [Stenotrophomonas sp.
           SKA14]
          Length = 247

 Score =  115 bits (287), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 78/236 (33%), Positives = 123/236 (52%), Gaps = 13/236 (5%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLATKNA----LARLDWDANLPHPFPVKTVPPQTIDKIV 105
           ++ GV+ V++++ N +  + ++L    A    L  ++ +A       V+ V  Q +D  V
Sbjct: 7   WIVGVNAVASSIENDAENVREVLVEAGAKNPRLTEIEENAR-RKGIDVRKVNAQALDG-V 64

Query: 106 GKEAVHQGLALETAPL-------LSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFS 158
           G    HQG+A   A         L   + A     LL+VLD V DPHN+GA LRSA A  
Sbjct: 65  GGSVRHQGVAARYAAARTYSENELEGLVTAAEGKALLLVLDEVQDPHNLGACLRSAAAAG 124

Query: 159 CDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKK 218
              +I  K  S + +A + K+++GA + IP + ++NL+  L+ +   G    GL+ ++  
Sbjct: 125 ATAVIIPKDKSATVNATVRKTSAGAADRIPVVAVTNLSRCLKDLQKQGVWIYGLAGEATA 184

Query: 219 PLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
            L Q      IAL+LG E  GLR  T+E    +  + MPG I++LNVS AA V+L+
Sbjct: 185 SLYQLDLKGNIALVLGGEADGLRRLTRENCDGLVKIPMPGEIESLNVSVAAGVSLF 240


>gi|32033775|ref|ZP_00134060.1| COG0566: rRNA methylases [Actinobacillus pleuropneumoniae serovar 1
           str. 4074]
 gi|126207530|ref|YP_001052755.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Actinobacillus
           pleuropneumoniae L20]
 gi|165975500|ref|YP_001651093.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Actinobacillus
           pleuropneumoniae serovar 3 str. JL03]
 gi|190149311|ref|YP_001967836.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Actinobacillus
           pleuropneumoniae serovar 7 str. AP76]
 gi|303250521|ref|ZP_07336718.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
 gi|303251865|ref|ZP_07338036.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Actinobacillus
           pleuropneumoniae serovar 2 str. 4226]
 gi|307244843|ref|ZP_07526942.1| 23S rRNA (guanosine-2'-O-)-methyltransferase rlmB [Actinobacillus
           pleuropneumoniae serovar 1 str. 4074]
 gi|307253797|ref|ZP_07535651.1| 23S rRNA (guanosine-2'-O-)-methyltransferase rlmB [Actinobacillus
           pleuropneumoniae serovar 9 str. CVJ13261]
 gi|307256063|ref|ZP_07537851.1| 23S rRNA (guanosine-2'-O-)-methyltransferase rlmB [Actinobacillus
           pleuropneumoniae serovar 10 str. D13039]
 gi|307258253|ref|ZP_07539996.1| 23S rRNA (guanosine-2'-O-)-methyltransferase rlmB [Actinobacillus
           pleuropneumoniae serovar 11 str. 56153]
 gi|307260494|ref|ZP_07542188.1| 23S rRNA (guanosine-2'-O-)-methyltransferase rlmB [Actinobacillus
           pleuropneumoniae serovar 12 str. 1096]
 gi|307262624|ref|ZP_07544254.1| 23S rRNA (guanosine-2'-O-)-methyltransferase rlmB [Actinobacillus
           pleuropneumoniae serovar 13 str. N273]
 gi|126096322|gb|ABN73150.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Actinobacillus
           pleuropneumoniae serovar 5b str. L20]
 gi|165875601|gb|ABY68649.1| putative tRNA/rRNA methyltransferase [Actinobacillus
           pleuropneumoniae serovar 3 str. JL03]
 gi|189914442|gb|ACE60694.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Actinobacillus
           pleuropneumoniae serovar 7 str. AP76]
 gi|302649295|gb|EFL79480.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Actinobacillus
           pleuropneumoniae serovar 2 str. 4226]
 gi|302650509|gb|EFL80668.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
 gi|306854288|gb|EFM86494.1| 23S rRNA (guanosine-2'-O-)-methyltransferase rlmB [Actinobacillus
           pleuropneumoniae serovar 1 str. 4074]
 gi|306863281|gb|EFM95221.1| 23S rRNA (guanosine-2'-O-)-methyltransferase rlmB [Actinobacillus
           pleuropneumoniae serovar 9 str. CVJ13261]
 gi|306865485|gb|EFM97380.1| 23S rRNA (guanosine-2'-O-)-methyltransferase rlmB [Actinobacillus
           pleuropneumoniae serovar 10 str. D13039]
 gi|306867713|gb|EFM99558.1| 23S rRNA (guanosine-2'-O-)-methyltransferase rlmB [Actinobacillus
           pleuropneumoniae serovar 11 str. 56153]
 gi|306869806|gb|EFN01589.1| 23S rRNA (guanosine-2'-O-)-methyltransferase rlmB [Actinobacillus
           pleuropneumoniae serovar 12 str. 1096]
 gi|306872047|gb|EFN03761.1| 23S rRNA (guanosine-2'-O-)-methyltransferase rlmB [Actinobacillus
           pleuropneumoniae serovar 13 str. N273]
          Length = 247

 Score =  115 bits (287), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 82/245 (33%), Positives = 122/245 (49%), Gaps = 33/245 (13%)

Query: 51  LYGVHTVSAALNNPSRKIFQLLATK-----------NALARLDWDANLPHPFPVKTVPPQ 99
           +YG+H V A L+N   ++ ++L  K           N L RL           V+ V  Q
Sbjct: 5   IYGIHAVKAFLDNAPERLIEVLVLKGREDKRLTPLLNELQRLG--------ISVQQVNRQ 56

Query: 100 TIDKIVGKEAVHQGLALETAP---LLSPTLDAV---RNSQLLMVLDHVNDPHNIGAILRS 153
           T+D     E VHQG+  +  P   L    LDA+   + +  L++LD V DPHN+GA LR+
Sbjct: 57  TLDNKAQGE-VHQGIIAKVVPQKELNEHDLDAILAQKQNPFLLILDGVTDPHNLGACLRT 115

Query: 154 AVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDA---LQKMHS-WGFQT 209
           A A   D +I  K  S   ++   K A GA E +P IR++NL      LQ+ H+ W    
Sbjct: 116 ADAAGVDAVIVPKDKSAQLTSTARKVACGAAETVPLIRVTNLARTMRELQEQHNIW---I 172

Query: 210 IGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAA 269
           +G + ++   + Q      IAL++GAEG G+R  T+E    +  + M G + +LNVS A 
Sbjct: 173 VGTAGEATSGIYQAKLTGAIALVMGAEGDGMRRLTREHCDQLISIPMAGSVSSLNVSVAT 232

Query: 270 AVALY 274
            V L+
Sbjct: 233 GVCLF 237


>gi|71904302|ref|YP_281105.1| 23S rRNA methyltransferase [Streptococcus pyogenes MGAS6180]
 gi|94991229|ref|YP_599329.1| 23S rRNA Gm2251 methyltransferase [Streptococcus pyogenes
           MGAS10270]
 gi|94995142|ref|YP_603240.1| 23S rRNA Gm2251 methyltransferase [Streptococcus pyogenes
           MGAS10750]
 gi|71803397|gb|AAX72750.1| 23S rRNA methyltransferase [Streptococcus pyogenes MGAS6180]
 gi|94544737|gb|ABF34785.1| 23S rRNA Gm2251 methyltransferase [Streptococcus pyogenes
           MGAS10270]
 gi|94548650|gb|ABF38696.1| 23S rRNA Gm2251 methyltransferase [Streptococcus pyogenes
           MGAS10750]
          Length = 257

 Score =  115 bits (287), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 78/247 (31%), Positives = 127/247 (51%), Gaps = 35/247 (14%)

Query: 48  NLFLYGVHTVSAALN-NPSRKIF-------------QLLATKNALARLDWDANLPHPFPV 93
           N  +YGVH V+ +L  N   K++             + LAT+  +A + W        P 
Sbjct: 19  NDIVYGVHAVTESLQANTGNKLYIQEDLRGKKVDNIKSLATQKKVA-ISWT-------PK 70

Query: 94  KTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAV------RNSQLLMVLDHVNDPHNI 147
           KT+   T        AVHQG  L  +      +D +        + L+++LD + DPHN+
Sbjct: 71  KTLSQMT------DGAVHQGFVLRVSAFAYTDVDEILEIAEQEANPLILILDGLTDPHNL 124

Query: 148 GAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGF 207
           G+ILR+A A +  G+I  K  S   + V++K+++GA+EHIP  R++NL+  L K+ + GF
Sbjct: 125 GSILRTADATNVCGVIIPKHRSVGVTPVVSKTSTGAVEHIPIARVTNLSQTLDKLKARGF 184

Query: 208 QTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSN 267
              G   +   P +    N K+AL++G EGKG+    ++    M  + M G +++LN S 
Sbjct: 185 WIFGTDMNG-TPSDCWNTNGKLALVIGNEGKGISTNIKKQVDEMITIPMNGHVQSLNASV 243

Query: 268 AAAVALY 274
           AAA+ +Y
Sbjct: 244 AAAILMY 250


>gi|162447016|ref|YP_001620148.1| TrmH family RNA methyltransferase [Acholeplasma laidlawii PG-8A]
 gi|161985123|gb|ABX80772.1| RNA methyltransferase, TrmH family [Acholeplasma laidlawii PG-8A]
          Length = 230

 Score =  115 bits (287), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 64/172 (37%), Positives = 98/172 (56%), Gaps = 5/172 (2%)

Query: 109 AVHQGLALETAPL----LSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIIT 164
           AVH G+  +        L   LD  R  + LM LD V DPHN+GAILRS  A + DG+I 
Sbjct: 59  AVHNGVVADVKDYQYLELDVVLDKTRRQRFLM-LDEVQDPHNLGAILRSVEATNYDGVII 117

Query: 165 TKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEI 224
           +K++    + V+AK++SGA+EH+  I +SNL   + K+    F  +G + ++    ++  
Sbjct: 118 SKKHQVPLTGVVAKTSSGAIEHVKLILVSNLYQTILKLQKEDFLVVGTAGEATASYKEIP 177

Query: 225 KNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYIT 276
           KN  + +I+G EG GLRP  ++    +  + M G + +LNVS A A+ LY T
Sbjct: 178 KNQNLLIIMGNEGFGLRPLIKKGCDLLVSIPMLGKVNSLNVSVATALLLYET 229


>gi|134295618|ref|YP_001119353.1| RNA methyltransferase [Burkholderia vietnamiensis G4]
 gi|134138775|gb|ABO54518.1| 23S rRNA Gm-2251 2'-O-methyltransferase [Burkholderia vietnamiensis
           G4]
          Length = 247

 Score =  115 bits (287), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 64/169 (37%), Positives = 99/169 (58%), Gaps = 5/169 (2%)

Query: 111 HQGLA--LETAPL---LSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITT 165
           HQG+   +E  PL   LS  LD ++   LL+VLD V DPHN+GA LR A A     +I  
Sbjct: 69  HQGVVARVEDVPLAQNLSELLDGIQGPALLLVLDGVTDPHNLGACLRVADAAGAHAVIAP 128

Query: 166 KRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIK 225
           +  +   +A  AK ASGA + +PYI ++NL  AL+++   G   IG + ++   L     
Sbjct: 129 RDRAVGLNATAAKVASGAADTVPYITVTNLARALRELKDAGVWIIGTADEASGTLYDTKL 188

Query: 226 NDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
           +  +A+++GAEG+G+R  T++T   +  + M G +++LNVS A+ V LY
Sbjct: 189 DGPVAIVMGAEGEGMRRLTRDTCDDVMSIPMAGSVESLNVSVASGVCLY 237


>gi|307543249|gb|ADN44264.1| TrmH family RNA methyltransferase [Pseudomonas syringae]
          Length = 255

 Score =  115 bits (287), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 74/232 (31%), Positives = 118/232 (50%), Gaps = 8/232 (3%)

Query: 51  LYGVHTVSAALNNPSRKIFQL-LATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEA 109
           +YG+H V A L +  +++ Q+ LA      R+     L     +     +  +  V  E 
Sbjct: 7   IYGIHAVEALLRHHPKRVKQVWLAESRNDPRVQTLIALAAENRIDVGNAERREMDVWVEG 66

Query: 110 VHQGLALETAP-------LLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGI 162
           VHQG+  + +P       +L+  LD    + L++VLD V DPHN+GA LR+A A     +
Sbjct: 67  VHQGVVADVSPSQVWGEAMLNELLDRTEGAPLILVLDGVTDPHNLGACLRTADAAGALAV 126

Query: 163 ITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQ 222
           I  K  S + +  + K A GA E IP + ++NL   L+K+   G   +G + ++++ L  
Sbjct: 127 IVPKDKSATLTPTVQKVACGAAEVIPLVAVTNLAATLKKLQQRGLWIVGTAGEAEQELYD 186

Query: 223 EIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
           +       LI+GAEGKG+R  T+E    +  L M G + +LNVS A  V L+
Sbjct: 187 QDMTGPTILIMGAEGKGMRRLTREHCDYLVRLPMAGSVSSLNVSVATGVCLF 238


>gi|254506517|ref|ZP_05118659.1| RNA methyltransferase, TrmH family, group 3 [Vibrio
           parahaemolyticus 16]
 gi|219550691|gb|EED27674.1| RNA methyltransferase, TrmH family, group 3 [Vibrio
           parahaemolyticus 16]
          Length = 245

 Score =  115 bits (287), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 79/241 (32%), Positives = 121/241 (50%), Gaps = 20/241 (8%)

Query: 48  NLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLP--HPFPVKTVPPQTI---- 101
           N F+YG+H V A L     +  +    K    R D D  +P  +   V  V  Q +    
Sbjct: 3   NEFIYGIHAVKAVLECEPERFIEAFVLK---GRQD-DRLMPILNELQVCGVSIQQMTRKT 58

Query: 102 --DKIVGKEAVHQGLALETAP---LLSPTLDAV---RNSQLLMVLDHVNDPHNIGAILRS 153
             DK  G  A HQG+     P   L    LD +     S LL+VLD V DPHN+GA LR+
Sbjct: 59  LDDKARG--ANHQGIMARVKPAKQLNENDLDDILAKHESPLLLVLDGVTDPHNLGACLRN 116

Query: 154 AVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLS 213
           A A     +I  K  S + +A ++K A GA E +P +R++NL   ++ +   G   +G +
Sbjct: 117 ADAAGVAAVIVPKDKSANITATVSKVACGAAETVPLVRVTNLARTMRALQEQGIWFVGTA 176

Query: 214 SDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVAL 273
            ++ + + Q      +A+++GAEG G+R  T+ET   +  + M G + +LNVS A+ V L
Sbjct: 177 GEATQDIYQAKLTGSLAIVMGAEGDGMRRLTRETCDDLIKIPMAGSVSSLNVSVASGVCL 236

Query: 274 Y 274
           +
Sbjct: 237 F 237


>gi|194365073|ref|YP_002027683.1| TrmH family RNA methyltransferase [Stenotrophomonas maltophilia
           R551-3]
 gi|194347877|gb|ACF51000.1| RNA methyltransferase, TrmH family, group 3 [Stenotrophomonas
           maltophilia R551-3]
          Length = 247

 Score =  115 bits (287), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 79/236 (33%), Positives = 123/236 (52%), Gaps = 13/236 (5%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLATKNA----LARLDWDANLPHPFPVKTVPPQTIDKIV 105
           ++ GV+ V++++ N +  + ++L    A    L  ++ +A       V+ V  Q +D  V
Sbjct: 7   WIVGVNAVASSIENDAENVREVLVEAGAKNPRLTEIEENAR-RKGIDVRKVNSQALDG-V 64

Query: 106 GKEAVHQGLALETAPL-------LSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFS 158
           G    HQG+A   A         L   + A     LL+VLD V DPHN+GA LRSA A  
Sbjct: 65  GGSVRHQGVAARYAAARTYSENELEGLVTAAEGKALLLVLDEVQDPHNLGACLRSAAAAG 124

Query: 159 CDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKK 218
              +I  K  S S +A + K+++GA + IP + ++NL+  L+ +   G    GL+ ++  
Sbjct: 125 ATAVIIPKDKSASVNATVRKTSAGAADLIPVVAVTNLSRCLKDLQKQGVWIYGLAGEATA 184

Query: 219 PLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
            L Q      IAL+LG E  GLR  T+E    +  + MPG I++LNVS AA V+L+
Sbjct: 185 SLYQLDLKGNIALVLGGEADGLRRLTRENCDGLVKIPMPGEIESLNVSVAAGVSLF 240


>gi|319649135|ref|ZP_08003343.1| YacO protein [Bacillus sp. BT1B_CT2]
 gi|317388835|gb|EFV69654.1| YacO protein [Bacillus sp. BT1B_CT2]
          Length = 249

 Score =  115 bits (287), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 69/235 (29%), Positives = 126/235 (53%), Gaps = 13/235 (5%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLATKNAL---ARLDWDANLPHPFPVKTVPPQTIDKIVG 106
           ++ G + V   L +  R++++L   +N +   A+   D        +  VP + +D++V 
Sbjct: 7   YVIGKNAVIETLKS-GRELYKLWMAENTVKGQAQQVVDLAAKKGVTIHYVPRKKLDQMVS 65

Query: 107 KEAVHQGLALETAPLLSPTLDAV------RNSQ-LLMVLDHVNDPHNIGAILRSAVAFSC 159
            +  HQG+  + A      LD +      RN Q  ++VLD + DPHN+G+I+R+A A   
Sbjct: 66  GQ--HQGVVAQVAAYEYAELDDLFQKAEDRNEQPFILVLDEIEDPHNLGSIMRTADAVGA 123

Query: 160 DGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKP 219
            GI+  KR +   +  +AK+++GA+EHIP ++++NL+  L++M   G   +G  +  ++ 
Sbjct: 124 HGIVIPKRRAVGLTTTVAKASTGAIEHIPVVKVTNLSRTLEEMKGRGIWVVGTDASGQQD 183

Query: 220 LEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
                 N  +AL++G+EGKG+    +E    +  L M G + +LN S AA + +Y
Sbjct: 184 YRSLDGNMPLALVIGSEGKGMGRLVKEKCDFLIRLPMAGKVTSLNASVAAGLLMY 238


>gi|291613895|ref|YP_003524052.1| RNA methyltransferase, TrmH family, group 3 [Sideroxydans
           lithotrophicus ES-1]
 gi|291584007|gb|ADE11665.1| RNA methyltransferase, TrmH family, group 3 [Sideroxydans
           lithotrophicus ES-1]
          Length = 247

 Score =  115 bits (287), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 73/236 (30%), Positives = 119/236 (50%), Gaps = 9/236 (3%)

Query: 47  ENLFLYGVHTVSAALNNPSRKIFQLLAT---KNALARLDWDANLPHPFPVKTVPPQTIDK 103
           E+  ++G H V+A +   +  + ++      K+  AR        +   +  V  + +D 
Sbjct: 3   ESRIIHGFHAVTARIRQNADSVLEMYVDTQRKDPRARDLLKLAESNGVRIIQVDGKRLDG 62

Query: 104 IVGKEAVHQGL-----ALETAPLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFS 158
           + G  + HQG+     A +    L   LD +    LL+VLD V DPHN+GA LRSA AF 
Sbjct: 63  MAGN-SRHQGVVARVDAAQKVQHLDDVLDTLTEPALLLVLDGVQDPHNLGACLRSADAFG 121

Query: 159 CDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKK 218
              +I  K  +   +A + K A GA + +PYI ++NL   L+++       IG+  +++ 
Sbjct: 122 VHAVIAPKDRAVGINATVEKVACGAAQTVPYITVTNLARTLRELQERDIWVIGMDGEAET 181

Query: 219 PLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
            L        +A +LGAEG+GLR  T+ET   +  + M G +++LNVS +  V LY
Sbjct: 182 NLYDVQHQGAVAWVLGAEGEGLRRLTRETCDQLVRIPMQGSVESLNVSVSTGVCLY 237


>gi|21911205|ref|NP_665473.1| SpoU family tRNA/rRNA methyltransferase [Streptococcus pyogenes
           MGAS315]
 gi|28896582|ref|NP_802932.1| tRNA/rRNA methyltransferase [Streptococcus pyogenes SSI-1]
 gi|21905417|gb|AAM80276.1| putative tRNA/rRNA methyltransferase, spoU family [Streptococcus
           pyogenes MGAS315]
 gi|28811836|dbj|BAC64765.1| putative tRNA/rRNA methyltransferase [Streptococcus pyogenes SSI-1]
          Length = 248

 Score =  115 bits (287), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 78/247 (31%), Positives = 127/247 (51%), Gaps = 35/247 (14%)

Query: 48  NLFLYGVHTVSAALN-NPSRKIF-------------QLLATKNALARLDWDANLPHPFPV 93
           N  +YGVH V+ +L  N   K++             + LAT+  +A + W        P 
Sbjct: 10  NDIVYGVHAVTESLQANTGNKLYIQEDLRGKKVDNIKSLATQKKVA-ISWT-------PK 61

Query: 94  KTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAV------RNSQLLMVLDHVNDPHNI 147
           KT+   T        AVHQG  L  +      +D +        + L+++LD + DPHN+
Sbjct: 62  KTLSQMT------DGAVHQGFVLRVSAFAYTDVDEILEIAEQEANPLILILDGLTDPHNL 115

Query: 148 GAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGF 207
           G+ILR+A A +  G+I  K  S   + V++K+++GA+EHIP  R++NL+  L K+ + GF
Sbjct: 116 GSILRTADATNVCGVIIPKHRSVCVTPVVSKTSTGAVEHIPIARVTNLSQTLDKLKARGF 175

Query: 208 QTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSN 267
              G   +   P +    N K+AL++G EGKG+    ++    M  + M G +++LN S 
Sbjct: 176 WIFGTDMNG-TPSDCWNTNGKLALVIGNEGKGISTNIKKQVDEMITIPMNGHVQSLNASV 234

Query: 268 AAAVALY 274
           AAA+ +Y
Sbjct: 235 AAAILMY 241


>gi|56807805|ref|ZP_00365654.1| COG0566: rRNA methylases [Streptococcus pyogenes M49 591]
 gi|209560082|ref|YP_002286554.1| 23S rRNA methyltransferase [Streptococcus pyogenes NZ131]
 gi|209541283|gb|ACI61859.1| 23S rRNA methyltransferase [Streptococcus pyogenes NZ131]
          Length = 248

 Score =  114 bits (286), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 78/247 (31%), Positives = 127/247 (51%), Gaps = 35/247 (14%)

Query: 48  NLFLYGVHTVSAALN-NPSRKIF-------------QLLATKNALARLDWDANLPHPFPV 93
           N  +YGVH V+ +L  N   K++             + LAT+  +A + W        P 
Sbjct: 10  NDIVYGVHAVTESLQANTGNKLYIQEDLRGKKVDNIKSLATQKKVA-ISWT-------PK 61

Query: 94  KTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAV------RNSQLLMVLDHVNDPHNI 147
           KT+   T        AVHQG  L  +      +D +        + L+++LD + DPHN+
Sbjct: 62  KTLSQMT------DGAVHQGFVLRVSAFAYTDVDEILEIAEQEANPLILILDGLTDPHNL 115

Query: 148 GAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGF 207
           G+ILR+A A +  G+I  K  S   + V++K+++GA+EHIP  R++NL+  L K+ + GF
Sbjct: 116 GSILRTADATNVCGVIIPKHRSVGVTPVVSKTSTGAVEHIPIARVTNLSQTLDKLKARGF 175

Query: 208 QTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSN 267
              G   +   P +    N K+AL++G EGKG+    ++    M  + M G +++LN S 
Sbjct: 176 WIFGTDMNG-TPSDCWNTNGKLALVIGNEGKGISTNIKKQVDEMITIPMNGHVQSLNASV 234

Query: 268 AAAVALY 274
           AAA+ +Y
Sbjct: 235 AAAILMY 241


>gi|15675741|ref|NP_269915.1| putative tRNA/rRNA methyltransferase [Streptococcus pyogenes M1
           GAS]
 gi|19746851|ref|NP_607987.1| tRNA/rRNA methyltransferase [Streptococcus pyogenes MGAS8232]
 gi|71911465|ref|YP_283015.1| 23S rRNA methyltransferase [Streptococcus pyogenes MGAS5005]
 gi|139474428|ref|YP_001129144.1| SpoU rRNA methylase family protein [Streptococcus pyogenes str.
           Manfredo]
 gi|13622961|gb|AAK34636.1| putative tRNA/rRNA methyltransferase [Streptococcus pyogenes M1
           GAS]
 gi|19749091|gb|AAL98486.1| putative tRNA/rRNA methyltransferase [Streptococcus pyogenes
           MGAS8232]
 gi|71854247|gb|AAZ52270.1| 23S rRNA methyltransferase [Streptococcus pyogenes MGAS5005]
 gi|134272675|emb|CAM30946.1| SpoU rRNA methylase family protein [Streptococcus pyogenes str.
           Manfredo]
          Length = 248

 Score =  114 bits (286), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 78/247 (31%), Positives = 127/247 (51%), Gaps = 35/247 (14%)

Query: 48  NLFLYGVHTVSAALN-NPSRKIF-------------QLLATKNALARLDWDANLPHPFPV 93
           N  +YGVH V+ +L  N   K++             + LAT+  +A + W        P 
Sbjct: 10  NDIVYGVHAVTESLQANTGNKLYIQEDLRGKKVDNIKSLATQKKVA-ISWT-------PK 61

Query: 94  KTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAV------RNSQLLMVLDHVNDPHNI 147
           KT+   T        AVHQG  L  +      +D +        + L+++LD + DPHN+
Sbjct: 62  KTLSQMT------DGAVHQGFVLRVSAFAYTDVDEILEIAEQEANPLILILDGLTDPHNL 115

Query: 148 GAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGF 207
           G+ILR+A A +  G+I  K  S   + V++K+++GA+EHIP  R++NL+  L K+ + GF
Sbjct: 116 GSILRTADATNVCGVIIPKHRSVGVTPVVSKTSTGAVEHIPIARVTNLSQTLDKLKARGF 175

Query: 208 QTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSN 267
              G   +   P +    N K+AL++G EGKG+    ++    M  + M G +++LN S 
Sbjct: 176 WIFGTDMNG-TPSDCWNTNGKLALVIGNEGKGISTNIKKQVDEMITIPMNGHVQSLNASV 234

Query: 268 AAAVALY 274
           AAA+ +Y
Sbjct: 235 AAAILMY 241


>gi|322411058|gb|EFY01966.1| putative tRNA/rRNA methyltransferase [Streptococcus dysgalactiae
           subsp. dysgalactiae ATCC 27957]
          Length = 248

 Score =  114 bits (286), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 77/239 (32%), Positives = 131/239 (54%), Gaps = 19/239 (7%)

Query: 48  NLFLYGVHTVSAALN-NPSRKIF--QLLATKNA--LARLDWDANLPHPF-PVKTVPPQTI 101
           N  +YGVH V+ +L+ N   K++  + L  KN   + RL  +  +   + P KT+   T 
Sbjct: 10  NDIVYGVHAVTESLHANTGNKLYIQEDLRGKNVDNIKRLATEKKVSISWTPKKTLSEMT- 68

Query: 102 DKIVGKEAVHQGLALETAPLLSPTLDAV------RNSQLLMVLDHVNDPHNIGAILRSAV 155
                + AVHQG  L  +      LD +       ++ L+++LD + DPHN+G+ILR+A 
Sbjct: 69  -----EGAVHQGFVLRVSAFAYTELDVILEKAEQEDNPLILILDGLTDPHNLGSILRTAD 123

Query: 156 AFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSD 215
           A +  G+I  K  +   + V++K+++GA+EH+   R++NL+  L K+ + GF T G   +
Sbjct: 124 ATNVCGVIIPKHRAVGVTPVVSKTSTGAVEHVLIARVTNLSQTLDKLKAKGFWTFGTDMN 183

Query: 216 SKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
              P  +   + K+ALI+G EGKG+    ++    M  + M G +++LN S AAA+ +Y
Sbjct: 184 G-TPSHRWNTSGKLALIIGNEGKGISANIKKQVDEMITIPMNGHVQSLNASVAAAILMY 241


>gi|184154739|ref|YP_001843079.1| RNA methyltransferase [Lactobacillus fermentum IFO 3956]
 gi|183226083|dbj|BAG26599.1| RNA methyltransferase [Lactobacillus fermentum IFO 3956]
          Length = 251

 Score =  114 bits (286), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 82/245 (33%), Positives = 134/245 (54%), Gaps = 19/245 (7%)

Query: 43  TSQPENLFLYGVHTVSAALNNPSR--KIFQLLATK-NALARLDWDANLPHPFPVKTVPPQ 99
           T++  + F+ G H   AAL +     K+F     K +A+A+L   A   H   +  VP  
Sbjct: 3   TNEENSEFIIGRHPAMAALKSDQEINKVFIQKGLKTDAIAQLVKSAKERH-LVISNVPKT 61

Query: 100 TIDKIVGKEAVHQGLALETAPLLSPTLD------AVRNSQ-LLMVLDHVNDPHNIGAILR 152
            +D++   +  HQG+AL  A     T+D      A ++ +   ++LD + DPHN+G+ILR
Sbjct: 62  KLDQMTAGQN-HQGVALAVAAYQYATVDDLFENAAQKDEEPFFLILDELADPHNLGSILR 120

Query: 153 SAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDA---LQKMHSWGFQT 209
           +A A    GII  KR S   ++V+AK+++GA+EH+P  R++NL      LQK   W F T
Sbjct: 121 TADAAGVHGIIIPKRRSVGLTSVVAKTSTGAIEHVPVARVTNLVQVAKELQKRGVWLFGT 180

Query: 210 IGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAA 269
               +D ++    + K   +AL++G EGKG+ P  ++T   M  + M G +++LN S AA
Sbjct: 181 DMQGTDCRR---WDAKG-AVALVIGNEGKGISPLLKKTCDEMLTIPMIGHVQSLNASVAA 236

Query: 270 AVALY 274
           ++ +Y
Sbjct: 237 SLLIY 241


>gi|312884705|ref|ZP_07744406.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Vibrio caribbenthicus
           ATCC BAA-2122]
 gi|309367618|gb|EFP95169.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Vibrio caribbenthicus
           ATCC BAA-2122]
          Length = 246

 Score =  114 bits (286), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 79/236 (33%), Positives = 124/236 (52%), Gaps = 10/236 (4%)

Query: 48  NLFLYGVHTVSAALN-NPSRKI--FQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKI 104
           N F+YG+H V A L   P R I  F L   ++   R   +        ++ +  +T+D  
Sbjct: 3   NEFIYGIHAVKAVLEREPERFIEAFVLKGRQDDRLRPILNDLQVCGVSIQLMTRKTLDD- 61

Query: 105 VGKEAVHQGLALETAP--LLSP-TLD---AVRNSQLLMVLDHVNDPHNIGAILRSAVAFS 158
             K A HQG+     P  LL+   LD   A   + LL+VLD V DPHN+GA LR+A A  
Sbjct: 62  KAKGANHQGIMARVKPAKLLNEHDLDNIIAQHTAPLLLVLDGVTDPHNLGACLRNADAAG 121

Query: 159 CDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKK 218
              +I  K  S + +A ++K A GA E +P IR++NL   ++ +   G   +G + ++ +
Sbjct: 122 VAAVIVPKDKSANINATVSKVACGAAETVPLIRVTNLARTMRALQEQGVWFVGTAGEATQ 181

Query: 219 PLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
            + Q      +A+++GAEG G+R  T+ET   +  + M G + +LNVS A+ V L+
Sbjct: 182 DIYQAKLTGALAIVMGAEGDGMRRLTRETCDDLIKIPMAGTVSSLNVSVASGVCLF 237


>gi|50915006|ref|YP_060978.1| 23S rRNA Gm2251 methyltransferase [Streptococcus pyogenes
           MGAS10394]
 gi|50904080|gb|AAT87795.1| 23S rRNA Gm2251 methyltransferase [Streptococcus pyogenes
           MGAS10394]
          Length = 257

 Score =  114 bits (286), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 78/247 (31%), Positives = 127/247 (51%), Gaps = 35/247 (14%)

Query: 48  NLFLYGVHTVSAALN-NPSRKIF-------------QLLATKNALARLDWDANLPHPFPV 93
           N  +YGVH V+ +L  N   K++             + LAT+  +A + W        P 
Sbjct: 19  NDIVYGVHAVTESLQANTGNKLYIQEDLRGKKVDNIKSLATQKKVA-ISWT-------PK 70

Query: 94  KTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAV------RNSQLLMVLDHVNDPHNI 147
           KT+   T        AVHQG  L  +      +D +        + L+++LD + DPHN+
Sbjct: 71  KTLSQMT------DGAVHQGFVLRVSAFAYTDVDEILEIAEQEANPLILILDGLTDPHNL 124

Query: 148 GAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGF 207
           G+ILR+A A +  G+I  K  S   + V++K+++GA+EHIP  R++NL+  L K+ + GF
Sbjct: 125 GSILRTADATNVCGVIIPKHRSVGVTPVVSKTSTGAVEHIPIARVTNLSQILDKLKARGF 184

Query: 208 QTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSN 267
              G   +   P +    N K+AL++G EGKG+    ++    M  + M G +++LN S 
Sbjct: 185 WIFGTDMNG-TPSDCWNTNGKLALVIGNEGKGISTNIKKQVDEMITIPMNGHVQSLNASV 243

Query: 268 AAAVALY 274
           AAA+ +Y
Sbjct: 244 AAAILMY 250


>gi|114331604|ref|YP_747826.1| RNA methyltransferase [Nitrosomonas eutropha C91]
 gi|114308618|gb|ABI59861.1| 23S rRNA Gm-2251 2'-O-methyltransferase [Nitrosomonas eutropha C91]
          Length = 260

 Score =  114 bits (286), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 63/171 (36%), Positives = 96/171 (56%), Gaps = 5/171 (2%)

Query: 111 HQGLA-----LETAPLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITT 165
           HQG+A     L+    L   LD +     L+VLD V DPHN+GA LR A AF    +I  
Sbjct: 69  HQGVAAHVMKLQQYTALEDLLDGLTEPAFLLVLDGVKDPHNLGACLRVADAFGVHAVIVP 128

Query: 166 KRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIK 225
           K  +   SA + K ASGA++ +P+  ++NL   L+++   G   +G ++D+   L+    
Sbjct: 129 KDRAVGLSATVHKVASGAVDTVPFFAVTNLARTLRELKEEGIWIVGTTADASDTLDSITL 188

Query: 226 NDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYIT 276
              IA +LGAEG+G+R  T+ET   +  + M G I++LNVS +A + L+ T
Sbjct: 189 TRPIAWVLGAEGEGMRRLTRETCDQLVSIPMSGSIESLNVSVSAGICLFET 239


>gi|327468344|gb|EGF13829.1| RNA methyltransferase [Streptococcus sanguinis SK330]
          Length = 242

 Score =  114 bits (286), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 74/235 (31%), Positives = 121/235 (51%), Gaps = 9/235 (3%)

Query: 47  ENLFLYGVHTVSAALN-NPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIV 105
           +N  +YGVH V+ AL  N   K++     +        D        +   P +T+ ++ 
Sbjct: 3   KNDIVYGVHAVTEALAANTGNKLYIQDDLRGKKVDKIKDLAAEKKVSISWTPKKTLQEMT 62

Query: 106 GKEAVHQGLALETAPLLSPTLDAV------RNSQLLMVLDHVNDPHNIGAILRSAVAFSC 159
              AVHQG  L  A       + +      +++ LL++LD + DPHN+G+ILR+A A + 
Sbjct: 63  -DGAVHQGFVLRVAEFAYTDFEVLLKKAEQKDNPLLLILDGLTDPHNLGSILRTADATNV 121

Query: 160 DGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKP 219
            G+I  K  +   + V+AK+++GA+EHIP  R++NL+  L K+   GF   G       P
Sbjct: 122 AGVIIPKHRAVGVTPVVAKTSTGAIEHIPIARVTNLSQTLDKLKEAGFWIFGTDMQG-TP 180

Query: 220 LEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
             +     K+ALI+G EGKG+    ++    M  + M G +++LN S AAA+ +Y
Sbjct: 181 SHKWNTAGKLALIIGNEGKGISSNIKKQVDEMISIPMNGHVQSLNASVAAAILMY 235


>gi|315221313|ref|ZP_07863236.1| RNA methyltransferase, TrmH family, group 3 [Streptococcus
           anginosus F0211]
 gi|315189672|gb|EFU23364.1| RNA methyltransferase, TrmH family, group 3 [Streptococcus
           anginosus F0211]
          Length = 242

 Score =  114 bits (286), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 78/236 (33%), Positives = 123/236 (52%), Gaps = 13/236 (5%)

Query: 48  NLFLYGVHTVSAAL-NNPSRKIF--QLLATKNALARLDWDANLPHPFPVKTVPPQTIDKI 104
           N  +YGVH V+ AL  N   K++    L  KN     D  A       +     +T+ ++
Sbjct: 4   NDIVYGVHAVTEALMTNTGNKLYIQDDLRGKNVAKMKDLAA--EKKVSISWTSKKTLQEM 61

Query: 105 VGKEAVHQGLALETAPLLSPTLDAV------RNSQLLMVLDHVNDPHNIGAILRSAVAFS 158
               AVHQG  L  +       +A+        + LL++LD + DPHN+G+ILR+A A +
Sbjct: 62  T-DGAVHQGFVLRVSEFAYTDFEAMLKMAEREENPLLLILDGLTDPHNLGSILRTADATN 120

Query: 159 CDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKK 218
             G+I  K  +   + V+AK+++GA+EHIP  R++NL+ AL K+   GF   G   +   
Sbjct: 121 VTGVIIPKHRAVGVTPVVAKTSTGAVEHIPIARVTNLSQALDKLKHAGFWIFGTDMNG-T 179

Query: 219 PLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
           P  +     K+ALI+G EGKG+    ++    M  + M G +++LN S AAA+ +Y
Sbjct: 180 PSTKWNTAGKLALIIGNEGKGISANIKKQVDEMITIPMNGHVQSLNASVAAAILMY 235


>gi|104783862|ref|YP_610360.1| RNA methyltransferase [Pseudomonas entomophila L48]
 gi|95112849|emb|CAK17577.1| RNA methyltransferase, TrmH family, group 3 [Pseudomonas
           entomophila L48]
          Length = 247

 Score =  114 bits (285), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 75/232 (32%), Positives = 122/232 (52%), Gaps = 8/232 (3%)

Query: 51  LYGVHTVSAALNNPSRKIFQL-LATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEA 109
           +YGVH V A L +  +++ Q+ L+   +  R+     L     V+    +  +     E 
Sbjct: 7   IYGVHAVQALLQHHPKRVKQIWLSEGRSEPRIQALLALAAENRVQVGQAERRELDAWVEG 66

Query: 110 VHQGLALETAP-------LLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGI 162
           VHQG+  E +P       +L   L+      L++VLD V DPHN+GA LR+A A     +
Sbjct: 67  VHQGVVAEVSPSQVWGELMLEELLERTETPPLILVLDGVTDPHNLGACLRTADAAGATAV 126

Query: 163 ITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQ 222
           +  K  S S +AV+ K A GA E IP + ++NL+  L+K+   G   +G + ++++ + Q
Sbjct: 127 VIPKDKSASLTAVVRKVACGAAEVIPLVAVTNLSRTLEKLQQRGLWVVGTAGEAEQEIYQ 186

Query: 223 EIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
           +     + +I+GAEGKG+R  T+E    +  L M G + +LNVS A  V L+
Sbjct: 187 QDLTGPLVMIMGAEGKGMRRLTREHCDFLVKLPMAGSVSSLNVSVATGVCLF 238


>gi|262281995|ref|ZP_06059764.1| RNA methyltransferase [Streptococcus sp. 2_1_36FAA]
 gi|262262449|gb|EEY81146.1| RNA methyltransferase [Streptococcus sp. 2_1_36FAA]
          Length = 243

 Score =  114 bits (285), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 74/235 (31%), Positives = 120/235 (51%), Gaps = 9/235 (3%)

Query: 47  ENLFLYGVHTVSAALN-NPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIV 105
           +N  +YGVH V+ AL  N   K++     +        D        +   P +T+ ++ 
Sbjct: 3   KNDIVYGVHAVTEALAANTGNKLYIQDDLRGKKVDKIKDLAAEKKVSISWTPKKTLQEMT 62

Query: 106 GKEAVHQGLALETAPLLSPTLDAV------RNSQLLMVLDHVNDPHNIGAILRSAVAFSC 159
              AVHQG  L  A       + +       ++ LL++LD + DPHN+G+ILR+A A + 
Sbjct: 63  -DGAVHQGFVLRVAEFAYTDFEVLLKKAEQEDNPLLLILDGLTDPHNLGSILRTADATNV 121

Query: 160 DGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKP 219
            G+I  K  +   + V+AK+++GA+EHIP  R++NL+  L K+   GF   G       P
Sbjct: 122 AGVIIPKHRAVGVTPVVAKTSTGAIEHIPIARVTNLSQTLDKLKEAGFWIFGTDMQG-TP 180

Query: 220 LEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
             +     K+ALI+G EGKG+    ++    M  + M G +++LN S AAA+ +Y
Sbjct: 181 SHKWNTTGKLALIIGNEGKGISSNIKKQVDEMISIPMNGHVQSLNASVAAAILMY 235


>gi|299821035|ref|ZP_07052923.1| RNA methyltransferase [Listeria grayi DSM 20601]
 gi|299816700|gb|EFI83936.1| RNA methyltransferase [Listeria grayi DSM 20601]
          Length = 249

 Score =  114 bits (285), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 66/192 (34%), Positives = 107/192 (55%), Gaps = 15/192 (7%)

Query: 93  VKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLD------AVRNSQ-LLMVLDHVNDPH 145
           ++ VP Q IDK+V  E  HQG+A + +      LD      + RN Q   ++LD + DPH
Sbjct: 52  IQFVPKQKIDKVV--EGAHQGVAAQISAYQYAELDELFERASTRNEQPFFILLDELEDPH 109

Query: 146 NIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLT---DALQKM 202
           N+G+I+R+A A    GII   R S   +  +AK+++GA+EHIP +R++NL    D L+  
Sbjct: 110 NLGSIMRTADAVGAHGIIIPNRRSVGLTQTVAKASTGAIEHIPVVRVTNLNKTIDVLKDR 169

Query: 203 HSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKA 262
             W F T    S   + ++ ++    + +++G+EG G+    +E    + HL M G + +
Sbjct: 170 GLWIFGTDAKGSSDYRTMDVDM---PLGIVIGSEGAGMSRLVREKCDFLVHLPMKGKVTS 226

Query: 263 LNVSNAAAVALY 274
           LN S AA++ LY
Sbjct: 227 LNASVAASILLY 238


>gi|212695900|ref|ZP_03304028.1| hypothetical protein ANHYDRO_00433 [Anaerococcus hydrogenalis DSM
           7454]
 gi|212677023|gb|EEB36630.1| hypothetical protein ANHYDRO_00433 [Anaerococcus hydrogenalis DSM
           7454]
          Length = 237

 Score =  114 bits (285), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 69/199 (34%), Positives = 111/199 (55%), Gaps = 9/199 (4%)

Query: 84  DANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDHVND 143
           D N+P  F  K        KI G    HQG+ +E        LD +++ + LM+LD + D
Sbjct: 45  DKNVPIFFEDK----DYFSKISGN---HQGVEIEVEDYKYKDLDDLKDKKRLMILDQIED 97

Query: 144 PHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMH 203
           PHN+GAI+RSA AF  DGI+ ++R S   ++ + K+++GA+ +I    + N+  A++++ 
Sbjct: 98  PHNLGAIIRSAEAFGFDGIVISERRSAKVNSTVYKTSAGAINNIDIAMVKNINRAIKEIK 157

Query: 204 SWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKAL 263
              F   GL+ ++   + Q     KIAL++G EGKGL    +E    +  + M G I +L
Sbjct: 158 EENFWVYGLAGEADGDITQTDLTGKIALVVGNEGKGLSRLVRENCDGLIKIPMLGKINSL 217

Query: 264 NVSNAAAVALY--ITQNHF 280
           N S A+A+A+Y  + QN F
Sbjct: 218 NASVASAIAIYESLRQNGF 236


>gi|327462795|gb|EGF09117.1| tRNA (guanosine-2'-O-)-methyltransferase [Streptococcus sanguinis
           SK1057]
          Length = 242

 Score =  114 bits (285), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 74/235 (31%), Positives = 120/235 (51%), Gaps = 9/235 (3%)

Query: 47  ENLFLYGVHTVSAALN-NPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIV 105
           +N  +YGVH V+ AL  N   K++     +        D        +   P +T+ ++ 
Sbjct: 3   KNDIVYGVHAVTEALAANTGNKLYIQDDLRGKKVDKIKDLAAEKKVSISWTPKKTLQEMT 62

Query: 106 GKEAVHQGLALETAPLLSPTLDAV------RNSQLLMVLDHVNDPHNIGAILRSAVAFSC 159
             E VHQG  L  A       + +       ++ LL++LD + DPHN+G+ILR+A A + 
Sbjct: 63  DGE-VHQGFVLRVAEFAYTDFEVLLKKAEQEDNPLLLILDGLTDPHNLGSILRTADATNV 121

Query: 160 DGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKP 219
            G+I  K  +   + V+AK+++GA+EHIP  R++NL+  L K+   GF   G       P
Sbjct: 122 AGVIIPKHRAVGVTPVVAKTSTGAIEHIPIARVTNLSQTLDKLKEAGFWIFGTDMQG-TP 180

Query: 220 LEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
             +     K+ALI+G EGKG+    ++    M  + M G +++LN S AAA+ +Y
Sbjct: 181 SHKWNTAGKLALIIGNEGKGISTNIKKQVDEMISIPMNGHVQSLNASVAAAILMY 235


>gi|256546104|ref|ZP_05473457.1| 23S rRNA (guanosine-2'-O-)-methyltransferase RlmB (23SrRNA
           2'-O-methyltransferase) [Anaerococcus vaginalis ATCC
           51170]
 gi|256398221|gb|EEU11845.1| 23S rRNA (guanosine-2'-O-)-methyltransferase RlmB (23SrRNA
           2'-O-methyltransferase) [Anaerococcus vaginalis ATCC
           51170]
          Length = 237

 Score =  114 bits (285), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 69/199 (34%), Positives = 112/199 (56%), Gaps = 9/199 (4%)

Query: 84  DANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDHVND 143
           D N+P  +  K        KI G    HQG+ +E        LD +++ + LM+LD + D
Sbjct: 45  DENVPIFYEDK----DYFSKISGN---HQGVEIEVEDYKYKDLDDLKDKKRLMILDQIED 97

Query: 144 PHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMH 203
           PHN+GAI+RSA AF  DGII ++R S   ++ + K+++GA+ +I    + N+  A++++ 
Sbjct: 98  PHNLGAIIRSAEAFGFDGIIISERRSAKVNSTVYKTSAGAINNIDIAMVKNINRAIKEIK 157

Query: 204 SWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKAL 263
              F   GL+ +++  + Q     KIAL++G EGKGL    +E    +  + M G I +L
Sbjct: 158 KENFWVYGLAGEAEGDITQTDLTGKIALVVGNEGKGLSRLVRENCDGLIKIPMLGKINSL 217

Query: 264 NVSNAAAVALY--ITQNHF 280
           N S A+A+A+Y  + QN F
Sbjct: 218 NASVASAIAIYESLRQNGF 236


>gi|324992441|gb|EGC24362.1| RNA methyltransferase [Streptococcus sanguinis SK405]
          Length = 242

 Score =  114 bits (285), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 74/235 (31%), Positives = 120/235 (51%), Gaps = 9/235 (3%)

Query: 47  ENLFLYGVHTVSAALN-NPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIV 105
           +N  +YGVH V+ AL  N   K++     +        D        +   P +T+ ++ 
Sbjct: 3   KNDIVYGVHAVTEALAANTGNKLYIQDDLRGKKVDKIKDLAAEKKVSISWTPKKTLQEMT 62

Query: 106 GKEAVHQGLALETAPLLSPTLDAV------RNSQLLMVLDHVNDPHNIGAILRSAVAFSC 159
              AVHQG  L  A       + +       ++ LL++LD + DPHN+G+ILR+A A + 
Sbjct: 63  -DGAVHQGFVLRVAEFAYTDFEVLLKKAEQEDNPLLLILDGLTDPHNLGSILRTADATNV 121

Query: 160 DGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKP 219
            G+I  K  +   + V+AK+++GA+EHIP  R++NL+  L K+   GF   G       P
Sbjct: 122 AGVIIPKHRAVGVTPVVAKTSTGAIEHIPIARVTNLSQTLDKLKEAGFWIFGTDMQG-TP 180

Query: 220 LEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
             +     K+ALI+G EGKG+    ++    M  + M G +++LN S AAA+ +Y
Sbjct: 181 THKWNTAGKLALIIGNEGKGISSNIKKQVDEMISIPMNGHVQSLNASVAAAILMY 235


>gi|254283118|ref|ZP_04958086.1| RNA methyltransferase, TrmH family, group 3 [gamma proteobacterium
           NOR51-B]
 gi|219679321|gb|EED35670.1| RNA methyltransferase, TrmH family, group 3 [gamma proteobacterium
           NOR51-B]
          Length = 252

 Score =  114 bits (285), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 75/237 (31%), Positives = 122/237 (51%), Gaps = 16/237 (6%)

Query: 51  LYGVHTVSAALNNPSRKIFQLLATKNA----LARLDWDANLPHPFPVKTVPPQTIDKIVG 106
           ++G+H V +AL +    + +++  K      +  L+  A       ++  P   +D++V 
Sbjct: 5   IFGLHAVESALKHRPEALLRVMLQKGRDDKRMRELETLAR-NQGVTIERRPRTELDRLV- 62

Query: 107 KEAVHQGLALETAPLL-SPTLD--------AVRNSQLLMVLDHVNDPHNIGAILRSAVAF 157
            +  HQG+  E       P LD        A  ++ LL+VLD V DPHN+GA LRSA A 
Sbjct: 63  -DGRHQGVVAEIEQGADGPPLDEAGLMQRVAETSTPLLLVLDGVTDPHNLGACLRSADAA 121

Query: 158 SCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSK 217
               +I  K  S   +  + K A GA E +P++R++NL   L  + + G   +G + D++
Sbjct: 122 GVTAVIVPKNNSADLTPAVRKVACGAAEAVPFVRVTNLVRTLAALQAEGVWVVGTTGDAE 181

Query: 218 KPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
           + L  +     IAL++GAEG+G+R  TQE    + +L M G + +LNVS A  V L+
Sbjct: 182 QSLYAQDFAGPIALVMGAEGQGMRRLTQEQCDFLVYLPMAGEVSSLNVSVATGVCLF 238


>gi|154706093|ref|YP_001424432.1| 23S rRNA Gm2251 methyltransferase [Coxiella burnetii Dugway
           5J108-111]
 gi|164685717|ref|ZP_01945643.2| RNA methyltransferase, TrmH family, group 3 [Coxiella burnetii 'MSU
           Goat Q177']
 gi|165918586|ref|ZP_02218672.1| RNA methyltransferase, TrmH family, group 3 [Coxiella burnetii RSA
           334]
 gi|212218447|ref|YP_002305234.1| 23S rRNA Gm2251 methyltransferase [Coxiella burnetii CbuK_Q154]
 gi|154355379|gb|ABS76841.1| 23S rRNA Gm2251 methyltransferase [Coxiella burnetii Dugway
           5J108-111]
 gi|164601225|gb|EAX33789.2| RNA methyltransferase, TrmH family, group 3 [Coxiella burnetii 'MSU
           Goat Q177']
 gi|165917714|gb|EDR36318.1| RNA methyltransferase, TrmH family, group 3 [Coxiella burnetii RSA
           334]
 gi|212012709|gb|ACJ20089.1| 23S rRNA Gm2251 methyltransferase [Coxiella burnetii CbuK_Q154]
          Length = 270

 Score =  114 bits (285), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 75/238 (31%), Positives = 119/238 (50%), Gaps = 10/238 (4%)

Query: 51  LYGVHTVSAALNNPSRKIFQLLATKNAL-ARLDWDANLPHPFPVKTVPPQTIDKIVGKEA 109
           +YG+H VSA L+   ++I +L   +N    RL           VK +     +       
Sbjct: 27  IYGIHAVSAVLDAAPQRIVKLYVQENRDDQRLQSLVEKAKGLGVKVILLSRTELNTLSNE 86

Query: 110 VHQGLA--------LETAPLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDG 161
            HQG+         L+ + LLS  L       LL++LD V DPHN+GA LRSA AF    
Sbjct: 87  KHQGIVADCEEVENLDESALLS-LLKKRETPALLLILDGVKDPHNLGACLRSANAFGVRA 145

Query: 162 IITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLE 221
           +I  K  +   + V+ K A GA E  P+IR++NL+  +  +   G   +G + +++  ++
Sbjct: 146 VIAPKDRAVGVTPVVRKVACGAAEMTPFIRVTNLSRTIDWLQKEGVWIVGTAVEAETLIQ 205

Query: 222 QEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNH 279
           +      IA++LG+EG GLR  T+E    +A + + G +++LNVS A  + LY  Q  
Sbjct: 206 EIDLTGDIAIVLGSEGAGLRRLTKERCDFLAQIPLRGSVESLNVSVACGICLYEVQRQ 263


>gi|323526270|ref|YP_004228423.1| TrmH family RNA methyltransferase [Burkholderia sp. CCGE1001]
 gi|323383272|gb|ADX55363.1| RNA methyltransferase, TrmH family, group 3 [Burkholderia sp.
           CCGE1001]
          Length = 247

 Score =  114 bits (285), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 60/169 (35%), Positives = 98/169 (57%), Gaps = 5/169 (2%)

Query: 111 HQGLALETAPL-----LSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITT 165
           HQG+      L     L+  LD +  S L++VLD V DPHN+GA LR A A     +I  
Sbjct: 69  HQGVVARAGDLPLAQNLAELLDGINGSPLILVLDGVTDPHNLGACLRVADAAGAHAVIAP 128

Query: 166 KRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIK 225
           +  +   +A  AK ASGA + +PYI ++NL  AL+++   G   +G + ++ K L +   
Sbjct: 129 RDRAVGLNATAAKVASGAADTVPYITVTNLARALRELKDAGVWIVGTAGEATKSLYETEL 188

Query: 226 NDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
           +  +A+++GAEG+G+R  T++T   +  + M G +++LNVS A+ V L+
Sbjct: 189 DGPVAIVMGAEGEGMRRLTRDTCDVVMQIPMAGTVESLNVSVASGVCLF 237


>gi|212212578|ref|YP_002303514.1| 23S rRNA Gm2251 methyltransferase [Coxiella burnetii CbuG_Q212]
 gi|212010988|gb|ACJ18369.1| 23S rRNA Gm2251 methyltransferase [Coxiella burnetii CbuG_Q212]
          Length = 270

 Score =  114 bits (285), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 75/238 (31%), Positives = 119/238 (50%), Gaps = 10/238 (4%)

Query: 51  LYGVHTVSAALNNPSRKIFQLLATKNAL-ARLDWDANLPHPFPVKTVPPQTIDKIVGKEA 109
           +YG+H VSA L+   ++I +L   +N    RL           VK +     +       
Sbjct: 27  IYGIHAVSAVLDAAPQRIVKLYVQENRDDQRLQSLVEKAKGLGVKVILLSRTELNTLSNE 86

Query: 110 VHQGLA--------LETAPLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDG 161
            HQG+         L+ + LLS  L       LL++LD V DPHN+GA LRSA AF    
Sbjct: 87  KHQGIVADCEEVENLDESALLS-LLKKRETPALLLILDGVKDPHNLGACLRSANAFGVRA 145

Query: 162 IITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLE 221
           +I  K  +   + V+ K A GA E  P+IR++NL+  +  +   G   +G + +++  ++
Sbjct: 146 VIAPKDRAVGVTPVVRKVACGAAEMTPFIRVTNLSRTIDWLQKEGVWIVGTAVEAETLIQ 205

Query: 222 QEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNH 279
           +      IA++LG+EG GLR  T+E    +A + + G +++LNVS A  + LY  Q  
Sbjct: 206 EIDLTGDIAIVLGSEGGGLRRLTKERCDFLAQIPLRGSVESLNVSVACGICLYEVQRQ 263


>gi|325689008|gb|EGD31016.1| tRNA (guanosine-2'-O-)-methyltransferase [Streptococcus sanguinis
           SK115]
          Length = 242

 Score =  114 bits (285), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 74/235 (31%), Positives = 120/235 (51%), Gaps = 9/235 (3%)

Query: 47  ENLFLYGVHTVSAALN-NPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIV 105
           +N  +YGVH V+ AL  N   K++     +        D        +   P +T+ ++ 
Sbjct: 3   KNDIVYGVHAVTEALAANTGNKLYIQDDLRGKKVDKIKDLAAEKKVSISWTPKKTLQEMT 62

Query: 106 GKEAVHQGLALETAPLLSPTLDAV------RNSQLLMVLDHVNDPHNIGAILRSAVAFSC 159
              AVHQG  L  A       + +       ++ LL++LD + DPHN+G+ILR+A A + 
Sbjct: 63  -DGAVHQGFVLRVAEFAYTDFEVLLKKAEQEDNPLLLILDGLTDPHNLGSILRTADATNV 121

Query: 160 DGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKP 219
            G+I  K  +   + V+AK+++GA+EHIP  R++NL+  L K+   GF   G       P
Sbjct: 122 TGVIIPKHRAVGVTPVVAKTSTGAIEHIPIARVTNLSQTLDKLKEAGFWIFGTDMQG-TP 180

Query: 220 LEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
             +     K+ALI+G EGKG+    ++    M  + M G +++LN S AAA+ +Y
Sbjct: 181 SHKWNTAGKLALIIGNEGKGISSNIKKQVDEMISIPMNGHVQSLNASVAAAILMY 235


>gi|66043847|ref|YP_233688.1| RNA methyltransferase TrmH, group 3 [Pseudomonas syringae pv.
           syringae B728a]
 gi|63254554|gb|AAY35650.1| RNA methyltransferase TrmH, group 3 [Pseudomonas syringae pv.
           syringae B728a]
 gi|330971568|gb|EGH71634.1| RNA methyltransferase TrmH, group 3 [Pseudomonas syringae pv.
           aceris str. M302273PT]
          Length = 251

 Score =  114 bits (285), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 78/232 (33%), Positives = 114/232 (49%), Gaps = 8/232 (3%)

Query: 51  LYGVHTVSAAL-NNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEA 109
           +YGVH V A L ++P R     LA      R+     L     V     +  +     E 
Sbjct: 7   IYGVHAVEALLRHHPKRVKHIWLAEGRNDPRVQTLVALAAENRVTIGQAERREMDAWVEG 66

Query: 110 VHQGLALETAP-------LLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGI 162
           VHQG+  + +P       +L   LD    S LL+VLD V DPHN+GA LR+A A     +
Sbjct: 67  VHQGVVADVSPSQVWGEAMLDELLDRSEGSPLLLVLDGVTDPHNLGACLRTADAAGALAV 126

Query: 163 ITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQ 222
           I  K  S + +  + K A GA E IP + ++NL   L+K+   G   +G + +++  L Q
Sbjct: 127 IVPKDKSATLTPAVRKVACGAAEVIPLVAVTNLARTLEKLQQRGLWVVGTAGEAEVELYQ 186

Query: 223 EIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
           +       +I+GAEGKG+R  T+E    +  L M G + +LNVS A  V L+
Sbjct: 187 QDLTGPTIIIMGAEGKGMRRLTREHCDYLVRLPMAGSVSSLNVSVATGVCLF 238


>gi|308171987|ref|YP_003918692.1| 23S rRNA methyltransferase [Bacillus amyloliquefaciens DSM 7]
 gi|307604851|emb|CBI41222.1| 23S rRNA methyltransferase [Bacillus amyloliquefaciens DSM 7]
 gi|328551797|gb|AEB22289.1| 23S rRNA methyltransferase [Bacillus amyloliquefaciens TA208]
 gi|328910058|gb|AEB61654.1| 23S rRNA methyltransferase [Bacillus amyloliquefaciens LL3]
          Length = 249

 Score =  114 bits (284), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 68/235 (28%), Positives = 125/235 (53%), Gaps = 13/235 (5%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLATKNAL---ARLDWDANLPHPFPVKTVPPQTIDKIVG 106
           ++ G + V   L +  RK+++L   +N +   A+   +        ++ VP + +D++V 
Sbjct: 7   YVIGKNAVIETLKS-DRKLYKLWMAENTVKGQAQQVIELAKKQGITIQFVPRKKLDQMV- 64

Query: 107 KEAVHQGLALETAPLLSPTLDAV------RNSQ-LLMVLDHVNDPHNIGAILRSAVAFSC 159
            E  HQG+  + A      LD +      RN Q   ++LD + DPHN+G+I+R+A A   
Sbjct: 65  -EGQHQGVVAQVAAYEYAQLDELYKRAEERNEQPFFLILDELEDPHNLGSIMRTADAVGA 123

Query: 160 DGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKP 219
            GI+  KR +   +A +AK+++GA+EHIP ++++NL   L +M   G   +G  + +++ 
Sbjct: 124 HGIVIPKRRAVGLTATVAKASTGAIEHIPVVKVTNLARTLDEMKERGIWVVGTDASARED 183

Query: 220 LEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
                    +AL++G+EG+G+    +E    +  L M G + +LN S AA + +Y
Sbjct: 184 YRSMDGKMPLALVIGSEGRGMGRLVKEKCDFLIKLPMAGKVTSLNASVAAGLLMY 238


>gi|260663232|ref|ZP_05864124.1| RNA methyltransferase, TrmH family, group 3 [Lactobacillus
           fermentum 28-3-CHN]
 gi|260552424|gb|EEX25475.1| RNA methyltransferase, TrmH family, group 3 [Lactobacillus
           fermentum 28-3-CHN]
          Length = 251

 Score =  114 bits (284), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 82/245 (33%), Positives = 134/245 (54%), Gaps = 19/245 (7%)

Query: 43  TSQPENLFLYGVHTVSAALNNPSR--KIFQLLATK-NALARLDWDANLPHPFPVKTVPPQ 99
           T++  + F+ G H   AAL +     K+F     K +A+A+L   A   H   +  VP  
Sbjct: 3   TNEENSEFIIGRHPAMAALKSDQEINKVFIQKGLKTDAIAQLVKSAKERH-LVISNVPKT 61

Query: 100 TIDKIVGKEAVHQGLALETAPLLSPTLD------AVRNSQ-LLMVLDHVNDPHNIGAILR 152
            +D++   +  HQG+AL  A     T+D      A ++ +   ++LD + DPHN+G+ILR
Sbjct: 62  KLDQMTAGQN-HQGVALAVAAYQYATVDDLFENAAQKDEEPFFLILDELADPHNLGSILR 120

Query: 153 SAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDA---LQKMHSWGFQT 209
           +A A    GII  KR S   ++V+AK+++GA+EH+P  R++NL      LQK   W F T
Sbjct: 121 TADAAGVHGIIIPKRRSVGLTSVVAKTSTGAIEHVPVARVTNLVQVAKELQKRGVWLFGT 180

Query: 210 IGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAA 269
               +D ++    + K   +AL++G EGKG+ P  ++T   M  + M G +++LN S AA
Sbjct: 181 DMQGTDYRR---WDAKG-AVALVIGNEGKGISPLLKKTCDEMLTIPMIGHVQSLNASVAA 236

Query: 270 AVALY 274
           ++ +Y
Sbjct: 237 SLLIY 241


>gi|92113015|ref|YP_572943.1| RNA methyltransferase TrmH, group 3 [Chromohalobacter salexigens
           DSM 3043]
 gi|91796105|gb|ABE58244.1| 23S rRNA Gm-2251 2'-O-methyltransferase [Chromohalobacter
           salexigens DSM 3043]
          Length = 261

 Score =  114 bits (284), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 84/256 (32%), Positives = 133/256 (51%), Gaps = 18/256 (7%)

Query: 33  MQSFNQKSRHTSQPENL-FLYGVHTVSAAL--NNPSRKIFQLLATKNALARLDWDANLPH 89
           M+  + ++R  + PE L  +YGVH V A      P R+++  +    A ARL+    L  
Sbjct: 1   MKGKSSRTR-VATPEGLDAVYGVHAVRALFERGQPPRELW--IQEGRAEARLEALVALAR 57

Query: 90  PFPVKT--VPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAV---------RNSQLLMVL 138
              VK   V  +T+D  V + AVHQG+     PL + + +A+          +  LL++L
Sbjct: 58  QAGVKCAGVARETLDG-VARGAVHQGVIAFAPPLQAESEEALWFRLGAWQQSSPPLLLIL 116

Query: 139 DHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDA 198
           D V DPHN GA LRSA A    G+I  K  +   +A + K A GA +  P  +++NL  A
Sbjct: 117 DGVTDPHNFGACLRSADAAGAHGVIVPKDKAAPLNATVRKVACGAADVTPVYQVTNLARA 176

Query: 199 LQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPG 258
           + ++ + G   +G + +S + L        +A+++GAEGKG+R  T++    +A L M G
Sbjct: 177 MGRLKTHGVWIVGTAGESAQCLYDIDLAGPLAVVMGAEGKGMRRLTRDACDLLAKLPMAG 236

Query: 259 IIKALNVSNAAAVALY 274
            + +LNVS A  V L+
Sbjct: 237 SVSSLNVSVATGVCLF 252


>gi|187923698|ref|YP_001895340.1| RNA methyltransferase, TrmH family, group 3 [Burkholderia
           phytofirmans PsJN]
 gi|187714892|gb|ACD16116.1| RNA methyltransferase, TrmH family, group 3 [Burkholderia
           phytofirmans PsJN]
          Length = 247

 Score =  114 bits (284), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 60/169 (35%), Positives = 97/169 (57%), Gaps = 5/169 (2%)

Query: 111 HQGLALETAPL-----LSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITT 165
           HQG+      +     L+  LD +  S L++VLD V DPHN+GA LR A A     +I  
Sbjct: 69  HQGVVARAGDMPLAQNLAELLDGINGSPLILVLDGVTDPHNLGACLRVADAAGAHAVIAP 128

Query: 166 KRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIK 225
           +  +   +A  AK ASGA + +PYI ++NL  AL+++   G   +G + ++ K L     
Sbjct: 129 RDRAVGLNATAAKVASGAADTVPYITVTNLARALRELKDAGVWVVGTAGEATKSLYDTEL 188

Query: 226 NDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
           +  +AL++GAEG+G+R  T++T   +  + M G +++LNVS A+ V L+
Sbjct: 189 DGPVALVMGAEGEGMRRLTRDTCDVVMQIPMAGTVESLNVSVASGVCLF 237


>gi|118580099|ref|YP_901349.1| RNA methyltransferase [Pelobacter propionicus DSM 2379]
 gi|118502809|gb|ABK99291.1| RNA methyltransferase, TrmH family, group 3 [Pelobacter propionicus
           DSM 2379]
          Length = 251

 Score =  114 bits (284), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 70/235 (29%), Positives = 124/235 (52%), Gaps = 12/235 (5%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLATKNALA-RLDWDANLPHPFPVKTVPPQTID--KIVG 106
            ++GV+ V  AL    R+IF L     A   RLD    L     V+ +  +  D  ++ G
Sbjct: 5   LVFGVNPVREALRG-KREIFGLYVQSTATDHRLDKILELARERGVRVIRREREDLTRMCG 63

Query: 107 KEAVHQGLALETAPLLSPTLDAVRNSQ-------LLMVLDHVNDPHNIGAILRSAVAFSC 159
               HQG+AL+ AP     LD +  +         L+VLD + DPHN+GA++R+A     
Sbjct: 64  SSH-HQGMALKVAPFSYADLDDLIEAGDREDAAGFLLVLDGIQDPHNLGALIRTAACAGA 122

Query: 160 DGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKP 219
            G++  +  + + +    K+++GA+E I   +++N+  +L+K+   G+   GLS ++   
Sbjct: 123 SGVVIPRDRACAITPAAEKASAGAVETITVAQVTNIAQSLEKLKRSGYWVYGLSGEADAS 182

Query: 220 LEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
           L +   + KIAL++G EG+G+RP  ++   ++  + + G + +LN S A  +ALY
Sbjct: 183 LYEVAFSGKIALVIGGEGEGIRPLVRKQCDALVSIPLYGGVGSLNASVAGGIALY 237


>gi|324996031|gb|EGC27942.1| tRNA (guanosine-2'-O-)-methyltransferase [Streptococcus sanguinis
           SK678]
          Length = 242

 Score =  114 bits (284), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 74/235 (31%), Positives = 120/235 (51%), Gaps = 9/235 (3%)

Query: 47  ENLFLYGVHTVSAALN-NPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIV 105
           +N  +YGVH V+ AL  N   K++     +        D        +   P +T+ ++ 
Sbjct: 3   KNDIVYGVHAVTEALAANTGNKLYIQDDLRGKKVDKIKDLAAEKKVSISWTPKKTLQEMT 62

Query: 106 GKEAVHQGLALETAPLLSPTLDAV------RNSQLLMVLDHVNDPHNIGAILRSAVAFSC 159
              AVHQG  L  A       + +       ++ LL++LD + DPHN+G+ILR+A A + 
Sbjct: 63  AG-AVHQGFVLRVAEFAYTDFEVLFKKAEQEDNPLLLILDGLTDPHNLGSILRTADATNV 121

Query: 160 DGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKP 219
            G+I  K  +   + V+AK+++GA+EHIP  R++NL+  L K+   GF   G       P
Sbjct: 122 AGVIIPKHRAVGVTPVVAKTSTGAIEHIPIARVTNLSQTLDKLKEAGFWIFGTDMQG-TP 180

Query: 220 LEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
             +     K+ALI+G EGKG+    ++    M  + M G +++LN S AAA+ +Y
Sbjct: 181 SHKWNTAGKLALIIGNEGKGISSNIKKQVDEMISIPMNGHVQSLNASVAAAILMY 235


>gi|296333093|ref|ZP_06875547.1| 23S rRNA methyltransferase [Bacillus subtilis subsp. spizizenii
           ATCC 6633]
 gi|305672795|ref|YP_003864466.1| 23S rRNA methyltransferase [Bacillus subtilis subsp. spizizenii
           str. W23]
 gi|296149709|gb|EFG90604.1| 23S rRNA methyltransferase [Bacillus subtilis subsp. spizizenii
           ATCC 6633]
 gi|305411038|gb|ADM36156.1| 23S rRNA methyltransferase [Bacillus subtilis subsp. spizizenii
           str. W23]
          Length = 249

 Score =  114 bits (284), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 69/235 (29%), Positives = 125/235 (53%), Gaps = 13/235 (5%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLATKNAL---ARLDWDANLPHPFPVKTVPPQTIDKIVG 106
           ++ G + V   L +  RK+++L   +N +   A+   +        ++ VP + +D++V 
Sbjct: 7   YVIGKNAVIETLKS-DRKLYKLWMAENTVKGQAQQVIELAKKQGITIQYVPRKKLDQMVT 65

Query: 107 KEAVHQGLALETAPLLSPTLDAV------RNSQ-LLMVLDHVNDPHNIGAILRSAVAFSC 159
            +  HQG+  + A      LD +      RN Q   ++LD + DPHN+G+I+R+A A   
Sbjct: 66  GQ--HQGVVAQVAAYEYAELDDLYKAAEERNEQPFFLILDELEDPHNLGSIMRTADAVGA 123

Query: 160 DGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKP 219
            GI+  KR +   +  +AK+++GA+EHIP  R++NL   L++M   G   +G  + +++ 
Sbjct: 124 HGIVIPKRRAVGLTTTVAKASTGAIEHIPVARVTNLARTLEEMKERGIWVVGTDASARED 183

Query: 220 LEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
                 N  +AL++G+EGKG+    +E    +  L M G + +LN S AA + +Y
Sbjct: 184 YRNMDGNMPLALVIGSEGKGMGRLVKEKCDFLIKLPMAGKVTSLNASVAAGLLMY 238


>gi|160871681|ref|ZP_02061813.1| RNA methyltransferase, TrmH family, group 3 [Rickettsiella grylli]
 gi|159120480|gb|EDP45818.1| RNA methyltransferase, TrmH family, group 3 [Rickettsiella grylli]
          Length = 253

 Score =  114 bits (284), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 78/245 (31%), Positives = 121/245 (49%), Gaps = 15/245 (6%)

Query: 44  SQPENLFLYGVHTVSAALNNPSRKIFQLLATKNAL-ARLDWDANLP--HPFPVKTVPPQT 100
           +QPE  F++G HT++A L +  +KI  L   ++    R+    NL   H  P+ T+    
Sbjct: 3   NQPEKEFIFGFHTITALLKSAPQKIDTLYCREDRQDKRVQSIRNLAKLHGIPIGTLSKVQ 62

Query: 101 IDKIVGKEAVHQGLALETAP-----------LLSPTLDAVRNSQLLMVLDHVNDPHNIGA 149
            ++I    AVHQG+  +               L   L    N   L+VLD V DPHN+GA
Sbjct: 63  CNEI-APNAVHQGVFAKIKKTSRLNEQDLMIFLHHRLHNNLNPPFLLVLDGVQDPHNLGA 121

Query: 150 ILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQT 209
            LRSA A   D +I  +  + +++ ++ K+A+GA E      ++NL   L+++   G   
Sbjct: 122 CLRSANAAGVDAVIIPQDRAVNKTPIVQKTAAGAAEVTSLFTVTNLATCLERLKKCGIWC 181

Query: 210 IGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAA 269
            GL     + +        +AL+LGAEGKGLR  T+     +  + M G + +LNVS AA
Sbjct: 182 YGLDQSGTRLIYDAPLTGPLALVLGAEGKGLRRLTKVCCDDLVAIPMVGTVGSLNVSVAA 241

Query: 270 AVALY 274
            V L+
Sbjct: 242 GVGLF 246


>gi|190573530|ref|YP_001971375.1| putative tRNA/rRNA methyltransferase [Stenotrophomonas maltophilia
           K279a]
 gi|190011452|emb|CAQ45070.1| putative tRNA/rRNA methyltransferase [Stenotrophomonas maltophilia
           K279a]
          Length = 247

 Score =  114 bits (284), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 78/236 (33%), Positives = 123/236 (52%), Gaps = 13/236 (5%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLATKNA----LARLDWDANLPHPFPVKTVPPQTIDKIV 105
           ++ GV+ V++++ N +  + ++L    A    L  ++ +A       V+ V  Q +D  V
Sbjct: 7   WIVGVNAVASSIENDAENVREVLVEAGAKNPRLTEIEENAR-RKGIDVRKVNSQALDG-V 64

Query: 106 GKEAVHQGLALETAPL-------LSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFS 158
           G    HQG+A   A         L   + A     LL+VLD V DPHN+GA LRSA A  
Sbjct: 65  GGSVRHQGVAARYAAARTYSENELEGLVTAAEGKALLLVLDEVQDPHNLGACLRSAAAAG 124

Query: 159 CDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKK 218
              +I  K  S + +A + K+++GA + IP + ++NL+  L+ +   G    GL+ ++  
Sbjct: 125 ATAVIIPKDKSATVNATVRKTSAGAADLIPVVAVTNLSRCLKDLQKQGVWIYGLAGEATA 184

Query: 219 PLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
            L Q      IAL+LG E  GLR  T+E    +  + MPG I++LNVS AA V+L+
Sbjct: 185 SLYQLDLKGNIALVLGGEADGLRRLTRENCDGLVKIPMPGEIESLNVSVAAGVSLF 240


>gi|332307764|ref|YP_004435615.1| RNA methyltransferase, TrmH family, group 3 [Glaciecola agarilytica
           4H-3-7+YE-5]
 gi|332175093|gb|AEE24347.1| RNA methyltransferase, TrmH family, group 3 [Glaciecola agarilytica
           4H-3-7+YE-5]
          Length = 246

 Score =  114 bits (284), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 78/237 (32%), Positives = 120/237 (50%), Gaps = 16/237 (6%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDAN--LPHP----FPVKTVPPQTIDK 103
           +LYG+H + A +     ++ +L   K    R D   N  + H       V+    +T+D 
Sbjct: 6   WLYGIHALEAVIEREPERLIELFVLK---GRDDKPINTIINHARKFGIAVQFCQRKTLDD 62

Query: 104 IVGKEAVHQGLALETAP---LLSPTLDAV---RNSQLLMVLDHVNDPHNIGAILRSAVAF 157
            V  E  HQG+  +  P        LD +     +  L+VLD V DPHN+GA LR+A A 
Sbjct: 63  KVNGEQ-HQGVVAKAKPGKQFNENDLDDIIKKSATPFLLVLDGVTDPHNLGACLRTADAA 121

Query: 158 SCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSK 217
             D I+  K  S + + V+ K A GA + IP I+++NL   L+++   G   +G + ++ 
Sbjct: 122 GIDAIVVPKDNSVALTPVVRKVACGAADLIPLIQVTNLARTLREIKDAGVWVVGTAGEAT 181

Query: 218 KPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
           + + Q      IAL++GAEGKG+R  T+E    +  L M G + +LNVS A  V LY
Sbjct: 182 QSIYQCKMQGPIALVMGAEGKGMRRLTREHCDELIKLPMAGSVSSLNVSVATGVCLY 238


>gi|71735318|ref|YP_272875.1| RNA methyltransferase [Pseudomonas syringae pv. phaseolicola 1448A]
 gi|289624605|ref|ZP_06457559.1| RNA methyltransferase [Pseudomonas syringae pv. aesculi str.
           NCPPB3681]
 gi|71555871|gb|AAZ35082.1| RNA methyltransferase, TrmH family, group 3 [Pseudomonas syringae
           pv. phaseolicola 1448A]
 gi|320321875|gb|EFW77971.1| RNA methyltransferase [Pseudomonas syringae pv. glycinea str. B076]
 gi|320331020|gb|EFW86994.1| RNA methyltransferase [Pseudomonas syringae pv. glycinea str. race
           4]
 gi|330865903|gb|EGH00612.1| RNA methyltransferase [Pseudomonas syringae pv. aesculi str.
           0893_23]
 gi|330984552|gb|EGH82655.1| RNA methyltransferase [Pseudomonas syringae pv. lachrymans str.
           M301315]
          Length = 253

 Score =  114 bits (284), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 78/232 (33%), Positives = 114/232 (49%), Gaps = 8/232 (3%)

Query: 51  LYGVHTVSAAL-NNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEA 109
           +YGVH V A L ++P R     LA      R+     L     V     +  +     E 
Sbjct: 7   IYGVHAVEALLRHHPKRVKHIWLAEGRNDPRVQTLVALAGENRVTIGQAERREMDAWVEG 66

Query: 110 VHQGLALETAP-------LLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGI 162
           VHQG+  + +P       +L   LD    S LL+VLD V DPHN+GA LR+A A     +
Sbjct: 67  VHQGVVADVSPSQVWGEAMLDELLDRSEGSPLLLVLDGVTDPHNLGACLRTADAAGALAV 126

Query: 163 ITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQ 222
           I  K  S + +  + K A GA E IP + ++NL   L+K+   G   +G + +++  L Q
Sbjct: 127 IVPKDKSATLTPAVRKVACGAAEVIPLVAVTNLARTLEKLQQRGLWVVGTAGEAEVELYQ 186

Query: 223 EIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
           +       +I+GAEGKG+R  T+E    +  L M G + +LNVS A  V L+
Sbjct: 187 QDLTGPTIIIMGAEGKGMRRLTREHCDYLVRLPMAGSVSSLNVSVATGVCLF 238


>gi|91783279|ref|YP_558485.1| RNA methyltransferase TrmH, group 3 [Burkholderia xenovorans LB400]
 gi|91687233|gb|ABE30433.1| 23S rRNA Gm-2251 2'-O-methyltransferase [Burkholderia xenovorans
           LB400]
          Length = 247

 Score =  114 bits (284), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 60/169 (35%), Positives = 97/169 (57%), Gaps = 5/169 (2%)

Query: 111 HQGLALETAPL-----LSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITT 165
           HQG+      +     L+  LD +  S L++VLD V DPHN+GA LR A A     +I  
Sbjct: 69  HQGVVARAGDMPLAQNLAELLDGINGSPLILVLDGVTDPHNLGACLRVADAAGAHAVIAP 128

Query: 166 KRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIK 225
           +  +   +A  AK ASGA + +PYI ++NL  AL+++   G   +G + ++ K L     
Sbjct: 129 RDRAVGLNATAAKVASGAADTVPYITVTNLARALRELKDAGVWVVGTAGEATKSLYDTEL 188

Query: 226 NDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
           +  +AL++GAEG+G+R  T++T   +  + M G +++LNVS A+ V L+
Sbjct: 189 DGPVALVMGAEGEGMRRLTRDTCDVVMQIPMAGTVESLNVSVASGVCLF 237


>gi|323495502|ref|ZP_08100576.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Vibrio sinaloensis
           DSM 21326]
 gi|323319383|gb|EGA72320.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Vibrio sinaloensis
           DSM 21326]
          Length = 245

 Score =  114 bits (284), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 79/241 (32%), Positives = 120/241 (49%), Gaps = 20/241 (8%)

Query: 48  NLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLP--HPFPVKTVPPQTI---- 101
           N F+YG+H V A L     +  +    K    R D D  +P  +   V  V  Q +    
Sbjct: 3   NEFIYGIHAVKAVLEREPERFIEAFVLK---GRQD-DRLMPILNELQVCGVSIQQMTRKT 58

Query: 102 --DKIVGKEAVHQGLALETAP---LLSPTLDAV---RNSQLLMVLDHVNDPHNIGAILRS 153
             DK  G  A HQG+     P   L    LD +     S LL+VLD V DPHN+GA LR+
Sbjct: 59  LDDKARG--ANHQGIMARVKPAKQLNENDLDDILAKHESPLLLVLDGVTDPHNLGACLRN 116

Query: 154 AVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLS 213
           A A     +I  K  S + +A ++K A GA E +P +R++NL   ++ +   G   +G +
Sbjct: 117 ADAAGVAAVIVPKDKSANITATVSKVACGAAEAVPLVRVTNLARTMRALQEQGVWFVGTA 176

Query: 214 SDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVAL 273
            ++   + Q      +A+++GAEG G+R  T+ET   +  + M G + +LNVS A+ V L
Sbjct: 177 GEATHDIYQAKLTGSLAIVMGAEGDGMRRLTRETCDDLIKIPMAGSVSSLNVSVASGVCL 236

Query: 274 Y 274
           +
Sbjct: 237 F 237


>gi|296157637|ref|ZP_06840471.1| RNA methyltransferase, TrmH family, group 3 [Burkholderia sp.
           Ch1-1]
 gi|295891883|gb|EFG71667.1| RNA methyltransferase, TrmH family, group 3 [Burkholderia sp.
           Ch1-1]
          Length = 247

 Score =  114 bits (284), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 60/169 (35%), Positives = 97/169 (57%), Gaps = 5/169 (2%)

Query: 111 HQGLALETAPL-----LSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITT 165
           HQG+      +     L+  LD +  S L++VLD V DPHN+GA LR A A     +I  
Sbjct: 69  HQGVVARAGDMPLAQNLAELLDGINGSPLILVLDGVTDPHNLGACLRVADAAGAHAVIAP 128

Query: 166 KRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIK 225
           +  +   +A  AK ASGA + +PYI ++NL  AL+++   G   +G + ++ K L     
Sbjct: 129 RDRAVGLNATAAKVASGAADTVPYITVTNLARALRELKDAGVWVVGTAGEATKSLYDTEL 188

Query: 226 NDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
           +  +AL++GAEG+G+R  T++T   +  + M G +++LNVS A+ V L+
Sbjct: 189 DGPVALVMGAEGEGMRRLTRDTCDVVMQIPMAGTVESLNVSVASGVCLF 237


>gi|302185448|ref|ZP_07262121.1| RNA methyltransferase [Pseudomonas syringae pv. syringae 642]
 gi|330899904|gb|EGH31323.1| RNA methyltransferase [Pseudomonas syringae pv. japonica str.
           M301072PT]
 gi|330978939|gb|EGH77998.1| RNA methyltransferase [Pseudomonas syringae pv. aptata str. DSM
           50252]
          Length = 253

 Score =  114 bits (284), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 78/232 (33%), Positives = 114/232 (49%), Gaps = 8/232 (3%)

Query: 51  LYGVHTVSAAL-NNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEA 109
           +YGVH V A L ++P R     LA      R+     L     V     +  +     E 
Sbjct: 7   IYGVHAVEALLRHHPKRVKHIWLAEGRNDPRVQTLVALAAENRVTIGQAERREMDAWVEG 66

Query: 110 VHQGLALETAP-------LLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGI 162
           VHQG+  + +P       +L   LD    S LL+VLD V DPHN+GA LR+A A     +
Sbjct: 67  VHQGVVADVSPSQVWGEAMLDELLDRSEGSPLLLVLDGVTDPHNLGACLRTADAAGALAV 126

Query: 163 ITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQ 222
           I  K  S + +  + K A GA E IP + ++NL   L+K+   G   +G + +++  L Q
Sbjct: 127 IVPKDKSATLTPAVRKVACGAAEVIPLVAVTNLARTLEKLQQRGLWVVGTAGEAEVELYQ 186

Query: 223 EIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
           +       +I+GAEGKG+R  T+E    +  L M G + +LNVS A  V L+
Sbjct: 187 QDLTGPTIIIMGAEGKGMRRLTREHCDYLVRLPMAGSVSSLNVSVATGVCLF 238


>gi|227514006|ref|ZP_03944055.1| TrmH family tRNA/rRNA methyltransferase [Lactobacillus fermentum
           ATCC 14931]
 gi|227087650|gb|EEI22962.1| TrmH family tRNA/rRNA methyltransferase [Lactobacillus fermentum
           ATCC 14931]
          Length = 251

 Score =  114 bits (284), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 82/245 (33%), Positives = 134/245 (54%), Gaps = 19/245 (7%)

Query: 43  TSQPENLFLYGVHTVSAALNNPSR--KIFQLLATK-NALARLDWDANLPHPFPVKTVPPQ 99
           T++  + F+ G H   AAL +     K+F     K +A+A+L   A   H   +  VP  
Sbjct: 3   TNEENSEFIIGRHPAMAALKSDQEINKVFIQKGLKTDAIAQLVKSAKERH-LVISNVPKT 61

Query: 100 TIDKIVGKEAVHQGLALETAPLLSPTLD------AVRNSQ-LLMVLDHVNDPHNIGAILR 152
            +D++   +  HQG+AL  A     T+D      A ++ +   ++LD + DPHN+G+ILR
Sbjct: 62  KLDQMTAGQN-HQGVALAVAAYQYATVDDLFENAAQKDEEPFFLILDELADPHNLGSILR 120

Query: 153 SAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDA---LQKMHSWGFQT 209
           +A A    GII  KR S   ++V+AK+++GA+EH+P  R++NL      LQK   W F T
Sbjct: 121 TADAAGVHGIIIPKRRSVGLTSVVAKTSTGAIEHVPVARVTNLVQVAKELQKSGVWLFGT 180

Query: 210 IGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAA 269
               +D ++    + K   +AL++G EGKG+ P  ++T   M  + M G +++LN S AA
Sbjct: 181 DMQGTDYRR---WDAKG-AVALVIGNEGKGISPLLKKTCDEMLTIPMIGHVQSLNASVAA 236

Query: 270 AVALY 274
           ++ +Y
Sbjct: 237 SLLIY 241


>gi|126656120|ref|ZP_01727504.1| RNA methyltransferase TrmH, group 3 [Cyanothece sp. CCY0110]
 gi|126622400|gb|EAZ93106.1| RNA methyltransferase TrmH, group 3 [Cyanothece sp. CCY0110]
          Length = 291

 Score =  113 bits (283), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 78/261 (29%), Positives = 129/261 (49%), Gaps = 22/261 (8%)

Query: 31  KKMQSFNQKSRHTSQPENL---FLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANL 87
           K + S   +S  +++P+      +YG H+V AAL    R++ ++  T     RL +D   
Sbjct: 23  KPIISSRSQSNTSAEPQETDDDLIYGRHSVLAALEG-DRQLNRIWITN----RLHYDPRF 77

Query: 88  PHPFPVKTVPPQTIDKI-------VGKEAVHQGLALETAPLLSPTLD-------AVRNSQ 133
            +           ID++       +   A HQG+A + AP     LD       A  ++ 
Sbjct: 78  HNLIQGSKAKGAVIDEVSLQRLSQITNGANHQGVAAQVAPYTYHELDELITQAKANSDAP 137

Query: 134 LLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRIS 193
           ++++ D + DPHN+GAI+R+A A  C G+I  +R +   ++ ++K A+GALE  P  R+ 
Sbjct: 138 VIVIADGIADPHNLGAIIRTAEAMGCQGLIIPQRRAAGVTSTVSKVAAGALESFPVARVV 197

Query: 194 NLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAH 253
           NL+ AL+ +   GF   G  ++  K L        I L++G+EG GL   TQ     +  
Sbjct: 198 NLSRALETLKKEGFWIYGTVAEGGKRLHDFNFEGAIGLVIGSEGSGLSLLTQRCCDQLVS 257

Query: 254 LHMPGIIKALNVSNAAAVALY 274
           + + G   +LN S AAA+ LY
Sbjct: 258 IPLEGKTPSLNASVAAAINLY 278


>gi|313124317|ref|YP_004034576.1| RNA methyltransferase, trmh family, group 3 [Lactobacillus
           delbrueckii subsp. bulgaricus ND02]
 gi|312280880|gb|ADQ61599.1| RNA methyltransferase, TrmH family, group 3 [Lactobacillus
           delbrueckii subsp. bulgaricus ND02]
 gi|325685666|gb|EGD27748.1| TrmH family RNA methyltransferase [Lactobacillus delbrueckii subsp.
           lactis DSM 20072]
          Length = 249

 Score =  113 bits (283), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 73/241 (30%), Positives = 116/241 (48%), Gaps = 12/241 (4%)

Query: 44  SQPENLFLYGVHTVSAALNNPS----RKIFQLLATKNALARLDWDANLPHPFPVKTVPPQ 99
           S   N F++G H     L N       K+F     +   AR  +         ++ VP  
Sbjct: 2   SSTNNDFVFGRHAGIDFLKNQDSEKINKVFLAEGVQEDFAREVYRYAKKKHLIIQRVPKN 61

Query: 100 TIDKIVGKEAVHQGLALETAPLLSPTLDAV------RNSQLLMVLDHVNDPHNIGAILRS 153
            +DK+ G E  HQGL L  A       D +        +  L++LD++ DPHN+G+ILRS
Sbjct: 62  KLDKLTGGEN-HQGLVLAVASFEYADFDQLLDKLDQEEAPFLLMLDNIEDPHNLGSILRS 120

Query: 154 AVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLS 213
           A A    G+I  KR +   ++V+AK+++GA++H+P  R++NL    Q +   G+   G +
Sbjct: 121 ADATGVSGVIIPKRRASGLTSVVAKTSTGAIDHVPVARVNNLVQTCQALKDRGYWIFGTA 180

Query: 214 SDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVAL 273
            +      +   N K  L++G EGKG+ P   +       + M G +++LN S A  V L
Sbjct: 181 MEGDD-YRKWNANGKTVLVIGNEGKGISPLLLKQMDQTLTIPMIGHVQSLNASVATGVLL 239

Query: 274 Y 274
           Y
Sbjct: 240 Y 240


>gi|327460672|gb|EGF07007.1| RNA methyltransferase [Streptococcus sanguinis SK1]
 gi|332359937|gb|EGJ37751.1| RNA methyltransferase [Streptococcus sanguinis SK1056]
          Length = 242

 Score =  113 bits (283), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 74/235 (31%), Positives = 120/235 (51%), Gaps = 9/235 (3%)

Query: 47  ENLFLYGVHTVSAALN-NPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIV 105
           +N  +YGVH V+ AL  N   K++     +        D        +   P +T+ ++ 
Sbjct: 3   KNDIVYGVHAVTEALAANTGNKLYIQDDLRGKKVDKIKDLAAEKKVSISWTPKKTLQEMT 62

Query: 106 GKEAVHQGLALETAPLLSPTLDAV------RNSQLLMVLDHVNDPHNIGAILRSAVAFSC 159
              AVHQG  L  A       + +       ++ LL++LD + DPHN+G+ILR+A A + 
Sbjct: 63  -DGAVHQGFVLRVAEFAYTDFEVLLKKAEQEDNPLLLILDGLTDPHNLGSILRTADATNV 121

Query: 160 DGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKP 219
            G+I  K  +   + V+AK+++GA+EHIP  R++NL+  L K+   GF   G       P
Sbjct: 122 AGVIIPKHRAVGVTPVVAKTSTGAIEHIPIARVTNLSQTLDKLKEAGFWIFGTDMQG-TP 180

Query: 220 LEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
             +     K+ALI+G EGKG+    ++    M  + M G +++LN S AAA+ +Y
Sbjct: 181 SHKWNTAGKLALIIGNEGKGISSNIKKQVDEMISIPMNGHVQSLNASVAAAILMY 235


>gi|325695531|gb|EGD37431.1| tRNA (guanosine-2'-O-)-methyltransferase [Streptococcus sanguinis
           SK150]
          Length = 242

 Score =  113 bits (283), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 74/235 (31%), Positives = 120/235 (51%), Gaps = 9/235 (3%)

Query: 47  ENLFLYGVHTVSAALN-NPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIV 105
           +N  +YGVH V+ AL  N   K++     +        D        +   P +T+ ++ 
Sbjct: 3   KNDIVYGVHAVTEALAANTGNKLYIQDDLRGKKVDKIKDLAAEKKVSISWTPKKTLQEMT 62

Query: 106 GKEAVHQGLALETAPLLSPTLDAV------RNSQLLMVLDHVNDPHNIGAILRSAVAFSC 159
              AVHQG  L  A       + +       ++ LL++LD + DPHN+G+ILR+A A + 
Sbjct: 63  -DGAVHQGFVLRVAEFAYTDFEVLLKKAEQEDNPLLLILDGLTDPHNLGSILRTADATNV 121

Query: 160 DGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKP 219
            G+I  K  +   + V+AK+++GA+EHIP  R++NL+  L K+   GF   G       P
Sbjct: 122 AGVIIPKHRAVGVTPVVAKTSTGAIEHIPIARVTNLSQTLDKLKEAGFWIFGTDMQG-TP 180

Query: 220 LEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
             +     K+ALI+G EGKG+    ++    M  + M G +++LN S AAA+ +Y
Sbjct: 181 SHKWNTAGKLALIIGNEGKGISTNIKKQVDEMISIPMNGHVQSLNASVAAAILMY 235


>gi|194289992|ref|YP_002005899.1| 23S rRNA (guanosine-2'-o-)-methyltransferase rlmb (23S rRNA gm2251
           2'-o-methyltransferase) [Cupriavidus taiwanensis LMG
           19424]
 gi|193223827|emb|CAQ69834.1| 23S rRNA (guanosine-2'-O-)-methyltransferase rlmB (23S rRNA Gm2251
           2'-O-methyltransferase) [Cupriavidus taiwanensis LMG
           19424]
          Length = 247

 Score =  113 bits (283), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 74/233 (31%), Positives = 116/233 (49%), Gaps = 9/233 (3%)

Query: 50  FLYGVHTVSAALNNPSRKIFQL-LATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKE 108
            L G H V+A L    + +  + + +     R+     L     V+ + P   +++ G  
Sbjct: 6   LLIGFHAVTARLRQDPKGVSDIYIESARRDRRMQDFVRLAESLGVR-LHPVDAERLRGMA 64

Query: 109 AV--HQGLALETAPL-----LSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDG 161
               HQG+      +     L   LD +  + LL+VLD V DPHN+GA LR A       
Sbjct: 65  GTDRHQGVVARAEDVALALNLDELLDGIEGTPLLLVLDGVTDPHNLGACLRVADGAGAHA 124

Query: 162 IITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLE 221
           +I  K  S   +A +AK ASGA E +PYI ++NL   L+++   G   IG +  ++K L 
Sbjct: 125 VIAPKDRSVGLNATVAKVASGAAETVPYITVTNLARTLRELQERGIWVIGTADGTEKSLY 184

Query: 222 QEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
                   A+++GAEG+G+R  T+ET   +  + M G +++LNVS A+ V LY
Sbjct: 185 DIDFKGPTAIVMGAEGEGMRRLTRETCDELVGIPMAGGVESLNVSVASGVCLY 237


>gi|293572686|ref|ZP_06683654.1| RNA methyltransferase, TrmH family, group 3 [Enterococcus faecium
           E980]
 gi|291607272|gb|EFF36626.1| RNA methyltransferase, TrmH family, group 3 [Enterococcus faecium
           E980]
          Length = 286

 Score =  113 bits (283), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 74/261 (28%), Positives = 126/261 (48%), Gaps = 12/261 (4%)

Query: 24  RRNHRDYKKMQSFNQKSRHTSQP--ENLFLYGVHTVSAALNNP-SRKIFQLLATKNALAR 80
           ++N    KK    NQ     ++   E+ F++G H    AL      K+F    ++     
Sbjct: 19  KQNRYPNKKQTGRNQSVSDQNEEALEDNFVFGHHAAVEALQQGRGNKLFLQEDSRGEKVE 78

Query: 81  LDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAV-------RNSQ 133
              +       PVK VP Q ++ +     VHQG+ L   P    +LD +       +   
Sbjct: 79  ELKEIAREQAVPVKWVPKQKLETL-SNHGVHQGVVLAITPYEYLSLDQLIERTKEKKEDP 137

Query: 134 LLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRIS 193
             ++LD + DPHN G+ILR+A A   DG+I  K  +   + ++ K+++GA+E++P  R++
Sbjct: 138 FFLILDSIEDPHNFGSILRTADASGVDGVIIPKHRAVGITPIVTKTSTGAVEYVPVARVT 197

Query: 194 NLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAH 253
           NL  A+Q++   GF   G         +   K   IAL++G EGKG+ P  ++    +  
Sbjct: 198 NLVQAVQQLKEIGFWVFGTDMTGTNFQKWNAKGS-IALVIGNEGKGMSPGLKKEMDELLT 256

Query: 254 LHMPGIIKALNVSNAAAVALY 274
           + M G +++LN S AA + +Y
Sbjct: 257 IPMTGHVQSLNASVAAGLLMY 277


>gi|157150299|ref|YP_001449674.1| RNA methyltransferase [Streptococcus gordonii str. Challis substr.
           CH1]
 gi|157075093|gb|ABV09776.1| RNA methyltransferase, TrmH family, group 3 [Streptococcus gordonii
           str. Challis substr. CH1]
          Length = 243

 Score =  113 bits (283), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 73/235 (31%), Positives = 119/235 (50%), Gaps = 9/235 (3%)

Query: 47  ENLFLYGVHTVSAALN-NPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIV 105
           +N  +YGVH V+ AL  N   K++     +        D        +   P +T+ ++ 
Sbjct: 3   KNDIVYGVHAVTEALAANTGNKLYIQDDLRGKKVDKIKDLAAEKKVSISWTPKKTLQEMT 62

Query: 106 GKEAVHQGLALETAPLLSPTLDAV------RNSQLLMVLDHVNDPHNIGAILRSAVAFSC 159
              AVHQG  L  A       + +       ++ LL++LD + DPHN+G+ILR+A A + 
Sbjct: 63  -DGAVHQGFVLRVAEFAYTDFEVLLKKAEQEDNPLLLILDGLTDPHNLGSILRTADATNV 121

Query: 160 DGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKP 219
            G+I  K  +   + V+AK+++GA+EHIP  R++NL+  L K+   GF   G       P
Sbjct: 122 SGVIIPKHRAVGVTPVVAKTSTGAIEHIPIARVTNLSQTLDKLKEAGFWIFGTDMQG-TP 180

Query: 220 LEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
             +     K+ LI+G EGKG+    ++    M  + M G +++LN S AAA+ +Y
Sbjct: 181 SHKWNTGGKLVLIIGNEGKGISSNIKKQVDEMISIPMNGHVQSLNASVAAAILMY 235


>gi|323350497|ref|ZP_08086159.1| tRNA (guanosine-2'-O-)-methyltransferase [Streptococcus sanguinis
           VMC66]
 gi|322123179|gb|EFX94864.1| tRNA (guanosine-2'-O-)-methyltransferase [Streptococcus sanguinis
           VMC66]
          Length = 242

 Score =  113 bits (283), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 77/237 (32%), Positives = 124/237 (52%), Gaps = 13/237 (5%)

Query: 47  ENLFLYGVHTVSAALN-NPSRKIFQLLATKNALARLDWDANLP--HPFPVKTVPPQTIDK 103
           +N  +YGVH V+ AL  N   K++  +       ++D   NL       +   P +T+ +
Sbjct: 3   KNDIVYGVHAVTEALAANTGNKLY--IQDDLRGKKVDKIKNLAAEKKVSISWTPKKTLQE 60

Query: 104 IVGKEAVHQGLALETAPLLSPTLDAV------RNSQLLMVLDHVNDPHNIGAILRSAVAF 157
           +    AVHQG  L  A       + +       ++ LL++LD + DPHN+G+ILR+A A 
Sbjct: 61  MT-DGAVHQGFVLRVAEFAYTDFEVLLKKAEQEDNPLLLILDGLTDPHNLGSILRTADAT 119

Query: 158 SCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSK 217
           +  GII  K  +   + V+AK+++GA+EHIP  R++NL+  L K+   GF   G      
Sbjct: 120 NVAGIIIPKHRAVGVTPVVAKTSTGAIEHIPISRVTNLSQTLDKLKEAGFWIFGTDMQG- 178

Query: 218 KPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
            P  +     K+ALI+G EGKG+    ++    M  + M G +++LN S AAA+ +Y
Sbjct: 179 TPSHKWNTAGKLALIIGNEGKGISTNIKKQVDEMISIPMNGHVQSLNASVAAAILMY 235


>gi|227552719|ref|ZP_03982768.1| TrmH family tRNA/rRNA methyltransferase [Enterococcus faecium
           TX1330]
 gi|257897355|ref|ZP_05677008.1| RNA methyltransferase TrmH [Enterococcus faecium Com12]
 gi|293378883|ref|ZP_06625038.1| RNA methyltransferase, TrmH family, group 3 [Enterococcus faecium
           PC4.1]
 gi|227178119|gb|EEI59091.1| TrmH family tRNA/rRNA methyltransferase [Enterococcus faecium
           TX1330]
 gi|257833920|gb|EEV60341.1| RNA methyltransferase TrmH [Enterococcus faecium Com12]
 gi|292642424|gb|EFF60579.1| RNA methyltransferase, TrmH family, group 3 [Enterococcus faecium
           PC4.1]
          Length = 286

 Score =  113 bits (283), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 74/261 (28%), Positives = 126/261 (48%), Gaps = 12/261 (4%)

Query: 24  RRNHRDYKKMQSFNQKSRHTSQP--ENLFLYGVHTVSAALNNP-SRKIFQLLATKNALAR 80
           ++N    KK    NQ     ++   E+ F++G H    AL      K+F    ++     
Sbjct: 19  KQNRYPNKKQTGRNQSVSDQNEEALEDNFVFGHHAAVEALQQGRGNKLFLQEDSRGEKVE 78

Query: 81  LDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAV-------RNSQ 133
              +       PVK VP Q ++ +     VHQG+ L   P    +LD +       +   
Sbjct: 79  ELKEIAREQAVPVKWVPKQKLETL-SDHGVHQGVVLAITPYEYLSLDQLIERTKEKKEDP 137

Query: 134 LLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRIS 193
             ++LD + DPHN G+ILR+A A   DG+I  K  +   + ++ K+++GA+E++P  R++
Sbjct: 138 FFLILDSIEDPHNFGSILRTADASGVDGVIIPKHRAVGITPIVTKTSTGAVEYVPVARVT 197

Query: 194 NLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAH 253
           NL  A+Q++   GF   G         +   K   IAL++G EGKG+ P  ++    +  
Sbjct: 198 NLVQAVQQLKETGFWVFGTDMTGTNFQKWNAKGS-IALVIGNEGKGMSPGLKKEMDELLT 256

Query: 254 LHMPGIIKALNVSNAAAVALY 274
           + M G +++LN S AA + +Y
Sbjct: 257 IPMTGHVQSLNASVAAGLLMY 277


>gi|197119261|ref|YP_002139688.1| 23S rRNA (2'-O-methyl-G2251)-methyltransferase [Geobacter
           bemidjiensis Bem]
 gi|197088621|gb|ACH39892.1| 23S rRNA (2'-O-methyl-G2251)-methyltransferase [Geobacter
           bemidjiensis Bem]
          Length = 248

 Score =  113 bits (283), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 71/234 (30%), Positives = 128/234 (54%), Gaps = 11/234 (4%)

Query: 50  FLYGVHTVSAALNNPSRKIFQL-LATKNALARLDWDANLP--HPFPVKTVPPQTIDKIVG 106
            +YG++ V  AL   SR+I +L +A  +A  RL+    L      PV+      ++++ G
Sbjct: 6   IIYGLNPVMEALRG-SREIHELFVAGTSADKRLEKLLKLAAERKIPVRQREKGDLNRLCG 64

Query: 107 KEAVHQGLALETAPL----LSPTLDAVRNSQ--LLMVLDHVNDPHNIGAILRSAVAFSCD 160
            E  HQG+AL+  P     L   L+ ++ ++  L++VLD V DPHN+GA++RSA     +
Sbjct: 65  TEH-HQGVALKVEPFPYADLDDVLEGLQGTRDGLILVLDSVQDPHNLGALIRSAACAGAN 123

Query: 161 GIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPL 220
            ++  K  +   +AV  KS++GA E I   +++N++ AL+ +   GF   G    ++  L
Sbjct: 124 AVVIPKDRAAGVTAVAEKSSAGATETISVAQVTNISQALESLKKAGFWIYGADGSARHTL 183

Query: 221 EQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
            Q+     +AL++G EG+G+RP  ++   ++  + + G + +LN S A  + L+
Sbjct: 184 YQQDFTGPVALVIGGEGEGIRPLVRKGCDAVVSIPLQGGVNSLNASVAGGIFLF 237


>gi|332142968|ref|YP_004428706.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Alteromonas macleodii
           str. 'Deep ecotype']
 gi|332142987|ref|YP_004428725.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Alteromonas macleodii
           str. 'Deep ecotype']
 gi|327552990|gb|AEA99708.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Alteromonas macleodii
           str. 'Deep ecotype']
 gi|327553009|gb|AEA99727.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Alteromonas macleodii
           str. 'Deep ecotype']
          Length = 246

 Score =  113 bits (283), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 78/243 (32%), Positives = 118/243 (48%), Gaps = 14/243 (5%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLATKNA-LARLDWDANLPHPFPVKTVPPQT---IDKIV 105
           +LYG+H + + L     ++ ++   K     RL    N    F +     Q     DK+ 
Sbjct: 6   WLYGLHAMQSVLEKEPERVMEVWVLKGRNDDRLTNIVNQARRFGISVQFSQRKALDDKVS 65

Query: 106 GKEAVHQGLALETAP---LLSPTLDAVRNSQ---LLMVLDHVNDPHNIGAILRSAVAFSC 159
           G++  HQG+     P   L    LD +  S+   L++VLD V DPHN+GA LR+A     
Sbjct: 66  GEQ--HQGVVARAKPARVLDEADLDKILESEAQPLILVLDGVTDPHNLGACLRTADGAGV 123

Query: 160 DGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKP 219
             ++  K  S S +  + K A GA E +P I+I+NL   L+ +   G   +G + ++ K 
Sbjct: 124 HAVVVPKDKSASLNGTVRKVACGAAEVVPLIQITNLARTLKHLQDKGLWIVGTAGETDKT 183

Query: 220 LEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY--ITQ 277
           L         AL++GAEGKG+R  T+ET   +  L M G + +L VS A  V LY  + Q
Sbjct: 184 LYDVDLKGSTALVMGAEGKGMRRLTKETCDELVKLPMAGSVTSLYVSVATGVCLYEIVRQ 243

Query: 278 NHF 280
             F
Sbjct: 244 RGF 246


>gi|73541759|ref|YP_296279.1| RNA methyltransferase TrmH, group 3 [Ralstonia eutropha JMP134]
 gi|72119172|gb|AAZ61435.1| RNA methyltransferase TrmH, group 3 [Ralstonia eutropha JMP134]
          Length = 256

 Score =  113 bits (282), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 73/233 (31%), Positives = 115/233 (49%), Gaps = 9/233 (3%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLATKNALARLDWD-ANLPHPFPVKT--VPPQTIDKIVG 106
            L G H V+A L   ++ +  +    +   R   D   L     V+   V  + +  + G
Sbjct: 16  LLIGFHAVTARLRQDAKGVTDVYVEASRRDRRMQDFIRLAESLGVRLHPVDAERLRGMAG 75

Query: 107 KEAVHQGLALETAPL-----LSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDG 161
            +  HQG+      +     L   LD +  + LL+VLD V DPHN+GA LR A       
Sbjct: 76  TDR-HQGVVARAEDVALALNLDELLDGIEGTPLLLVLDGVTDPHNLGACLRVADGAGAHA 134

Query: 162 IITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLE 221
           +I  K  S   +  +AK ASGA E +PYI ++NL   L+++   G   +G +  + K L 
Sbjct: 135 VIAPKDRSVGLNTTVAKVASGAAETVPYITVTNLARTLRELQERGIWVVGTADGTDKTLY 194

Query: 222 QEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
                  +A+++GAEG+G+R  T+ET   +  + M G +++LNVS A+ V LY
Sbjct: 195 DVDLKGPMAIVMGAEGEGMRRLTRETCDELVGIPMLGGVESLNVSVASGVCLY 247


>gi|330939882|gb|EGH43109.1| RNA methyltransferase TrmH, group 3 [Pseudomonas syringae pv. pisi
           str. 1704B]
          Length = 240

 Score =  113 bits (282), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 78/234 (33%), Positives = 115/234 (49%), Gaps = 8/234 (3%)

Query: 51  LYGVHTVSAAL-NNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEA 109
           +YGVH V A L ++P R     LA      R+     L     V     +  +     E 
Sbjct: 7   IYGVHAVEALLRHHPKRVKHIWLAEGRNDPRVQTLVALAAENRVTIGQAERREMDAWVEG 66

Query: 110 VHQGLALETAP-------LLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGI 162
           VHQG+  + +P       +L   LD    S LL+VLD V DPHN+GA LR+A A     +
Sbjct: 67  VHQGVVADVSPSQVWGEAMLDELLDRSEGSPLLLVLDGVTDPHNLGACLRTADAAGALAV 126

Query: 163 ITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQ 222
           I  K  S + +  + K A GA E IP + ++NL   L+K+   G   +G + +++  L Q
Sbjct: 127 IVPKDKSATLTPAVRKVACGAAEVIPLVAVTNLARTLEKLQQRGLGVVGTAGEAEVELYQ 186

Query: 223 EIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYIT 276
           +       +I+GAEGKG+R  T+E    +  L M G + +LNVS A  V L ++
Sbjct: 187 QDLTGPTIIIMGAEGKGMRRLTREHCDYLVRLPMAGSVSSLNVSVATGVCLCVS 240


>gi|125718827|ref|YP_001035960.1| tRNA (guanosine-2'-O-)-methyltransferase [Streptococcus sanguinis
           SK36]
 gi|125498744|gb|ABN45410.1| tRNA (Guanosine-2'-O-)-methyltransferase, TrmH family, putative
           [Streptococcus sanguinis SK36]
 gi|327488747|gb|EGF20546.1| RNA methyltransferase [Streptococcus sanguinis SK1058]
          Length = 242

 Score =  113 bits (282), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 76/238 (31%), Positives = 122/238 (51%), Gaps = 15/238 (6%)

Query: 47  ENLFLYGVHTVSAALN-NPSRKIF---QLLATKNALARLDWDANLPHPFPVKTVPPQTID 102
           +N  +YGVH V+ AL  N   K++    L   K    +   D        +   P +T+ 
Sbjct: 3   KNDIVYGVHAVTEALAANTGNKLYIQDDLCGKKVDKIK---DLAAEKKVSISWTPKKTLQ 59

Query: 103 KIVGKEAVHQGLALETAPLLSPTLDAV------RNSQLLMVLDHVNDPHNIGAILRSAVA 156
           ++    AVHQG  L  A       + +       ++ LL++LD + DPHN+G+ILR+A A
Sbjct: 60  EMT-DGAVHQGFVLRVAEFAYTDFEVLLKKAEQEDNPLLLILDGLTDPHNLGSILRTADA 118

Query: 157 FSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDS 216
            +  G+I  K  +   + V+AK+++GA+EHIP  R++NL+  L K+   GF   G     
Sbjct: 119 TNVAGVIIPKHRAVGVTPVVAKTSTGAIEHIPIARVTNLSQTLDKLKEAGFWIFGTDMQG 178

Query: 217 KKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
             P  +     K+ALI+G EGKG+    ++    M  + M G +++LN S AAA+ +Y
Sbjct: 179 -TPSHKWNTAGKLALIIGNEGKGISSNIKKQVDEMISIPMNGHVQSLNASVAAAILMY 235


>gi|238855653|ref|ZP_04645953.1| RNA methyltransferase, TrmH family, group 3 [Lactobacillus jensenii
           269-3]
 gi|260664905|ref|ZP_05865756.1| tRNA-rRNA methyltransferase [Lactobacillus jensenii SJ-7A-US]
 gi|282933602|ref|ZP_06338971.1| RNA methyltransferase, TrmH family, group 3 [Lactobacillus jensenii
           208-1]
 gi|313472548|ref|ZP_07813038.1| RNA methyltransferase, TrmH family, group 3 [Lactobacillus jensenii
           1153]
 gi|238831719|gb|EEQ24056.1| RNA methyltransferase, TrmH family, group 3 [Lactobacillus jensenii
           269-3]
 gi|239529985|gb|EEQ68986.1| RNA methyltransferase, TrmH family, group 3 [Lactobacillus jensenii
           1153]
 gi|260561388|gb|EEX27361.1| tRNA-rRNA methyltransferase [Lactobacillus jensenii SJ-7A-US]
 gi|281302257|gb|EFA94490.1| RNA methyltransferase, TrmH family, group 3 [Lactobacillus jensenii
           208-1]
          Length = 251

 Score =  113 bits (282), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 75/240 (31%), Positives = 121/240 (50%), Gaps = 12/240 (5%)

Query: 50  FLYGVHTVSAALNNPS----RKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIV 105
           F++G H     L N S     K+F     +   A   +         V+ VP   +DK+V
Sbjct: 8   FVFGRHAGIDFLKNESADKINKVFLQNGVQTEFANQVYGLAKKKHLIVQEVPKNKLDKLV 67

Query: 106 GKEAVHQGLALETAPLLSPTLD------AVRNSQLLMVLDHVNDPHNIGAILRSAVAFSC 159
             +A HQGL L  +      LD      A + +  L++LD + DPHN+G+ILRSA A   
Sbjct: 68  -PDANHQGLVLAISSFEYADLDDLVEKIADKENPFLLMLDSIEDPHNLGSILRSADATGV 126

Query: 160 DGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKP 219
           DGII  KR +   ++V+AK+++GA++H+P  R++NL    +++   G+   G + + +  
Sbjct: 127 DGIIIPKRRASGLTSVVAKTSTGAIDHVPVCRVNNLVQTTKELKKAGYWFFGTAMEGQDY 186

Query: 220 LEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNH 279
              + K  K  L++G EGKG+ P   +       + M G +++LN S A  V LY   N+
Sbjct: 187 RYWDTKG-KCVLVIGNEGKGISPLLLKQMDQTLTIPMVGHVQSLNASVATGVLLYQMLNN 245


>gi|289648619|ref|ZP_06479962.1| RNA methyltransferase [Pseudomonas syringae pv. aesculi str. 2250]
          Length = 252

 Score =  113 bits (282), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 80/233 (34%), Positives = 117/233 (50%), Gaps = 11/233 (4%)

Query: 51  LYGVHTVSAAL-NNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEA 109
           +YGVH V A L ++P R     LA     AR+     L     V     +  +     E 
Sbjct: 7   IYGVHAVEALLRHHPKRVKHIWLAEGRNDARVQTLVALAGENRVTIGQAERREMDAWVEG 66

Query: 110 VHQGLALETAP-------LLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGI 162
           VHQG+  + +P       +L   LD    S LL+VLD V DPHN+GA LR+A A     +
Sbjct: 67  VHQGVVADVSPSQVWGEAMLDELLDRSEGSPLLLVLDGVTDPHNLGACLRTADAAGALAV 126

Query: 163 ITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPL-E 221
           I  K  S + +  + K A GA E IP + ++NL   L+K+   G   +G + +++  L +
Sbjct: 127 IVPKDKSATLTPAVRKVACGAAEVIPLVAVTNLARTLEKLQQRGLWVVGTAGEAEVELYQ 186

Query: 222 QEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
           Q++    I  I+GAEGKG+R  T+E    +  L M G + +LNVS A  V L+
Sbjct: 187 QDLTGPTI--IMGAEGKGMRRLTREHCDYLVRLPMAGSVSSLNVSVATGVCLF 237


>gi|110004177|emb|CAK98515.1| putative trna/rrna methyltransferase protein [Spiroplasma citri]
          Length = 244

 Score =  113 bits (282), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 76/236 (32%), Positives = 126/236 (53%), Gaps = 9/236 (3%)

Query: 47  ENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTID-KIV 105
           E +++YG++ V  +L NP+ KI +L          D+   L     +K V    ++   +
Sbjct: 3   EYIYIYGINPVVESLLNPAVKINKLYLLPQGKNN-DYYLKLAKSRQLKVVFCSAVEMTTL 61

Query: 106 GKEAVHQGLALETA-----PLLSPTLDAVRNSQ-LLMVLDHVNDPHNIGAILRSAVAFSC 159
            + + HQ L LE        L S T  A++N    L+VLD ++DPHN GAILR+   F+ 
Sbjct: 62  VQTSKHQSLILEICKPQNYSLASITTKALQNKHPFLLVLDQISDPHNFGAILRTCDLFNV 121

Query: 160 DGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKP 219
           DG+I   +     +A +AK+++GA  ++P  R++NLT+A++ +   GF     S ++K  
Sbjct: 122 DGVIILDKRQVDINATVAKTSAGAFNYVPVCRVNNLTNAIEYLKKQGFWIYATSLNTKAQ 181

Query: 220 LEQEIKND-KIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
              E+K D  I LI+G EG G+  K  + A    ++   G + +LNVS A+A+ +Y
Sbjct: 182 NVSELKYDIPICLIVGNEGTGISAKLLKHADFNIYIPTAGHLDSLNVSVASAILIY 237


>gi|152981297|ref|YP_001353804.1| RNA methyltransferase [Janthinobacterium sp. Marseille]
 gi|151281374|gb|ABR89784.1| RNA methyltransferase, TrmH family [Janthinobacterium sp.
           Marseille]
          Length = 247

 Score =  113 bits (282), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 74/233 (31%), Positives = 119/233 (51%), Gaps = 9/233 (3%)

Query: 50  FLYGVHTVSAALNNPSRKIFQL-LATKNALARLDWDANLPHPFPVKTVPPQT--IDKIVG 106
            ++G H V+A L + +  + ++ +       R+           V+ +P     +  IVG
Sbjct: 5   MIFGFHAVTARLRHEASSVEEIYIDAGRHDQRMKDLIRAAEGAKVRIIPADDARLSSIVG 64

Query: 107 KEAVHQGLALETAPL-----LSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDG 161
               HQG+  +   L     L   LDA+    LL+VLD + DPHN+GA LR A       
Sbjct: 65  TRR-HQGVVAKAGELSLARNLDELLDAIEGPPLLLVLDGITDPHNLGACLRVADGAGAHA 123

Query: 162 IITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLE 221
           +I  K  +   +A  AK ASGA + +PYI ++NL   L+++       IG + DS+K L 
Sbjct: 124 VIAPKDRAVGLNATAAKVASGAADTVPYITVTNLARTLRELKERDIMLIGTTDDSEKGLY 183

Query: 222 QEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
           +   +   AL++G+EG+G+R  T+ET   +  + M G +++LNVS A+ V LY
Sbjct: 184 EADFSGPAALVMGSEGEGMRRLTRETCDVLVGIPMFGSVESLNVSVASGVCLY 236


>gi|300811853|ref|ZP_07092319.1| RNA methyltransferase, TrmH family, group 3 [Lactobacillus
           delbrueckii subsp. bulgaricus PB2003/044-T3-4]
 gi|300497172|gb|EFK32228.1| RNA methyltransferase, TrmH family, group 3 [Lactobacillus
           delbrueckii subsp. bulgaricus PB2003/044-T3-4]
          Length = 255

 Score =  113 bits (282), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 73/241 (30%), Positives = 116/241 (48%), Gaps = 12/241 (4%)

Query: 44  SQPENLFLYGVHTVSAALNNPS----RKIFQLLATKNALARLDWDANLPHPFPVKTVPPQ 99
           S   N F++G H     L         K+F     +   AR  +         ++ VP  
Sbjct: 8   SSTNNDFVFGRHAGIDFLKTQDSEKINKVFLAEGVQEDFAREVYRYAKKKHLIIQRVPKN 67

Query: 100 TIDKIVGKEAVHQGLALETAPLLSPTLDAV------RNSQLLMVLDHVNDPHNIGAILRS 153
            +DK+ G E  HQGL L  A       D +        +  L++LD++ DPHN+G+ILRS
Sbjct: 68  KLDKLTGGEN-HQGLVLAVASFEYADFDQLLDKLGQEEAPFLLMLDNIEDPHNLGSILRS 126

Query: 154 AVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLS 213
           A A    G+I  KR +   ++V+AK+++GA++H+P  R++NL    Q +   G+   G +
Sbjct: 127 ADATGVSGVIIPKRRASGLTSVVAKTSTGAIDHVPVARVNNLVQTCQALKDRGYWIFGTA 186

Query: 214 SDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVAL 273
            +      +   N KI L++G EGKG+ P   +       + M G +++LN S A  V L
Sbjct: 187 MEGDD-YRKWNANGKIVLVIGNEGKGISPLLLKQMDQTLTIPMIGHVQSLNASVATGVLL 245

Query: 274 Y 274
           Y
Sbjct: 246 Y 246


>gi|254525374|ref|ZP_05137426.1| RNA methyltransferase, TrmH family, group 3 [Prochlorococcus
           marinus str. MIT 9202]
 gi|221536798|gb|EEE39251.1| RNA methyltransferase, TrmH family, group 3 [Prochlorococcus
           marinus str. MIT 9202]
          Length = 326

 Score =  113 bits (282), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 63/173 (36%), Positives = 101/173 (58%), Gaps = 7/173 (4%)

Query: 109 AVHQGLALETAPLLSPTLDAVRN-------SQLLMVLDHVNDPHNIGAILRSAVAFSCDG 161
           A HQG+AL+ A   + +L+ + +       + +++ LD + DPHN+GAI+RSA AF C G
Sbjct: 149 ASHQGVALQLACSKTISLEKLIDISKHNCANPIILALDGITDPHNVGAIIRSAEAFDCKG 208

Query: 162 IITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLE 221
           II  +R S   +  +AK A+GALEH+   R+ NL  AL+ +   GF  +GLS D +  L 
Sbjct: 209 IIIPQRRSAGLTGTVAKVAAGALEHLQVSRVVNLNRALEMLKKNGFLIVGLSGDGQLSLS 268

Query: 222 QEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
              +   + +I+G+E KG+   TQ+    +  + + G   +LN S AAA++L+
Sbjct: 269 NFSEKVPLVVIVGSEDKGISLLTQKKCDFLLSIPLKGKTSSLNASVAAAISLF 321


>gi|197294706|ref|YP_001799247.1| tRNA/rRNA methyltransferase [Candidatus Phytoplasma australiense]
 gi|171854033|emb|CAM12006.1| tRNA/rRNA methyltransferase [Candidatus Phytoplasma australiense]
          Length = 233

 Score =  113 bits (282), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 73/235 (31%), Positives = 121/235 (51%), Gaps = 13/235 (5%)

Query: 49  LFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKI---- 104
           +F+YG +T+  A+    RKI+QL    N       D +      +   P Q +DK     
Sbjct: 1   MFIYGKNTIKEAIK-AKRKIYQLYLDANF-----KDNSFISFLKLSNQPYQLVDKKKLFD 54

Query: 105 VGKEAVHQGLALETAPLLSPTLDAV---RNSQLLMVLDHVNDPHNIGAILRSAVAFSCDG 161
           + K+  HQG+  +        LD+       Q  ++LD ++DPHN+GAILR+  A   DG
Sbjct: 55  LVKQKNHQGVVAQVESYQFYDLDSFLSFEKKQRFLILDAIHDPHNLGAILRTVEACGFDG 114

Query: 162 IITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLE 221
           +I +K++    +A ++K A GALE++    +SNL   + K+       IG  S++ + L 
Sbjct: 115 VIMSKKHQVPLNATVSKIACGALEYVKVFLVSNLHQTILKLQKQQVLIIGTDSNATQTLT 174

Query: 222 QEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYIT 276
           +   N  +A+I+G EG G+R   ++    +  + M G I +LNVS A+A+ +Y T
Sbjct: 175 KIPCNQSLAIIVGNEGDGIRYLLKQKCDLLVKIPMKGKINSLNVSVASALMMYAT 229


>gi|324989712|gb|EGC21655.1| tRNA (guanosine-2'-O-)-methyltransferase [Streptococcus sanguinis
           SK353]
          Length = 242

 Score =  113 bits (282), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 76/237 (32%), Positives = 124/237 (52%), Gaps = 13/237 (5%)

Query: 47  ENLFLYGVHTVSAALN-NPSRKIFQLLATKNALARLDWDANLP--HPFPVKTVPPQTIDK 103
           +N  +YGVH V+ AL  N   K++  +       ++D   NL       +   P +T+ +
Sbjct: 3   KNDIVYGVHAVTEALAANTGNKLY--IQDDLRGKKVDKIKNLAAEKKVSISWTPKKTLQE 60

Query: 104 IVGKEAVHQGLALETAPLLSPTLDAV------RNSQLLMVLDHVNDPHNIGAILRSAVAF 157
           +    AVHQG  L  A       + +       ++ LL++LD + DPHN+G+ILR+A A 
Sbjct: 61  MT-DGAVHQGFVLRVAEFAYTDFEVLLKKAEQEDNPLLLILDGLTDPHNLGSILRTADAT 119

Query: 158 SCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSK 217
           +  G+I  K  +   + V+AK+++GA+EHIP  R++NL+  L K+   GF   G      
Sbjct: 120 NVAGVIIPKHRAVGVTPVVAKTSTGAIEHIPISRVTNLSQTLDKLKEAGFWIFGTDMQG- 178

Query: 218 KPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
            P  +     K+ALI+G EGKG+    ++    M  + M G +++LN S AAA+ +Y
Sbjct: 179 TPSHKWNTAGKLALIIGNEGKGISTNIKKQVDEMISIPMNGHVQSLNASVAAAILMY 235


>gi|16077164|ref|NP_387977.1| 23S rRNA methyltransferase [Bacillus subtilis subsp. subtilis str.
           168]
 gi|221307908|ref|ZP_03589755.1| hypothetical protein Bsubs1_00500 [Bacillus subtilis subsp.
           subtilis str. 168]
 gi|221312229|ref|ZP_03594034.1| hypothetical protein BsubsN3_00495 [Bacillus subtilis subsp.
           subtilis str. NCIB 3610]
 gi|221317163|ref|ZP_03598457.1| hypothetical protein BsubsJ_00500 [Bacillus subtilis subsp.
           subtilis str. JH642]
 gi|221321426|ref|ZP_03602720.1| hypothetical protein BsubsS_00500 [Bacillus subtilis subsp.
           subtilis str. SMY]
 gi|586908|sp|Q06753|YACO_BACSU RecName: Full=Putative TrmH family tRNA/rRNA methyltransferase YacO
 gi|467483|dbj|BAA05329.1| unknown [Bacillus subtilis]
 gi|2632363|emb|CAB11872.1| 23S rRNA methyltransferase [Bacillus subtilis subsp. subtilis str.
           168]
          Length = 249

 Score =  113 bits (282), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 68/235 (28%), Positives = 125/235 (53%), Gaps = 13/235 (5%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLATKNAL---ARLDWDANLPHPFPVKTVPPQTIDKIVG 106
           ++ G + V   L +  RK+++L   +N +   A+   +        ++ VP + +D++V 
Sbjct: 7   YVIGKNAVIETLKS-DRKLYKLWMAENTVKGQAQQVIELAKKQGITIQYVPRKKLDQMVT 65

Query: 107 KEAVHQGLALETAPLLSPTLDAV------RNSQ-LLMVLDHVNDPHNIGAILRSAVAFSC 159
            +  HQG+  + A      LD +      +N Q   ++LD + DPHN+G+I+R+A A   
Sbjct: 66  GQ--HQGVVAQVAAYEYAELDDLYKAAEEKNEQPFFLILDELEDPHNLGSIMRTADAVGA 123

Query: 160 DGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKP 219
            GI+  KR +   +  +AK+++GA+EHIP  R++NL   L++M   G   +G  + +++ 
Sbjct: 124 HGIVIPKRRAVGLTTTVAKASTGAIEHIPVARVTNLARTLEEMKERGIWVVGTDASARED 183

Query: 220 LEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
                 N  +AL++G+EGKG+    +E    +  L M G + +LN S AA + +Y
Sbjct: 184 FRNMDGNMPLALVIGSEGKGMGRLVKEKCDFLIKLPMAGKVTSLNASVAAGLLMY 238


>gi|257899917|ref|ZP_05679570.1| RNA methyltransferase TrmH [Enterococcus faecium Com15]
 gi|257837829|gb|EEV62903.1| RNA methyltransferase TrmH [Enterococcus faecium Com15]
          Length = 286

 Score =  113 bits (282), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 74/261 (28%), Positives = 126/261 (48%), Gaps = 12/261 (4%)

Query: 24  RRNHRDYKKMQSFNQKSRHTSQP--ENLFLYGVHTVSAALNNP-SRKIFQLLATKNALAR 80
           ++N    KK    NQ     ++   E+ F++G H    AL      K+F    ++     
Sbjct: 19  KQNRYPNKKQTGRNQSVSDQNEEALEDNFVFGHHAAVEALQQGRGNKLFLQEDSRGEKVE 78

Query: 81  LDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAV-------RNSQ 133
              +       PVK VP Q ++ +     VHQG+ L   P    +LD +       +   
Sbjct: 79  ELKEIAREQAVPVKWVPKQKLETL-SDHGVHQGVVLAITPYEYLSLDQLIERTKEKKEDP 137

Query: 134 LLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRIS 193
             ++LD + DPHN G+ILR+A A   DG+I  K  +   + ++ K+++GA+E++P  R++
Sbjct: 138 FFLILDSIEDPHNFGSILRTADASGVDGVIIPKHRAVGITPIVTKTSTGAVEYVPVARVT 197

Query: 194 NLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAH 253
           NL  A+Q++   GF   G         +   K   IAL++G EGKG+ P  ++    +  
Sbjct: 198 NLIQAVQQLKEIGFWVFGTDMTGTNFQKWNAKGS-IALVIGNEGKGMSPGLKKEMDELLT 256

Query: 254 LHMPGIIKALNVSNAAAVALY 274
           + M G +++LN S AA + +Y
Sbjct: 257 IPMTGHVQSLNASVAAGLLMY 277


>gi|215919079|ref|NP_819993.2| RNA methyltransferase [Coxiella burnetii RSA 493]
 gi|206583964|gb|AAO90507.2| 23S rRNA Gm2251 methyltransferase [Coxiella burnetii RSA 493]
          Length = 270

 Score =  113 bits (282), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 74/238 (31%), Positives = 118/238 (49%), Gaps = 10/238 (4%)

Query: 51  LYGVHTVSAALNNPSRKIFQLLATKNAL-ARLDWDANLPHPFPVKTVPPQTIDKIVGKEA 109
           +YG+H VS  L+   ++I +L   +N    RL           VK +     +       
Sbjct: 27  IYGIHAVSGVLDAAPQRIVKLYVQENRDDQRLQSLVEKAKALGVKVILLSRTELNTLSNE 86

Query: 110 VHQGLA--------LETAPLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDG 161
            HQG+         L+ + LLS  L       LL++LD V DPHN+GA LRSA AF    
Sbjct: 87  KHQGIVADCEEVENLDESALLS-LLKKRETPALLLILDGVKDPHNLGACLRSANAFGVRA 145

Query: 162 IITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLE 221
           +I  K  +   + V+ K A GA E  P+IR++NL+  +  +   G   +G + +++  ++
Sbjct: 146 VIAPKDRAVGVTPVVRKVACGAAEMTPFIRVTNLSRTIDWLQKEGVWIVGTAVEAETLIQ 205

Query: 222 QEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNH 279
           +      IA++LG+EG GLR  T+E    +A + + G +++LNVS A  + LY  Q  
Sbjct: 206 EIDLTGDIAIVLGSEGAGLRRLTKERCDFLAQIPLRGSVESLNVSVACGICLYEVQRQ 263


>gi|319939872|ref|ZP_08014227.1| TRNA/rRNA methyltransferase [Streptococcus anginosus 1_2_62CV]
 gi|319810883|gb|EFW07202.1| TRNA/rRNA methyltransferase [Streptococcus anginosus 1_2_62CV]
          Length = 242

 Score =  113 bits (282), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 78/238 (32%), Positives = 123/238 (51%), Gaps = 17/238 (7%)

Query: 48  NLFLYGVHTVSAAL-NNPSRKIF--QLLATKNALARLDWDAN--LPHPFPVKTVPPQTID 102
           N  +YGVH V+ AL  N   K++    L  KN     D  A   +   +  K +  +  D
Sbjct: 4   NDIVYGVHAVTEALMANTGNKLYIQDDLRGKNVAKMKDLAAEKKVSISWTTKKILQEMTD 63

Query: 103 KIVGKEAVHQGLALETAPLLSPTLDAV------RNSQLLMVLDHVNDPHNIGAILRSAVA 156
                 AVHQG  L  +       +A+       ++ LL++LD + DPHN+G+ILR+A A
Sbjct: 64  G-----AVHQGFVLRVSEFAYTDFEAMLKMATQEDNPLLLILDGLTDPHNLGSILRTADA 118

Query: 157 FSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDS 216
            +  G+I  K  +   + V+AK+++GA+EHIP  R++NL+  L K+   GF   G   + 
Sbjct: 119 TNVTGVIIPKHRAVGVTPVVAKTSTGAVEHIPIARVTNLSQTLDKLKHAGFWIFGTDMNG 178

Query: 217 KKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
             P  +     K+ALI+G EGKG+    ++    M  + M G +++LN S AAA+ +Y
Sbjct: 179 -TPSTKWNTAGKLALIIGNEGKGISANIKKQVDEMITIPMNGHVQSLNASVAAAILMY 235


>gi|52783308|sp|Q83CW6|RLMB_COXBU RecName: Full=23S rRNA (guanosine-2'-O-)-methyltransferase RlmB;
           AltName: Full=23S rRNA Gm2251 2'-O-methyltransferase
          Length = 250

 Score =  113 bits (282), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 74/238 (31%), Positives = 118/238 (49%), Gaps = 10/238 (4%)

Query: 51  LYGVHTVSAALNNPSRKIFQLLATKNAL-ARLDWDANLPHPFPVKTVPPQTIDKIVGKEA 109
           +YG+H VS  L+   ++I +L   +N    RL           VK +     +       
Sbjct: 7   IYGIHAVSGVLDAAPQRIVKLYVQENRDDQRLQSLVEKAKALGVKVILLSRTELNTLSNE 66

Query: 110 VHQGLA--------LETAPLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDG 161
            HQG+         L+ + LLS  L       LL++LD V DPHN+GA LRSA AF    
Sbjct: 67  KHQGIVADCEEVENLDESALLS-LLKKRETPALLLILDGVKDPHNLGACLRSANAFGVRA 125

Query: 162 IITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLE 221
           +I  K  +   + V+ K A GA E  P+IR++NL+  +  +   G   +G + +++  ++
Sbjct: 126 VIAPKDRAVGVTPVVRKVACGAAEMTPFIRVTNLSRTIDWLQKEGVWIVGTAVEAETLIQ 185

Query: 222 QEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNH 279
           +      IA++LG+EG GLR  T+E    +A + + G +++LNVS A  + LY  Q  
Sbjct: 186 EIDLTGDIAIVLGSEGAGLRRLTKERCDFLAQIPLRGSVESLNVSVACGICLYEVQRQ 243


>gi|331701828|ref|YP_004398787.1| TrmH family RNA methyltransferase [Lactobacillus buchneri NRRL
           B-30929]
 gi|329129171|gb|AEB73724.1| RNA methyltransferase, TrmH family, group 3 [Lactobacillus buchneri
           NRRL B-30929]
          Length = 266

 Score =  113 bits (282), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 79/258 (30%), Positives = 130/258 (50%), Gaps = 19/258 (7%)

Query: 33  MQSFNQKSRHTS-----QPENLFLYGVHTVSAAL--NNPSRKIFQLLATKNALARLDWDA 85
           M++ N+   H S     QPE  F+ G H V AAL   NP  K+F     K+    +    
Sbjct: 1   MKNDNRSQDHRSDDSQDQPEE-FVIGRHPVVAALKSENPVNKLFIQSGIKDDDNIISEIM 59

Query: 86  NLPHP--FPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQ-------LLM 136
            L H     +  VP Q +DK+   +  HQG+ L  A     T+D +  +          +
Sbjct: 60  KLAHKKRLVISKVPKQKLDKLSNNQN-HQGVVLSIAAFKYATIDDLFTNAKKQAVEPFFV 118

Query: 137 VLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLT 196
           +LD++ DPHN+G+I+R+A A    GII  K  +   +A ++K+++GA+E +P  R++NL+
Sbjct: 119 ILDNIEDPHNLGSIIRTADAAGVSGIIIPKHRAVGLTATVSKTSAGAIERVPVARVTNLS 178

Query: 197 DALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHM 256
             ++++   G    G           + K   IA+I+G EGKG+ P  ++    M  + M
Sbjct: 179 ATIKELKQRGMWVFGTDVSGTDYRRWDAKG-SIAVIIGNEGKGISPLLKKQVDEMLTIPM 237

Query: 257 PGIIKALNVSNAAAVALY 274
            G I++LN S AA++ +Y
Sbjct: 238 VGDIQSLNASVAASILIY 255


>gi|116074617|ref|ZP_01471878.1| hypothetical protein RS9916_28824 [Synechococcus sp. RS9916]
 gi|116067839|gb|EAU73592.1| hypothetical protein RS9916_28824 [Synechococcus sp. RS9916]
          Length = 548

 Score =  113 bits (282), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 62/173 (35%), Positives = 98/173 (56%), Gaps = 7/173 (4%)

Query: 109 AVHQGLALETA-------PLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDG 161
           AVHQG+AL+TA       P L     A+    LL+ LD + DPHN+GAI+RSA A    G
Sbjct: 292 AVHQGIALQTASADTLDLPTLVEGCAALGEPPLLLALDGLTDPHNLGAIVRSAEALGAHG 351

Query: 162 IITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLE 221
           ++  +R S   +  +AK A+GALEH+P  R+ NL  +L+ +   G++ +GL+ +    L 
Sbjct: 352 VVLPQRRSAGLTGSVAKVAAGALEHLPVARVVNLNRSLETLKDAGYRVVGLAGEGDVTLA 411

Query: 222 QEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
           +      +A++ G+EG+GL   T+     +  + + G+  +LN S A A+ LY
Sbjct: 412 EADLEGPLAIVTGSEGQGLSLLTRRHCDQLIRIPLRGVTPSLNASVATAMCLY 464


>gi|53803949|ref|YP_114407.1| RNA methyltransferase [Methylococcus capsulatus str. Bath]
 gi|53757710|gb|AAU92001.1| RNA methyltransferase, TrmH family, group 3 [Methylococcus
           capsulatus str. Bath]
          Length = 250

 Score =  113 bits (282), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 76/235 (32%), Positives = 120/235 (51%), Gaps = 13/235 (5%)

Query: 51  LYGVHTVSAALN-NPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPP--QTIDKIVGK 107
           ++G+H   AAL+ +P + +   L       RL   A       V+ V    + +D++   
Sbjct: 7   VWGIHAAEAALDYSPDKIVKAWLDDHRMQNRLQAVATRLDELGVEIVRADRKRLDRLADP 66

Query: 108 EAVHQGLALE--------TAPLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSC 159
              HQG+ LE         A LL  TLDA     L +VLDHV DPHN+GA LR+  A   
Sbjct: 67  RK-HQGILLELDLPGEQGEAELLD-TLDAADGHPLYLVLDHVQDPHNLGACLRTCDAAGV 124

Query: 160 DGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKP 219
            G++ TK  S   +  +AK ASGA E +P  R++NL   L +    G+  +G + ++++ 
Sbjct: 125 KGLVVTKDQSVGLTPTVAKVASGAAETVPVYRVTNLARCLDRFKQRGYWVVGAAGEAERT 184

Query: 220 LEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
           L +      + +++GAEG GLR  T+E    +  + M G +++LN+S A  + LY
Sbjct: 185 LYELDLRLPLVVVMGAEGVGLRRLTRERCDFLLRIPMVGGVESLNLSVATGIVLY 239


>gi|325845921|ref|ZP_08169119.1| RNA methyltransferase, TrmH family, group 3 [Anaerococcus
           hydrogenalis ACS-025-V-Sch4]
 gi|325481827|gb|EGC84859.1| RNA methyltransferase, TrmH family, group 3 [Anaerococcus
           hydrogenalis ACS-025-V-Sch4]
          Length = 237

 Score =  112 bits (281), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 61/172 (35%), Positives = 102/172 (59%), Gaps = 2/172 (1%)

Query: 111 HQGLALETAPLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSP 170
           HQG+ +E        LD +++ + LM+LD + DPHN+GAI+RSA AF  DGI+ ++R S 
Sbjct: 65  HQGVEIEVEDYKYKDLDDLKDKKRLMILDQIEDPHNLGAIIRSAEAFGFDGIVISERRSA 124

Query: 171 SESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIA 230
             ++ + K+++GA+ +I    + N+  A++++    F   GL+ ++   + Q     KIA
Sbjct: 125 KVNSTVYKTSAGAINNIDIAMVKNINRAIKEIKEENFWVYGLAGEADGDITQTDLTGKIA 184

Query: 231 LILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY--ITQNHF 280
           L++G EGKGL    +E    +  + M G I +LN S A+A+A+Y  + QN F
Sbjct: 185 LVVGNEGKGLSRLVRENCDGLIKIPMLGKINSLNASVASAIAIYESLRQNGF 236


>gi|257888687|ref|ZP_05668340.1| RNA methyltransferase TrmH [Enterococcus faecium 1,141,733]
 gi|257824741|gb|EEV51673.1| RNA methyltransferase TrmH [Enterococcus faecium 1,141,733]
          Length = 286

 Score =  112 bits (281), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 69/236 (29%), Positives = 118/236 (50%), Gaps = 10/236 (4%)

Query: 47  ENLFLYGVHTVSAALNNP-SRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIV 105
           E+ F++G H    AL      K+F    ++        +       PVK VP Q ++ + 
Sbjct: 44  EDNFVFGHHAAVEALQQGRGNKLFLQEDSRGEKVEELKEIAREQAVPVKWVPKQKLETL- 102

Query: 106 GKEAVHQGLALETAPLLSPTLDAV-------RNSQLLMVLDHVNDPHNIGAILRSAVAFS 158
               VHQG+ L   P    +LD +       + +   ++LD + DPHN G+ILR+A A  
Sbjct: 103 SDHGVHQGVVLAITPYEYLSLDQLIERTKEKKEAPFFLILDSIEDPHNFGSILRTADASG 162

Query: 159 CDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKK 218
            DG+I  K  +   + ++ K+++GA+E++P  R++NL  A+Q++   GF   G       
Sbjct: 163 VDGVIIPKHRAVGITPIVTKTSTGAVEYVPVARVTNLVQAVQQLKETGFWVFGTDMIGTN 222

Query: 219 PLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
             +   K   IAL++G EGKG+ P  ++    +  + M G +++LN S AA + +Y
Sbjct: 223 FQKWNAKGS-IALVIGNEGKGMSPGLKKEMDELLTIPMTGHVQSLNASVAAGLLMY 277


>gi|161830029|ref|YP_001596726.1| RNA methyltransferase [Coxiella burnetii RSA 331]
 gi|161761896|gb|ABX77538.1| RNA methyltransferase, TrmH family, group 3 [Coxiella burnetii RSA
           331]
          Length = 270

 Score =  112 bits (281), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 74/238 (31%), Positives = 118/238 (49%), Gaps = 10/238 (4%)

Query: 51  LYGVHTVSAALNNPSRKIFQLLATKNAL-ARLDWDANLPHPFPVKTVPPQTIDKIVGKEA 109
           +YG+H VS  L+   ++I +L   +N    RL           VK +     +       
Sbjct: 27  IYGIHAVSGVLDAAPQRIVKLYVQENRDDQRLQSLVEKAKGLGVKVILLSRTELNTLSNE 86

Query: 110 VHQGLA--------LETAPLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDG 161
            HQG+         L+ + LLS  L       LL++LD V DPHN+GA LRSA AF    
Sbjct: 87  KHQGIVADCEEVENLDESALLS-LLKKRETPALLLILDGVKDPHNLGACLRSANAFGVRA 145

Query: 162 IITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLE 221
           +I  K  +   + V+ K A GA E  P+IR++NL+  +  +   G   +G + +++  ++
Sbjct: 146 VIAPKDRAVGVTPVVRKVACGAAEMTPFIRVTNLSRTIDWLQKEGVWIVGTAVEAETLIQ 205

Query: 222 QEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNH 279
           +      IA++LG+EG GLR  T+E    +A + + G +++LNVS A  + LY  Q  
Sbjct: 206 EIDLTGDIAIVLGSEGAGLRRLTKERCDFLAQIPLRGSVESLNVSVACGICLYEVQRQ 263


>gi|261250419|ref|ZP_05942994.1| 23S rRNA (guanosine-2'-O-) -methyltransferase RlmB [Vibrio
           orientalis CIP 102891]
 gi|260938988|gb|EEX94975.1| 23S rRNA (guanosine-2'-O-) -methyltransferase RlmB [Vibrio
           orientalis CIP 102891]
          Length = 245

 Score =  112 bits (281), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 78/241 (32%), Positives = 120/241 (49%), Gaps = 20/241 (8%)

Query: 48  NLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLP--HPFPVKTVPPQTI---- 101
           N F+YG+H V A L     +  +    K    R D D  +P  +   V  V  Q +    
Sbjct: 3   NEFIYGIHAVKAVLEREPERFIEAFVLK---GRQD-DRLMPILNELQVCGVSIQQMTRKT 58

Query: 102 --DKIVGKEAVHQGLALETAP---LLSPTLDAV---RNSQLLMVLDHVNDPHNIGAILRS 153
             DK  G  A HQG+     P   L    LD +     + LL+VLD V DPHN+GA LR+
Sbjct: 59  LDDKARG--ANHQGIMARVKPAKQLNENDLDDILAKHEAPLLLVLDGVTDPHNLGACLRN 116

Query: 154 AVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLS 213
           A A     +I  K  S + +A ++K A GA E +P +R++NL   ++ +   G   +G +
Sbjct: 117 ADAAGVAAVIVPKDKSANITATVSKVACGAAESVPLVRVTNLARTMRTLQEQGIWFVGTA 176

Query: 214 SDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVAL 273
            ++   + Q      +A+++GAEG G+R  T+ET   +  + M G + +LNVS A+ V L
Sbjct: 177 GEATHDIYQAKLTGPLAIVMGAEGDGMRRLTRETCDDLIKIPMAGSVSSLNVSVASGVCL 236

Query: 274 Y 274
           +
Sbjct: 237 F 237


>gi|219872021|ref|YP_002476396.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Haemophilus parasuis
           SH0165]
 gi|219692225|gb|ACL33448.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Haemophilus parasuis
           SH0165]
          Length = 244

 Score =  112 bits (281), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 75/241 (31%), Positives = 118/241 (48%), Gaps = 26/241 (10%)

Query: 51  LYGVHTVSAALNNPSRKIFQLLATK-----------NALARLDWDANLPHPFPVKTVPPQ 99
           +YG+H V + L+    ++ ++   K           N L RL           V+ V  Q
Sbjct: 5   IYGIHAVKSFLDVAPERLIEVFVLKGREDKRLTPLLNELQRLG--------IRVQQVNRQ 56

Query: 100 TIDKIVGKEAVHQGLALETAP---LLSPTLDAVRNSQ---LLMVLDHVNDPHNIGAILRS 153
            +D  V  E VHQG+  +  P   L    LD + + +    L++LD V DPHN+GA LR+
Sbjct: 57  ALDNKVQGE-VHQGIIAKIIPAKELNESDLDQILDRKANPFLLILDGVTDPHNLGACLRT 115

Query: 154 AVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLS 213
           A A   D +I  K  S   ++   K A GA E +P IR++NL   ++++       +G +
Sbjct: 116 ADAAGVDAVIVPKDKSAQLTSTARKVACGAAETVPLIRVTNLARTMRELQERNIWIVGTA 175

Query: 214 SDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVAL 273
            ++ + L Q      IAL++GAEG G+R  T+E    +  + M G + +LNVS A  V L
Sbjct: 176 GEATESLYQVKLTGSIALVMGAEGDGMRRLTREHCDQLVSIPMAGSVSSLNVSVATGVCL 235

Query: 274 Y 274
           +
Sbjct: 236 F 236


>gi|78222568|ref|YP_384315.1| RNA methyltransferase TrmH, group 3 [Geobacter metallireducens
           GS-15]
 gi|78193823|gb|ABB31590.1| RNA methyltransferase TrmH, group 3 [Geobacter metallireducens
           GS-15]
          Length = 250

 Score =  112 bits (281), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 74/239 (30%), Positives = 126/239 (52%), Gaps = 20/239 (8%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLATKNA-------LARLDWDANLPHPFPVKTVPPQTID 102
            LYG+++   AL    R+ F+L  +++A       L +L  +  +P    V+    + I 
Sbjct: 5   ILYGINSAMEALRG-KRRAFELFVSRDASDRRMEKLLKLATEKGVP----VRNRDKRDIS 59

Query: 103 KIVGKEAVHQGLAL--ETAPL--LSPTLDAVRNSQ---LLMVLDHVNDPHNIGAILRSAV 155
           ++ G +  HQG+AL  E  P   LS  +DA R S    L++ LD V DPHN+GA++RSA 
Sbjct: 60  RLCGTDH-HQGVALKLEGFPYTGLSDIIDAWRESGERGLILALDGVQDPHNLGALIRSAA 118

Query: 156 AFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSD 215
                G+I  K  +   +A + KSA+GA E IP  +++NL  AL ++   GF   G +  
Sbjct: 119 CAGAHGVIIPKDRAARVTATVEKSAAGAAETIPVAQVTNLAQALDELKEAGFWIYGAADS 178

Query: 216 SKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
           +   L  +  +  + +++G+EG+G+RP  ++    +  + + G + +LN S A  V L+
Sbjct: 179 AASSLYDQDLSGNVVIVIGSEGEGVRPLVRKKCDFLVAIPLRGGVSSLNASVAGGVILF 237


>gi|261345208|ref|ZP_05972852.1| RNA methyltransferase, TrmH family, group 3 [Providencia
           rustigianii DSM 4541]
 gi|282566901|gb|EFB72436.1| RNA methyltransferase, TrmH family, group 3 [Providencia
           rustigianii DSM 4541]
          Length = 245

 Score =  112 bits (281), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 76/235 (32%), Positives = 115/235 (48%), Gaps = 12/235 (5%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDK----IV 105
            +YG+H V A L N  ++I ++   K    R      + H    + +  Q  ++      
Sbjct: 4   IIYGIHAVKALLENSPQRIKEVYILKGREDRRLMP--IVHEIEAQGIVVQVANRQWMDAQ 61

Query: 106 GKEAVHQGLALETAPLLS------PTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSC 159
            + AVHQG+     P         P L     S  L+VLD V DPHN+GA LRSA A   
Sbjct: 62  TEGAVHQGIIANVLPGKQYQEGDLPDLLESTESPFLLVLDGVTDPHNLGACLRSADAAGV 121

Query: 160 DGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKP 219
             +I  K  S   +A + K A GA E+IP IR++NL   L+ +  +    +G + ++   
Sbjct: 122 HAVIVPKDKSAQLNATVKKVACGAAENIPLIRVTNLARTLRLLQEYNVWIVGTAGEADHT 181

Query: 220 LEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
           L Q   +  IAL++GAEG+G+R  T+E    +  + M G + +LNVS A  V L+
Sbjct: 182 LYQSKLSGSIALVMGAEGEGMRRLTREHCDELISIPMAGSVSSLNVSVATGVCLF 236


>gi|170077013|ref|YP_001733651.1| rRNA methyltransferase [Synechococcus sp. PCC 7002]
 gi|169884682|gb|ACA98395.1| rRNA methyltransferase, TrmH family, group 3 [Synechococcus sp. PCC
           7002]
          Length = 388

 Score =  112 bits (281), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 62/173 (35%), Positives = 98/173 (56%), Gaps = 7/173 (4%)

Query: 109 AVHQGLALETAPL-------LSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDG 161
            VHQG+A++TAP        L     A   S ++++ D + DPHN+GAI+R+A A    G
Sbjct: 197 GVHQGIAVQTAPYEYMELPDLIEQAKAKTESPVVVIADGITDPHNLGAIIRTAEAIGAQG 256

Query: 162 IITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLE 221
           +I  +R +   ++ + K A+GALEH P  R+ NL+ A++++   GF   G ++ + K L 
Sbjct: 257 MIIPQRRAVGVTSTVMKVAAGALEHFPVARVVNLSRAMEELKEAGFWIYGTAAGTSKALH 316

Query: 222 QEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
                  I L++G+EG+GL   TQ+    +  + M G   +LN S AAA+ALY
Sbjct: 317 NIKFEGAIGLVIGSEGQGLSLLTQKHCDELVAIPMTGKTPSLNASVAAAIALY 369


>gi|251793952|ref|YP_003008684.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Aggregatibacter
           aphrophilus NJ8700]
 gi|247535351|gb|ACS98597.1| RNA methyltransferase, TrmH family, group 3 [Aggregatibacter
           aphrophilus NJ8700]
          Length = 245

 Score =  112 bits (281), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 83/245 (33%), Positives = 128/245 (52%), Gaps = 33/245 (13%)

Query: 51  LYGVHTVSAALNNPSRKIFQLLATK-----------NALARLDWDANLPHPFPVKTVPPQ 99
           +YG+H V A + +   ++ ++LA K           N + RL           V+ +  Q
Sbjct: 5   IYGIHAVKAFVTHYPERLIEVLALKGRDDQRLQLLINEIQRLG--------ISVQFLNRQ 56

Query: 100 TIDKIVGKEAVHQGLA--LETAPLLSP-TLDAVRNSQ---LLMVLDHVNDPHNIGAILRS 153
           T+DK    E VHQG+   + + P L+   LD +   Q   LL+VLD V DPHN+GA LR+
Sbjct: 57  TLDKKAEGE-VHQGIIARVHSLPELNEHDLDLLLEQQKAPLLLVLDGVTDPHNLGACLRT 115

Query: 154 AVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDA---LQKMHS-WGFQT 209
           A A   + +I TK  S   ++   K A GA E++P IR++NL      LQK H+ W    
Sbjct: 116 ADAAGVNAVIVTKDKSAQLNSTARKVACGAAENVPLIRVTNLARTLRELQKRHNVW---V 172

Query: 210 IGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAA 269
           +G + ++ + L Q      +AL++GAEG+G+R  T+E    +  + M G + +LNVS A 
Sbjct: 173 VGTAGETTETLYQTKLTGALALVMGAEGEGMRRLTREHCDQLISIPMMGSVSSLNVSVAT 232

Query: 270 AVALY 274
            V L+
Sbjct: 233 GVCLF 237


>gi|325686893|gb|EGD28918.1| RNA methyltransferase [Streptococcus sanguinis SK72]
          Length = 242

 Score =  112 bits (281), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 73/235 (31%), Positives = 119/235 (50%), Gaps = 9/235 (3%)

Query: 47  ENLFLYGVHTVSAALN-NPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIV 105
           +N  +YGVH V  AL  N   K++     +        D        +   P +T+ ++ 
Sbjct: 3   KNDIVYGVHAVKEALAANTGNKLYIQDDLRGKKVEKIKDLAAEKKVSISWTPKKTLQEMT 62

Query: 106 GKEAVHQGLALETAPLLSPTLDAV------RNSQLLMVLDHVNDPHNIGAILRSAVAFSC 159
              AVHQG  L  A       + +       ++ LL++LD + DPHN+G+ILR+A A + 
Sbjct: 63  -DGAVHQGFVLRVAEFAYTDFEVLLKKAEQEDNPLLLILDGLTDPHNLGSILRTADATNV 121

Query: 160 DGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKP 219
            G+I  K  +   + V+AK+++GA+EHIP  R++N++  L K+   GF   G       P
Sbjct: 122 AGVIIPKHRAVGVTPVVAKTSTGAIEHIPIARVTNISQTLDKLKEAGFWIFGTDMQG-TP 180

Query: 220 LEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
             +     K+ALI+G EGKG+    ++    M  + M G +++LN S AAA+ +Y
Sbjct: 181 SHKWNTAGKLALIIGNEGKGISSNIKKQVDEMISIPMNGHVQSLNASVAAAILMY 235


>gi|328944843|gb|EGG39003.1| RNA methyltransferase [Streptococcus sanguinis SK1087]
          Length = 242

 Score =  112 bits (281), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 73/235 (31%), Positives = 120/235 (51%), Gaps = 9/235 (3%)

Query: 47  ENLFLYGVHTVSAALN-NPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIV 105
           +N  +YGVH V+ AL  N   K++     +        D        +   P +T+ ++ 
Sbjct: 3   KNDIVYGVHAVTEALAANTGNKLYIQDDLRGKKVDKIKDLAAEKKVSISWTPKKTLQEMT 62

Query: 106 GKEAVHQGLALETAPLLSPTLDAV------RNSQLLMVLDHVNDPHNIGAILRSAVAFSC 159
              AVHQG  L  A       + +       ++ LL++LD + DPHN+G+ILR+A A + 
Sbjct: 63  -DGAVHQGFVLRVAEFAYTDFEVLLKKAEQEDNPLLLILDGLTDPHNLGSILRTADATNV 121

Query: 160 DGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKP 219
            G+I  K  +   + V+AK+++GA+EHIP  R++NL+  L K+   GF   G       P
Sbjct: 122 AGVIIPKHRAVGVTPVVAKTSTGAIEHIPIARVTNLSQTLGKLKEAGFWIFGTDMQG-TP 180

Query: 220 LEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
             +     K+AL++G EGKG+    ++    M  + M G +++LN S AAA+ +Y
Sbjct: 181 SHKWNTAGKLALVIGNEGKGISSNIKKQVDEMISIPMNGHVQSLNASVAAAILMY 235


>gi|292493502|ref|YP_003528941.1| RNA methyltransferase, TrmH family, group 3 [Nitrosococcus
           halophilus Nc4]
 gi|291582097|gb|ADE16554.1| RNA methyltransferase, TrmH family, group 3 [Nitrosococcus
           halophilus Nc4]
          Length = 249

 Score =  112 bits (280), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 76/238 (31%), Positives = 113/238 (47%), Gaps = 11/238 (4%)

Query: 52  YGVHTVSAALNNPSRKIFQLLATKNALARLDWDAN---LPHPFPVKTVPPQTIDKIVGKE 108
           YG+H V AAL  P+ +I  L   ++   R   +     L        V  + +D +V   
Sbjct: 7   YGLHAVRAALEQPATQIISLWLDQSRKDRAIQEITELALEQGLDFYPVNREDLDSLV-PG 65

Query: 109 AVHQGLALE-------TAPLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDG 161
             HQG+          T   L   LD ++   LL++LD V DPHN+GA LR+A A    G
Sbjct: 66  VRHQGVVAHCSAQPTFTEEGLFDLLDNLKAPPLLLILDGVQDPHNLGACLRTAEAAGVHG 125

Query: 162 IITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLE 221
           +I  K  +   +A + K ASGA E +P++R++NL   ++K+   G   +G        L 
Sbjct: 126 VIAPKDRAVGLTAAVRKVASGAAERVPFVRVTNLARLMRKLRERGLWLVGTVVKGGGSLY 185

Query: 222 QEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNH 279
                  + L+LGAE +GLR  T E    +  + M G + +LNVS AA V L+  Q  
Sbjct: 186 NTDLKGPLGLVLGAEDRGLRRLTAEHCDCLVQIPMQGAVGSLNVSVAAGVCLFEAQRQ 243


>gi|323492117|ref|ZP_08097279.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Vibrio brasiliensis
           LMG 20546]
 gi|323313678|gb|EGA66780.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Vibrio brasiliensis
           LMG 20546]
          Length = 245

 Score =  112 bits (280), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 77/239 (32%), Positives = 120/239 (50%), Gaps = 16/239 (6%)

Query: 48  NLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLP--HPFPVKTVPPQTIDKIV 105
           N ++YG+H V A L+    +  +    K    R D D  LP  +   V  V  Q + +  
Sbjct: 3   NEYIYGIHAVKAVLSREPERFIEAFVLK---GRQD-DRLLPILNELNVCGVSIQQMTRKT 58

Query: 106 GKE----AVHQGLALETAP---LLSPTLD---AVRNSQLLMVLDHVNDPHNIGAILRSAV 155
             E    A HQG+     P   L    LD   A   S LL+VLD V DPHN+GA LR+A 
Sbjct: 59  LDEKASGANHQGIMARVKPAKQLNEHDLDDIIAQHESPLLLVLDGVTDPHNLGACLRNAD 118

Query: 156 AFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSD 215
           A     +I  K  S + +A ++K A GA E +P +R++NL   ++ +   G   +G + +
Sbjct: 119 AAGVAAVIVPKDRSANITATVSKVACGAAEMVPLVRVTNLARTMRTLQEQGIWFVGTAGE 178

Query: 216 SKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
           +   + Q      +A+++GAEG G+R  T+ET   +  + M G + +LNVS A+ + L+
Sbjct: 179 ATHDIYQAKLTGPLAIVMGAEGDGMRRLTRETCDDLIKIPMAGTVSSLNVSVASGICLF 237


>gi|104774468|ref|YP_619448.1| tRNA/rRNA methyltransferase [Lactobacillus delbrueckii subsp.
           bulgaricus ATCC 11842]
 gi|103423549|emb|CAI98467.1| tRNA/rRNA methyltransferase [Lactobacillus delbrueckii subsp.
           bulgaricus ATCC 11842]
          Length = 255

 Score =  112 bits (280), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 73/241 (30%), Positives = 116/241 (48%), Gaps = 12/241 (4%)

Query: 44  SQPENLFLYGVHTVSAALNNPS----RKIFQLLATKNALARLDWDANLPHPFPVKTVPPQ 99
           S   N F++G H     L         K+F     +   AR  +         ++ VP  
Sbjct: 8   SSTNNDFVFGRHAGIDFLKTQDSEKINKVFLAEGVQEDFAREVYRYAKKKHLIIQRVPKN 67

Query: 100 TIDKIVGKEAVHQGLALETAPLLSPTLDAV------RNSQLLMVLDHVNDPHNIGAILRS 153
            +DK+ G E  HQGL L  A       D +        + LL++LD++ DPHN+G+ILRS
Sbjct: 68  KLDKLTGGEN-HQGLVLAVASFEYADFDQLLDKLDQEEAPLLLMLDNIEDPHNLGSILRS 126

Query: 154 AVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLS 213
           A A    G+I  KR +   ++V+AK+++GA++H+P  R++NL    Q +   G+   G +
Sbjct: 127 ADATGVSGVIIPKRRASGLTSVVAKTSTGAIDHVPVARVNNLVQTCQALKDRGYWIFGTA 186

Query: 214 SDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVAL 273
            +      +   N K  L++G EGKG+ P   +       + M G +++LN S A  V L
Sbjct: 187 MEGDD-YRKWNANGKTVLVIGNEGKGISPLLLKQMDQTLTIPMIGHVQSLNASVATGVLL 245

Query: 274 Y 274
           Y
Sbjct: 246 Y 246


>gi|253996415|ref|YP_003048479.1| TrmH family RNA methyltransferase [Methylotenera mobilis JLW8]
 gi|253983094|gb|ACT47952.1| RNA methyltransferase, TrmH family, group 3 [Methylotenera mobilis
           JLW8]
          Length = 250

 Score =  112 bits (280), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 74/235 (31%), Positives = 118/235 (50%), Gaps = 10/235 (4%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLATKNAL-ARLDWDANLPHPFPVKT--VPPQTIDKIVG 106
            L+G H V + L   S  + ++L  ++ + AR+    N+     V+T  V    +D + G
Sbjct: 6   ILFGFHAVLSRLRQHSASVQEILIDRDRVDARMKDLLNMAESSGVRTMQVERSRLDGMAG 65

Query: 107 KEAVHQGLALETA--PLLSPTLDAVRNSQL-----LMVLDHVNDPHNIGAILRSAVAFSC 159
               HQG+       P+    +  +  S L      ++LD V DPHN+GA LR A A   
Sbjct: 66  MNGRHQGVIARVVDTPIPYKDIHDILESDLSEPAFFLILDGVEDPHNLGACLRVADAMGV 125

Query: 160 DGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKP 219
             +I  K  +   +A + K A GA E +P+I ++NL   ++++   G   +G + DS   
Sbjct: 126 HAVIAPKDRAAGLNATVRKVACGAAETVPFIAVTNLARTIRELKEAGVFVVGTTMDSPST 185

Query: 220 LEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
           L     N  IAL+LGAEG G+R  T ET  ++  + M G +++LNVS A+ + LY
Sbjct: 186 LLNTKLNGPIALVLGAEGDGMRRLTAETCDALMTIPMFGSVQSLNVSVASGICLY 240


>gi|291482468|dbj|BAI83543.1| hypothetical protein BSNT_00195 [Bacillus subtilis subsp. natto
           BEST195]
          Length = 249

 Score =  112 bits (280), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 68/235 (28%), Positives = 125/235 (53%), Gaps = 13/235 (5%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLATKNAL---ARLDWDANLPHPFPVKTVPPQTIDKIVG 106
           ++ G + V   L +  RK+++L   +N +   A+   +        ++ VP + +D++V 
Sbjct: 7   YVIGKNAVIETLKS-DRKLYKLWMAENTVKGQAQQVIELAKKQGITIQYVPRKKLDQMVT 65

Query: 107 KEAVHQGLALETAPLLSPTLDAV------RNSQ-LLMVLDHVNDPHNIGAILRSAVAFSC 159
            +  HQG+  + A      LD +      +N Q   ++LD + DPHN+G+I+R+A A   
Sbjct: 66  GQ--HQGVVAQVAAYEYAELDDLYKAAEEKNEQPFFLILDELEDPHNLGSIMRTADAVGA 123

Query: 160 DGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKP 219
            GI+  KR +   +  +AK+++GA+EHIP  R++NL   L++M   G   +G  + +++ 
Sbjct: 124 HGIVIPKRRAVGLTTTVAKASTGAIEHIPVARVTNLARTLEEMKERGIWVVGTDASARED 183

Query: 220 LEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
                 N  +AL++G+EGKG+    +E    +  L M G + +LN S AA + +Y
Sbjct: 184 YRNMDGNMPLALVIGSEGKGMGRLVKEKCDFLIKLPMAGKVTSLNASVAAGLLMY 238


>gi|325126286|gb|ADY85616.1| tRNA/rRNA methyltransferase [Lactobacillus delbrueckii subsp.
           bulgaricus 2038]
          Length = 249

 Score =  112 bits (280), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 73/241 (30%), Positives = 116/241 (48%), Gaps = 12/241 (4%)

Query: 44  SQPENLFLYGVHTVSAALNNPS----RKIFQLLATKNALARLDWDANLPHPFPVKTVPPQ 99
           S   N F++G H     L         K+F     +   AR  +         ++ VP  
Sbjct: 2   SSTNNDFVFGRHAGIDFLKTQDSEKINKVFLAEGVQEDFAREVYRYAKKKHLIIQRVPKN 61

Query: 100 TIDKIVGKEAVHQGLALETAPLLSPTLDAV------RNSQLLMVLDHVNDPHNIGAILRS 153
            +DK+ G E  HQGL L  A       D +        + LL++LD++ DPHN+G+ILRS
Sbjct: 62  KLDKLTGGEN-HQGLVLAVASFEYADFDQLLDKLDQEEAPLLLMLDNIEDPHNLGSILRS 120

Query: 154 AVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLS 213
           A A    G+I  KR +   ++V+AK+++GA++H+P  R++NL    Q +   G+   G +
Sbjct: 121 ADATGVSGVIIPKRRASGLTSVVAKTSTGAIDHVPVARVNNLVQTCQALKDRGYWIFGTA 180

Query: 214 SDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVAL 273
            +      +   N K  L++G EGKG+ P   +       + M G +++LN S A  V L
Sbjct: 181 MEGDD-YRKWNANGKTVLVIGNEGKGISPLLLKQMDQTLTIPMIGHVQSLNASVATGVLL 239

Query: 274 Y 274
           Y
Sbjct: 240 Y 240


>gi|229824606|ref|ZP_04450675.1| hypothetical protein GCWU000282_01953 [Catonella morbi ATCC 51271]
 gi|229785977|gb|EEP22091.1| hypothetical protein GCWU000282_01953 [Catonella morbi ATCC 51271]
          Length = 281

 Score =  112 bits (280), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 82/279 (29%), Positives = 140/279 (50%), Gaps = 31/279 (11%)

Query: 25  RNHRDYKKMQSFNQKSRHTSQ----------PENLFLYGVHTVSAAL--NNPSRKIF--Q 70
           R+ +   K Q+  +K   T+           P+   ++G H V   L  N    K+F  +
Sbjct: 7   RSRKSTSKRQTHKKKYDETTDKKIENIPDASPQEEIIFGKHAVMETLKKNKGINKLFYQK 66

Query: 71  LLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLD--- 127
            LA     + ++   N  H    + VP   +D++  + A HQGL L   P    T++   
Sbjct: 67  GLADSKISSIIELVKN--HGGIFQEVPKSKLDELT-QGANHQGLVLTVPPFDYQTIEGCL 123

Query: 128 AVRNSQ----LLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGA 183
           A+  S+     L++LD + DPHN+G+ILR+A AF   GII  KR +   + ++AK+++GA
Sbjct: 124 ALAESKGQPPFLLILDGIEDPHNLGSILRTADAFGVHGIIIPKRRAVGLTGIVAKTSTGA 183

Query: 184 LEHIPYIRISNLT---DALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGL 240
           +EH+P +R++N+    + LQ    W F T     D ++   Q      +A+++G EG+G+
Sbjct: 184 IEHVPVVRVANIAQTIELLQNQGIWVFATDMAGEDVRQWNSQ----GPLAIVIGNEGQGV 239

Query: 241 RPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNH 279
            P  ++ A  +  + M G +++LN S AA V +Y    H
Sbjct: 240 SPLVKQKADGIVTIPMVGHVQSLNASVAAGVLVYEVARH 278


>gi|308048246|ref|YP_003911812.1| 23S rRNA Gm-2251 2'-O-methyltransferase [Ferrimonas balearica DSM
           9799]
 gi|307630436|gb|ADN74738.1| 23S rRNA Gm-2251 2'-O-methyltransferase [Ferrimonas balearica DSM
           9799]
          Length = 245

 Score =  112 bits (280), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 76/236 (32%), Positives = 115/236 (48%), Gaps = 14/236 (5%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLATKNAL-ARLDWDANLPHPFPVKTVPPQTIDKIVGKE 108
            ++G+H V A +     ++ +L   K     RL   A L   F V+  P     K++  +
Sbjct: 5   MVFGLHAVEALMQRQPERVMELWVMKGRDDERLTRIAELAQQFGVR--PQLAARKVLDDK 62

Query: 109 AV---HQGLALETAPL-------LSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFS 158
           A    HQG+     P        L   LD V ++  L+VLD V DPHN+GA LRSA A  
Sbjct: 63  AESTQHQGVVARCKPEPVKGEHELDQLLDGV-DTPFLLVLDGVTDPHNLGACLRSADAAG 121

Query: 159 CDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKK 218
             G+I  K  S S   ++ K A GA E IP  +++NL   L+ +   G   +G + ++  
Sbjct: 122 VHGVIVPKDRSASLGPIVRKVAVGAAESIPLFQVTNLARTLRSLQERGIWIVGAAGEATH 181

Query: 219 PLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
            + Q      +A+ +GAEGKGLR  T+E    +  + M G + +LNVS A  + L+
Sbjct: 182 TVYQSKLTGPLAIAMGAEGKGLRRLTREHCDDLISIPMAGAVSSLNVSVATGICLF 237


>gi|257462508|ref|ZP_05626920.1| 23S rRNA methyltransferase [Fusobacterium sp. D12]
 gi|317060164|ref|ZP_07924649.1| 23S rRNA methyltransferase [Fusobacterium sp. D12]
 gi|313685840|gb|EFS22675.1| 23S rRNA methyltransferase [Fusobacterium sp. D12]
          Length = 238

 Score =  112 bits (280), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 52/146 (35%), Positives = 90/146 (61%)

Query: 128 AVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHI 187
           A R+  +L++LD + DP N GA++RSA  F  DGI+  +R S   +  + K+++GA+E++
Sbjct: 83  AGRSQSILLMLDEIQDPRNFGALIRSAEVFGVDGILIPERNSVRINETVVKTSTGAIEYV 142

Query: 188 PYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQET 247
           P I+++NL++A++K+    +   G + +++   ++E    K+ LILG EG GLR K +E 
Sbjct: 143 PIIKVTNLSNAIEKLKKIDYWVYGAAGEAELSCQEEQYPKKVVLILGNEGTGLRKKVREH 202

Query: 248 ATSMAHLHMPGIIKALNVSNAAAVAL 273
              +  + M G I +LNVS A  + L
Sbjct: 203 CDKLIKIQMRGKINSLNVSVAGGILL 228


>gi|321313767|ref|YP_004206054.1| 23S rRNA methyltransferase [Bacillus subtilis BSn5]
 gi|320020041|gb|ADV95027.1| 23S rRNA methyltransferase [Bacillus subtilis BSn5]
          Length = 249

 Score =  112 bits (280), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 68/235 (28%), Positives = 125/235 (53%), Gaps = 13/235 (5%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLATKNAL---ARLDWDANLPHPFPVKTVPPQTIDKIVG 106
           ++ G + V   L +  RK+++L   +N +   A+   +        ++ VP + +D++V 
Sbjct: 7   YVIGKNAVIETLKS-DRKLYKLWMAENTVKGQAQQVIELAKKQGITIQYVPRKKLDQMVT 65

Query: 107 KEAVHQGLALETAPLLSPTLDAV------RNSQ-LLMVLDHVNDPHNIGAILRSAVAFSC 159
            +  HQG+  + A      LD +      +N Q   ++LD + DPHN+G+I+R+A A   
Sbjct: 66  GQ--HQGVVAQVAAYEYAELDDLYKAAEEKNEQPFFLILDELEDPHNLGSIMRTADAVGA 123

Query: 160 DGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKP 219
            GI+  KR +   +  +AK+++GA+EHIP  R++NL   L++M   G   +G  + +++ 
Sbjct: 124 HGIVIPKRRAVGLTTTVAKASTGAIEHIPVARVTNLARTLEEMKERGIWVVGTDASARED 183

Query: 220 LEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
                 N  +AL++G+EGKG+    +E    +  L M G + +LN S AA + +Y
Sbjct: 184 YRNMDGNMPLALVIGSEGKGMGRLVKEKCDFLIKLPMAGKVTSLNASVAAGLLMY 238


>gi|330960080|gb|EGH60340.1| TrmH family RNA methyltransferase [Pseudomonas syringae pv.
           maculicola str. ES4326]
          Length = 250

 Score =  112 bits (280), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 77/247 (31%), Positives = 116/247 (46%), Gaps = 38/247 (15%)

Query: 51  LYGVHTVSAAL----------------NNPSRKIFQLLATKNALARLDWDANLPHPFPVK 94
           +YGVH V A L                N+P  +    LA++N +              + 
Sbjct: 7   IYGVHAVEALLRHHPKRVKHIWLAEGRNDPRVQTLVALASENRVT-------------IG 53

Query: 95  TVPPQTIDKIVGKEAVHQGLALETAP-------LLSPTLDAVRNSQLLMVLDHVNDPHNI 147
               + +D  V  E VHQG+  + +P       +L   LD      LL+VLD V DPHN+
Sbjct: 54  QAERREMDAWV--EGVHQGVVADVSPSQVWGEAMLEELLDRSEGPPLLLVLDGVTDPHNL 111

Query: 148 GAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGF 207
           GA LR+A A     +I  K  S + +  + K A GA E IP + ++NL   L+K+   G 
Sbjct: 112 GACLRTADAAGALAVIVPKDKSATLTPAVRKVACGAAEVIPLVAVTNLARTLEKLQQRGL 171

Query: 208 QTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSN 267
             +G + +++  L Q+       +I+GAEGKG+R  T+E    +  L M G + +LNVS 
Sbjct: 172 WVVGTAGEAEVELYQQDLTGPTIIIMGAEGKGMRRLTREHCDYLVRLPMAGSVSSLNVSV 231

Query: 268 AAAVALY 274
           A  V L+
Sbjct: 232 ATGVCLF 238


>gi|154684614|ref|YP_001419775.1| YacO [Bacillus amyloliquefaciens FZB42]
 gi|154350465|gb|ABS72544.1| YacO [Bacillus amyloliquefaciens FZB42]
          Length = 249

 Score =  112 bits (280), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 67/235 (28%), Positives = 125/235 (53%), Gaps = 13/235 (5%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLATKNAL---ARLDWDANLPHPFPVKTVPPQTIDKIVG 106
           ++ G + V   L +  RK+++L   +N +   A+   +        ++ VP + +D++V 
Sbjct: 7   YVIGKNAVIETLKS-DRKLYKLWMAENTVKGQAQQVMELAKKRGVTIQFVPRKKLDQMV- 64

Query: 107 KEAVHQGLALETAPLLSPTLDAV------RNSQ-LLMVLDHVNDPHNIGAILRSAVAFSC 159
            E  HQG+  + A      LD +      RN Q   ++LD + DPHN+G+I+R+A A   
Sbjct: 65  -EGQHQGVVAQVAAYEYAQLDELYKRAEERNEQPFFLILDELEDPHNLGSIMRTADAVGA 123

Query: 160 DGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKP 219
            GI+  KR +   ++ +AK+++GA+EHIP ++++NL   L +M   G   +G  + +++ 
Sbjct: 124 HGIMIPKRRAVGLTSTVAKASTGAIEHIPVVKVTNLARTLDEMKERGIWVVGTDASARED 183

Query: 220 LEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
                    +AL++G+EG+G+    +E    +  L M G + +LN S AA + +Y
Sbjct: 184 YRSMDGKMPLALVIGSEGRGMGRLVKEKCDFLIKLPMAGKVTSLNASVAAGLLMY 238


>gi|259907185|ref|YP_002647541.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Erwinia pyrifoliae
           Ep1/96]
 gi|224962807|emb|CAX54265.1| 23S rRNA (Guanosine-2\'-O-)-methyltransferase [Erwinia pyrifoliae
           Ep1/96]
 gi|283476994|emb|CAY72886.1| putative tRNA/rRNA methyltransferase [Erwinia pyrifoliae DSM 12163]
 gi|310765324|gb|ADP10274.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Erwinia sp. Ejp617]
          Length = 245

 Score =  112 bits (280), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 74/234 (31%), Positives = 118/234 (50%), Gaps = 10/234 (4%)

Query: 50  FLYGVHTVSAALN-NPSR--KIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVG 106
            ++G+H V A L+ +P R  ++F L   ++   +    A       ++    Q +D    
Sbjct: 4   IVFGIHAVQALLDSDPQRFQEVFILKGREDRRLQTLVKALEAQGIVIQVANKQMLDN-TS 62

Query: 107 KEAVHQGLALETAPLLS------PTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCD 160
           + AVHQG+     P         P L A  ++  L++LD V DPHN+GA +RSA A    
Sbjct: 63  EGAVHQGIIARVKPGRQYQEGDLPDLLASLDNPFLLILDGVTDPHNLGACMRSADAAGVH 122

Query: 161 GIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPL 220
            II  K  S + +A   K ASGA EHIP +R++NL   ++ +       +G + ++   L
Sbjct: 123 AIIVPKDRSAALNATAKKVASGAAEHIPLVRVTNLARTMRVLQEANVWIVGTAGEADHTL 182

Query: 221 EQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
            Q      +AL++GAEG+G+R  T+E    +  + M G + +LNVS A  V L+
Sbjct: 183 YQSKMTGPMALVMGAEGEGMRRLTREHCDELISIPMAGSVSSLNVSVATGVCLF 236


>gi|28872048|ref|NP_794667.1| TrmH family RNA methyltransferase [Pseudomonas syringae pv. tomato
           str. DC3000]
 gi|52783312|sp|Q87VK2|RLMB_PSESM RecName: Full=23S rRNA (guanosine-2'-O-)-methyltransferase RlmB;
           AltName: Full=23S rRNA Gm2251 2'-O-methyltransferase
 gi|28855301|gb|AAO58362.1| RNA methyltransferase, TrmH family, group 3 [Pseudomonas syringae
           pv. tomato str. DC3000]
 gi|331014619|gb|EGH94675.1| RNA methyltransferase, TrmH family, group 3 [Pseudomonas syringae
           pv. lachrymans str. M302278PT]
          Length = 250

 Score =  112 bits (280), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 77/247 (31%), Positives = 116/247 (46%), Gaps = 38/247 (15%)

Query: 51  LYGVHTVSAAL----------------NNPSRKIFQLLATKNALARLDWDANLPHPFPVK 94
           +YGVH V A L                N+P  +    LA++N +              + 
Sbjct: 7   IYGVHAVEALLRHHPKRVKHIWLAEGRNDPRVQTLVALASENRVT-------------IG 53

Query: 95  TVPPQTIDKIVGKEAVHQGLALETAP-------LLSPTLDAVRNSQLLMVLDHVNDPHNI 147
               + +D  V  E VHQG+  + +P       +L   LD      LL+VLD V DPHN+
Sbjct: 54  QAERREMDAWV--EGVHQGVVADVSPSQVWGEAMLDELLDRSEGPPLLLVLDGVTDPHNL 111

Query: 148 GAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGF 207
           GA LR+A A     +I  K  S + +  + K A GA E IP + ++NL   L+K+   G 
Sbjct: 112 GACLRTADAAGALAVIVPKDKSATLTPAVRKVACGAAEVIPLVAVTNLARTLEKLQQRGL 171

Query: 208 QTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSN 267
             +G + +++  L Q+       +I+GAEGKG+R  T+E    +  L M G + +LNVS 
Sbjct: 172 WVVGTAGEAEVELYQQDLTGPTIIIMGAEGKGMRRLTREHCDYLVRLPMAGSVSSLNVSV 231

Query: 268 AAAVALY 274
           A  V L+
Sbjct: 232 ATGVCLF 238


>gi|213967932|ref|ZP_03396078.1| RNA methyltransferase, TrmH family, group 3 [Pseudomonas syringae
           pv. tomato T1]
 gi|301383751|ref|ZP_07232169.1| RNA methyltransferase [Pseudomonas syringae pv. tomato Max13]
 gi|302059274|ref|ZP_07250815.1| RNA methyltransferase [Pseudomonas syringae pv. tomato K40]
 gi|302132342|ref|ZP_07258332.1| RNA methyltransferase [Pseudomonas syringae pv. tomato NCPPB 1108]
 gi|213927275|gb|EEB60824.1| RNA methyltransferase, TrmH family, group 3 [Pseudomonas syringae
           pv. tomato T1]
          Length = 253

 Score =  112 bits (280), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 77/247 (31%), Positives = 116/247 (46%), Gaps = 38/247 (15%)

Query: 51  LYGVHTVSAAL----------------NNPSRKIFQLLATKNALARLDWDANLPHPFPVK 94
           +YGVH V A L                N+P  +    LA++N +              + 
Sbjct: 7   IYGVHAVEALLRHHPKRVKHIWLAEGRNDPRVQTLVALASENRVT-------------IG 53

Query: 95  TVPPQTIDKIVGKEAVHQGLALETAP-------LLSPTLDAVRNSQLLMVLDHVNDPHNI 147
               + +D  V  E VHQG+  + +P       +L   LD      LL+VLD V DPHN+
Sbjct: 54  QAERREMDAWV--EGVHQGVVADVSPSQVWGEAMLDELLDRSEGPPLLLVLDGVTDPHNL 111

Query: 148 GAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGF 207
           GA LR+A A     +I  K  S + +  + K A GA E IP + ++NL   L+K+   G 
Sbjct: 112 GACLRTADAAGALAVIVPKDKSATLTPAVRKVACGAAEVIPLVAVTNLARTLEKLQQRGL 171

Query: 208 QTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSN 267
             +G + +++  L Q+       +I+GAEGKG+R  T+E    +  L M G + +LNVS 
Sbjct: 172 WVVGTAGEAEVELYQQDLTGPTIIIMGAEGKGMRRLTREHCDYLVRLPMAGSVSSLNVSV 231

Query: 268 AAAVALY 274
           A  V L+
Sbjct: 232 ATGVCLF 238


>gi|315634962|ref|ZP_07890243.1| 23S rRNA (guanosine-2'-O-)-methyltransferase RlmB [Aggregatibacter
           segnis ATCC 33393]
 gi|315476224|gb|EFU66975.1| 23S rRNA (guanosine-2'-O-)-methyltransferase RlmB [Aggregatibacter
           segnis ATCC 33393]
          Length = 245

 Score =  112 bits (280), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 80/247 (32%), Positives = 122/247 (49%), Gaps = 37/247 (14%)

Query: 51  LYGVHTVSAALNNPSRKIFQLLATK-----------NALARLDWDANLPHPFPVKTVPPQ 99
           +YG+H V A ++N   ++ ++LA K           N + RL           V+ +  Q
Sbjct: 5   IYGIHAVKAFVSNHPERLIEVLALKGRDDQRLQPLINEIQRLG--------ISVQFLNRQ 56

Query: 100 TIDKIVGKEAVHQGLALETAPLLSPTLDA--------VRNSQLLMVLDHVNDPHNIGAIL 151
           T+DK    E VHQG+      L  P L+          RN  LL+VLD V DPHN+GA L
Sbjct: 57  TLDKKAEGE-VHQGIIARVHSL--PELNEHDLDRLLETRNVPLLLVLDGVTDPHNLGACL 113

Query: 152 RSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHS----WGF 207
           R+A A     +I  K  S   ++   K A GA E++P IR++NL   L+ +      W  
Sbjct: 114 RTADAAGVSAVIVPKDKSAQLNSTARKVACGAAENVPLIRVTNLARTLRDLQERHNVW-- 171

Query: 208 QTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSN 267
             +G + ++ + L Q      +AL++GAEG+G+R  T+E    +  + M G + +LNVS 
Sbjct: 172 -VVGTAGEATETLYQTKLTGALALVMGAEGEGMRRLTREHCDQLISIPMAGSVSSLNVSV 230

Query: 268 AAAVALY 274
           A  V L+
Sbjct: 231 ATGVCLF 237


>gi|86158008|ref|YP_464793.1| RNA methyltransferase TrmH, group 3 [Anaeromyxobacter dehalogenans
           2CP-C]
 gi|85774519|gb|ABC81356.1| RNA methyltransferase TrmH, group 3 [Anaeromyxobacter dehalogenans
           2CP-C]
          Length = 256

 Score =  112 bits (280), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 64/189 (33%), Positives = 107/189 (56%), Gaps = 8/189 (4%)

Query: 93  VKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTL-DAVRNSQ------LLMVLDHVNDPH 145
           V+  P   +D++ G +  HQG+    A      L D +  +Q      LL+VLD V DPH
Sbjct: 50  VRAAPRAKLDRLAGTDR-HQGVVAVVADFRYAELEDLLARAQASGRPPLLVVLDGVEDPH 108

Query: 146 NIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSW 205
           N+GAI+RSA A    G++  +  +   +  +AK+++GA+E  P  R++N+   L+++   
Sbjct: 109 NLGAIIRSAHALGAHGVVIPRDRAVGVTPAVAKASAGAVERCPVARVTNVAKTLERLKEA 168

Query: 206 GFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNV 265
           G  ++  ++D ++ L +       AL+LG+EG+GLRP  + T    A + M G + +L+V
Sbjct: 169 GIWSVAFAADGERALGEVDLKGPTALVLGSEGEGLRPLVRRTCDLSARIPMSGDLDSLSV 228

Query: 266 SNAAAVALY 274
           S +AAVALY
Sbjct: 229 SASAAVALY 237


>gi|330873777|gb|EGH07926.1| RNA methyltransferase [Pseudomonas syringae pv. morsprunorum str.
           M302280PT]
 gi|330965990|gb|EGH66250.1| RNA methyltransferase [Pseudomonas syringae pv. actinidiae str.
           M302091]
          Length = 253

 Score =  112 bits (279), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 77/247 (31%), Positives = 116/247 (46%), Gaps = 38/247 (15%)

Query: 51  LYGVHTVSAAL----------------NNPSRKIFQLLATKNALARLDWDANLPHPFPVK 94
           +YGVH V A L                N+P  +    LA++N +              + 
Sbjct: 7   IYGVHAVEALLRHHPKRVKHIWLAEGRNDPRVQTLVALASENRVT-------------IG 53

Query: 95  TVPPQTIDKIVGKEAVHQGLALETAP-------LLSPTLDAVRNSQLLMVLDHVNDPHNI 147
               + +D  V  E VHQG+  + +P       +L   LD      LL+VLD V DPHN+
Sbjct: 54  QAERREMDAWV--EGVHQGVVADVSPSQVWGEAMLDELLDRSEGPPLLLVLDGVTDPHNL 111

Query: 148 GAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGF 207
           GA LR+A A     +I  K  S + +  + K A GA E IP + ++NL   L+K+   G 
Sbjct: 112 GACLRTADAAGALAVIVPKDKSATLTPAVRKVACGAAEVIPLVAVTNLARTLEKLQQRGL 171

Query: 208 QTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSN 267
             +G + +++  L Q+       +I+GAEGKG+R  T+E    +  L M G + +LNVS 
Sbjct: 172 WVVGTAGEAEVELYQQDLTGPTIIIMGAEGKGMRRLTREHCDYLVRLPMAGSVSSLNVSV 231

Query: 268 AAAVALY 274
           A  V L+
Sbjct: 232 ATGVCLF 238


>gi|298491203|ref|YP_003721380.1| TrmA family RNA methyltransferase ['Nostoc azollae' 0708]
 gi|298233121|gb|ADI64257.1| RNA methyltransferase, TrmH family, group 3 ['Nostoc azollae' 0708]
          Length = 323

 Score =  112 bits (279), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 84/299 (28%), Positives = 145/299 (48%), Gaps = 31/299 (10%)

Query: 1   MNLISKKKSEKIFSLKDSHYAKLRRNHRDYKKMQSFNQKSRHTSQ-----------PENL 49
           +N+  + K  +   +K          H+   + +SF+ K R + Q            E+ 
Sbjct: 8   INITGETKRVQPIKIKGKRVIANPTRHQTKGESKSFSSKPRPSHQSSLPTPAIKSPEESD 67

Query: 50  FLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPF--------PVKTVPPQTI 101
            +YG H V +AL N  R + +L  T    ARL +D    H           +  V P+ +
Sbjct: 68  LIYGRHPVLSALEN-QRGLNRLWIT----ARLRYDPRFHHLILQAKDNGTVIDEVEPKRL 122

Query: 102 DKIVGKEAVHQGLALETAPLLSPTL-DAVRNSQ-----LLMVLDHVNDPHNIGAILRSAV 155
           D+I    A HQG+A + AP     L D +  ++     +++V D + DPHN+GAI+R+A 
Sbjct: 123 DQIT-DGANHQGIAAQIAPYAYMELEDLITQAKSVTDPVIVVADGITDPHNLGAIIRTAE 181

Query: 156 AFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSD 215
           A    G++  +R +   ++ + K A+GALE+ P  R+ NL+ AL+++   G+   G ++ 
Sbjct: 182 AIGSQGLVIPQRRASGITSTVVKVAAGALENFPVARVINLSRALEQLKEAGYWIYGTAAA 241

Query: 216 SKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
             +P+     +    L++G+EG GL   TQ +   +  + + G   +LN S AA +ALY
Sbjct: 242 GSEPIHTVKFSGSTVLVIGSEGDGLSMLTQRSCDILVSIPLQGKTPSLNASVAAGMALY 300


>gi|113954303|ref|YP_730838.1| RNA methyltransferase [Synechococcus sp. CC9311]
 gi|113881654|gb|ABI46612.1| RNA methyltransferase, TrmH family, group 3 [Synechococcus sp.
           CC9311]
          Length = 589

 Score =  112 bits (279), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 62/173 (35%), Positives = 101/173 (58%), Gaps = 7/173 (4%)

Query: 109 AVHQGLALETAPLLSPTLD-------AVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDG 161
           AVHQG+ L+TA   +  L+       A+  + LL+ LD + DPHN+GAI+RSA A    G
Sbjct: 313 AVHQGIVLQTAAAETFDLEDLVKGCSALDEAPLLLALDGLTDPHNLGAIVRSAEALGAHG 372

Query: 162 IITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLE 221
           ++  +R S   +  +AK A+GALEH+P  R+ NL  +L+ + S G++ IGL+ +    LE
Sbjct: 373 VVLPQRRSAGLTGSVAKVAAGALEHLPVARVVNLNRSLETLKSSGYRVIGLAEEGDLTLE 432

Query: 222 QEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
           +   +  + ++ G+EG+GL   T+     +  + + G+  +LN S A A+ LY
Sbjct: 433 EVDLDGPLVIVTGSEGQGLSMLTRRHCDQLIRIPLRGVTPSLNASVATALCLY 485


>gi|256852091|ref|ZP_05557478.1| tRNA-rRNA methyltransferase [Lactobacillus jensenii 27-2-CHN]
 gi|260661339|ref|ZP_05862252.1| tRNA-rRNA methyltransferase [Lactobacillus jensenii 115-3-CHN]
 gi|282934883|ref|ZP_06340115.1| RNA methyltransferase, TrmH family, group 3 [Lactobacillus jensenii
           208-1]
 gi|297205034|ref|ZP_06922430.1| RNA methyltransferase [Lactobacillus jensenii JV-V16]
 gi|256615503|gb|EEU20693.1| tRNA-rRNA methyltransferase [Lactobacillus jensenii 27-2-CHN]
 gi|260547794|gb|EEX23771.1| tRNA-rRNA methyltransferase [Lactobacillus jensenii 115-3-CHN]
 gi|281301064|gb|EFA93376.1| RNA methyltransferase, TrmH family, group 3 [Lactobacillus jensenii
           208-1]
 gi|297149612|gb|EFH29909.1| RNA methyltransferase [Lactobacillus jensenii JV-V16]
          Length = 251

 Score =  112 bits (279), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 74/235 (31%), Positives = 119/235 (50%), Gaps = 12/235 (5%)

Query: 50  FLYGVHTVSAALNNPS----RKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIV 105
           F++G H     L N S     K+F     +   A   +         V+ VP   +DK+V
Sbjct: 8   FVFGRHAGIDFLKNESADKINKVFLQNGVQVEFANQVYGLAKKKHLIVQEVPKNKLDKLV 67

Query: 106 GKEAVHQGLALETAPLLSPTLD------AVRNSQLLMVLDHVNDPHNIGAILRSAVAFSC 159
             +A HQGL L  +      LD      A + +  L++LD + DPHN+G+ILRSA A   
Sbjct: 68  -PDANHQGLVLAISSFEYADLDKLVKKIADKENPFLLMLDSIEDPHNLGSILRSADATGV 126

Query: 160 DGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKP 219
           DGII  KR +   ++V+AK+++GA++H+P  R++NL    +++   G+   G + + +  
Sbjct: 127 DGIIIPKRRASGLTSVVAKTSTGAIDHVPVCRVNNLVQTTKELKKAGYWFFGTAMEGQDY 186

Query: 220 LEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
              + K  K  L++G EGKG+ P   +       + M G +++LN S A  V LY
Sbjct: 187 RYWDAKG-KCVLVIGNEGKGISPLLLKQMDQTLTIPMVGHVQSLNASVATGVLLY 240


>gi|253699965|ref|YP_003021154.1| RNA methyltransferase, TrmH family, group 3 [Geobacter sp. M21]
 gi|251774815|gb|ACT17396.1| RNA methyltransferase, TrmH family, group 3 [Geobacter sp. M21]
          Length = 249

 Score =  112 bits (279), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 71/234 (30%), Positives = 124/234 (52%), Gaps = 11/234 (4%)

Query: 50  FLYGVHTVSAALNNPSRKIFQL-LATKNALARLDWDANLP--HPFPVKTVPPQTIDKIVG 106
            +YG++ V  AL   SR+I +L +A  ++  RL+    L      PV+      ++++ G
Sbjct: 6   IIYGLNPVMEALRG-SREIHELFVAGTSSDKRLEKLLKLAADRKIPVRQREKGDLNRLCG 64

Query: 107 KEAVHQGLALETAPLLSPTLDAV------RNSQLLMVLDHVNDPHNIGAILRSAVAFSCD 160
            E  HQG+AL+  P     LD V          L++VLD V DPHN+GA++RSA      
Sbjct: 65  TEH-HQGVALKVEPFPYADLDDVLAELKGNQEGLVLVLDSVQDPHNLGALIRSAACAGAH 123

Query: 161 GIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPL 220
            ++  K  +   +AV  KS++GA E I   +++N++ AL+ +   GF   G    ++  L
Sbjct: 124 AVVIPKDRAAGVTAVAEKSSAGATETISVAQVTNISQALESLKKAGFWIYGADGSARSTL 183

Query: 221 EQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
            Q+  +  +AL++G EG+G+RP  ++   ++  + + G + +LN S A  + L+
Sbjct: 184 YQQDFSGPVALVIGGEGEGIRPLVRKGCDAVVSIPLQGGVNSLNASVAGGIMLF 237


>gi|157690879|ref|YP_001485341.1| tRNA/rRNA methyltransferase [Bacillus pumilus SAFR-032]
 gi|194017547|ref|ZP_03056158.1| RNA methyltransferase, TrmH family, group 3 [Bacillus pumilus ATCC
           7061]
 gi|157679637|gb|ABV60781.1| tRNA/rRNA methyltransferase [Bacillus pumilus SAFR-032]
 gi|194010819|gb|EDW20390.1| RNA methyltransferase, TrmH family, group 3 [Bacillus pumilus ATCC
           7061]
          Length = 249

 Score =  112 bits (279), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 62/189 (32%), Positives = 107/189 (56%), Gaps = 9/189 (4%)

Query: 93  VKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAV------RNSQ-LLMVLDHVNDPH 145
           ++ VP + +D++V  +  HQG+  + A      LD +      RN Q   ++LD + DPH
Sbjct: 52  IQYVPRKKLDQMVTGQ--HQGIVAQVAAYEYAELDDLYQIAEQRNEQPFFLILDEIEDPH 109

Query: 146 NIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSW 205
           N+G+I+R+A A    GI+  KR +   +  +AK+++GA+EHIP  +++NL+ AL +M   
Sbjct: 110 NLGSIMRTADAVGAHGIVIPKRRAVGLTTTVAKASTGAIEHIPVAKVTNLSRALDEMKER 169

Query: 206 GFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNV 265
           G    G  + +K+   Q      +AL++G+EGKG+    +E    +  L M G + +LN 
Sbjct: 170 GIWVAGTDASAKQDYRQFDGTMPLALVIGSEGKGIGRLIKEKCDFLIKLPMAGKVTSLNA 229

Query: 266 SNAAAVALY 274
           S AA++ +Y
Sbjct: 230 SVAASLLMY 238


>gi|56461042|ref|YP_156323.1| rRNA methylase [Idiomarina loihiensis L2TR]
 gi|56180052|gb|AAV82774.1| RRNA methylase, SpoU family [Idiomarina loihiensis L2TR]
          Length = 248

 Score =  112 bits (279), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 73/238 (30%), Positives = 125/238 (52%), Gaps = 11/238 (4%)

Query: 47  ENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWD-ANLPHPFPVKT--VPPQTIDK 103
           + + ++G+H V A L N   ++ +L  +K        D  N  H   V+   VP Q ++K
Sbjct: 3   QKVTVFGLHAVRAILKNHPDRLVELYVSKERQDDSVRDIVNQCHATGVRPQWVPKQALEK 62

Query: 104 IVGKEAVHQGLA--LETAPLLSP-----TLDAVRNSQLLMVLDHVNDPHNIGAILRSAVA 156
              +   HQG+   +++ P L+       L+  + + L ++LD V DPHN+GA LR+A A
Sbjct: 63  -RAEGGNHQGVVATVQSPPTLTEHDLPKLLEQSQQAGLFLILDGVTDPHNLGACLRTADA 121

Query: 157 FSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDS 216
               G+I  K  S   +  + K ASGA E++P + ++NL  AL+ +   G    G + ++
Sbjct: 122 AGVTGVIVPKDKSAQITPTVRKVASGAAENVPLVVVTNLARALRDLQELGVWAYGTAGEA 181

Query: 217 KKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
            + +        +AL++GAEGKG+R  T+ET   +  + + G + +LNVS A+ V L+
Sbjct: 182 TQSVYDVDYRGPVALVMGAEGKGMRRLTRETCDDLVSIPLSGSVSSLNVSVASGVCLF 239


>gi|222055495|ref|YP_002537857.1| RNA methyltransferase, TrmH family, group 3 [Geobacter sp. FRC-32]
 gi|221564784|gb|ACM20756.1| RNA methyltransferase, TrmH family, group 3 [Geobacter sp. FRC-32]
          Length = 245

 Score =  112 bits (279), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 66/233 (28%), Positives = 122/233 (52%), Gaps = 9/233 (3%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHP--FPVKTVPPQTIDKIVGK 107
            +YG+++V  AL    R     +A+ ++  RL+   +L      PV+    + I ++ G 
Sbjct: 5   IIYGLNSVMEALRGKRRAFELFVASGSSDRRLEKLLDLAEEKRVPVRHRDKRDISRLCGT 64

Query: 108 EAVHQGLALETAPLLSPTL------DAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDG 161
           +  HQG+AL T       L      +  R++ LL+VLD V DPHN+GA++RSA      G
Sbjct: 65  DH-HQGIALRTERFAYAQLADILESETARSNGLLLVLDGVQDPHNLGALIRSAACAGAQG 123

Query: 162 IITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLE 221
           +I  K  +   +A + K+++GA+E I    ++N+   L ++ + GF   G   +S   + 
Sbjct: 124 VIIPKDRAVGVTAAVEKASAGAIETIAVAEVTNIAQTLDELKAAGFWIYGADGESPISIF 183

Query: 222 QEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
           ++     +AL++G+EG+G+RP  ++    +  + + G + +LN S A  + L+
Sbjct: 184 EQKLTGAVALVIGSEGEGIRPLVKKRCDILVSIPLKGGVNSLNASVAGGIMLF 236


>gi|157413277|ref|YP_001484143.1| RNA methyltransferase TrmH, group 3 [Prochlorococcus marinus str.
           MIT 9215]
 gi|157387852|gb|ABV50557.1| RNA methyltransferase TrmH, group 3 [Prochlorococcus marinus str.
           MIT 9215]
          Length = 326

 Score =  111 bits (278), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 63/173 (36%), Positives = 101/173 (58%), Gaps = 7/173 (4%)

Query: 109 AVHQGLALETAPLLSPTLDAVRN-------SQLLMVLDHVNDPHNIGAILRSAVAFSCDG 161
           A HQG+AL+ A   + +L+ + +       + +++ LD + DPHN+GAI+RSA AF C G
Sbjct: 149 ASHQGVALQLACSKTISLEKLIDISKHNCANPIILALDGITDPHNVGAIIRSAEAFDCKG 208

Query: 162 IITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLE 221
           II  +R S   +  +AK A+GALEH+   R+ NL  AL+ +   GF  +GLS D +  L 
Sbjct: 209 IIIPQRRSAGLTGTVAKVAAGALEHLQVSRVVNLNRALEVLKKNGFLIVGLSGDGQLSLS 268

Query: 222 QEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
              +   + +I+G+E KG+   TQ+    +  + + G   +LN S AAA++L+
Sbjct: 269 NFSEIVPLVVIVGSEDKGISLLTQKKCDFLLSIPLKGKTSSLNASVAAAISLF 321


>gi|260779505|ref|ZP_05888395.1| 23S rRNA (guanosine-2'-O-) -methyltransferase RlmB [Vibrio
           coralliilyticus ATCC BAA-450]
 gi|260604314|gb|EEX30618.1| 23S rRNA (guanosine-2'-O-) -methyltransferase RlmB [Vibrio
           coralliilyticus ATCC BAA-450]
          Length = 245

 Score =  111 bits (278), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 75/240 (31%), Positives = 122/240 (50%), Gaps = 18/240 (7%)

Query: 48  NLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLP-------HPFPVKTVPPQT 100
           N F+YG+H V A L     +  +    K    R D D  +P           ++ +  +T
Sbjct: 3   NEFIYGIHAVKAVLAKEPERFVEAFVLKG---RQD-DRLMPILNELQMCGVSIQQMTRKT 58

Query: 101 IDKIVGKEAVHQGLALETAP---LLSPTLD---AVRNSQLLMVLDHVNDPHNIGAILRSA 154
           +D    + A HQG+  +  P   L    LD   A  ++ LL+VLD V DPHN+GA LR+A
Sbjct: 59  LDD-KARGANHQGIMAKVKPAKQLNENDLDDILAQHSAPLLLVLDGVTDPHNLGACLRNA 117

Query: 155 VAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSS 214
            A     +I  K  S + +A ++K A GA E +P +R++NL   ++ +   G   +G + 
Sbjct: 118 DAAGVAAVIVPKDKSANITATVSKVACGAAETVPLVRVTNLARTMRALQEQGIWFVGTAG 177

Query: 215 DSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
           ++   + Q      +A+++GAEG G+R  T+ET   +  + M G + +LNVS A+ V L+
Sbjct: 178 EATHDIYQAKLTGPLAIVMGAEGDGMRRLTRETCDDLIKIPMAGSVSSLNVSVASGVCLF 237


>gi|224475680|ref|YP_002633286.1| putative rRNA methyltransferase [Staphylococcus carnosus subsp.
           carnosus TM300]
 gi|222420287|emb|CAL27101.1| putative rRNA methyltransferase [Staphylococcus carnosus subsp.
           carnosus TM300]
          Length = 249

 Score =  111 bits (278), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 74/242 (30%), Positives = 128/242 (52%), Gaps = 21/242 (8%)

Query: 47  ENLFLYGVHTVSAAL--NNPSRKIFQLLATKNALARLDWDANLPHP----FPVKTVPPQT 100
           E+  + G H V  A+   +P  KI      ++ + +   +  L H       V+TVP   
Sbjct: 4   EDSVIVGRHAVKEAITTGHPINKIL----IQDGVKKQQLEEILKHAKNQKIVVQTVPKSK 59

Query: 101 IDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQL--------LMVLDHVNDPHNIGAILR 152
           +D +   EA HQG+A   AP     LD +  +QL        L++LD + DPHN+G+ILR
Sbjct: 60  LDHLA--EAPHQGVAALVAPYEYADLDKLL-AQLKDKDGLPTLVILDGLEDPHNLGSILR 116

Query: 153 SAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGL 212
           +A A   DG+I  KR S + +  +AK+++GA++H+P +R++NL+  + ++   G+   G 
Sbjct: 117 TADAAGVDGVIIPKRRSVALTQTVAKASAGAIQHVPVVRVTNLSQTMDQLKDEGYWIAGT 176

Query: 213 SSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVA 272
           ++D+     Q   +  +A+++G EG G+    +E       + M G I +LN S AA++ 
Sbjct: 177 AADNATDYRQMAADMPLAIVIGNEGHGMSRLVKEKCDFYIKIPMVGHINSLNASVAASLM 236

Query: 273 LY 274
           +Y
Sbjct: 237 MY 238


>gi|224283924|ref|ZP_03647246.1| tRNA/rRNA methyltransferase protein [Bifidobacterium bifidum NCIMB
           41171]
 gi|310288277|ref|YP_003939536.1| SpoU rRNA methylase family protein [Bifidobacterium bifidum S17]
 gi|311065139|ref|YP_003971865.1| RNA/rRNA methyltransferase protein [Bifidobacterium bifidum
           PRL2010]
 gi|313141076|ref|ZP_07803269.1| tRNA/rRNA methyltransferase protein [Bifidobacterium bifidum NCIMB
           41171]
 gi|309252214|gb|ADO53962.1| SpoU rRNA methylase family protein [Bifidobacterium bifidum S17]
 gi|310867459|gb|ADP36828.1| RNA/rRNA methyltransferase protein [Bifidobacterium bifidum
           PRL2010]
 gi|313133586|gb|EFR51203.1| tRNA/rRNA methyltransferase protein [Bifidobacterium bifidum NCIMB
           41171]
          Length = 332

 Score =  111 bits (278), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 55/142 (38%), Positives = 88/142 (61%), Gaps = 1/142 (0%)

Query: 134 LLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRIS 193
           L + LD V DP N+GA++RSA AF  +G+I  +R S S +A   K ++GA  HIP  R+ 
Sbjct: 176 LFIALDGVTDPQNLGAVIRSAAAFGANGVILPERRSASVTAAAWKVSAGAAAHIPVARVV 235

Query: 194 NLTDALQKMHSWGFQTIGLSSDSKKPL-EQEIKNDKIALILGAEGKGLRPKTQETATSMA 252
           NLT A++ M   G+ T+GL     K + E   + D + ++LG+EGKGL    +E+  ++A
Sbjct: 236 NLTKAIESMRERGYYTVGLDGGGDKLVGETGFETDPLIVVLGSEGKGLSRLVRESCDAIA 295

Query: 253 HLHMPGIIKALNVSNAAAVALY 274
            + +  ++++LN S AA ++LY
Sbjct: 296 GIPITSMVESLNASVAAGISLY 317


>gi|159903237|ref|YP_001550581.1| RNA methyltransferase TrmH, group 3 [Prochlorococcus marinus str.
           MIT 9211]
 gi|159888413|gb|ABX08627.1| RNA methyltransferase TrmH, group 3 [Prochlorococcus marinus str.
           MIT 9211]
          Length = 413

 Score =  111 bits (278), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 64/175 (36%), Positives = 98/175 (56%), Gaps = 11/175 (6%)

Query: 109 AVHQGLALETAPLLSPTLD---------AVRNSQLLMVLDHVNDPHNIGAILRSAVAFSC 159
            VHQG+AL+TA   S TLD          +  S +L+ LD + DPHN+GAI+RSA A   
Sbjct: 209 GVHQGIALQTAA--SKTLDLQTLIDGCSQLGESSVLIALDGLTDPHNVGAIIRSAEALGA 266

Query: 160 DGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKP 219
            G++  +R S   +  +AK A+GALEH P  R+ NL  +L ++   G+  IGL+ D    
Sbjct: 267 HGLVLPQRRSAGLTGSVAKVAAGALEHFPVARVVNLNRSLIELKDAGYSVIGLAGDGDFV 326

Query: 220 LEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
           L +      + L++G+E KGL   T+     +  + + G+  +LN S AA+++LY
Sbjct: 327 LNEVDLLGPLVLVIGSEDKGLSVLTRRNCDQLVRVPLRGVTSSLNASVAASISLY 381


>gi|332365573|gb|EGJ43333.1| RNA methyltransferase [Streptococcus sanguinis SK1059]
          Length = 247

 Score =  111 bits (278), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 74/240 (30%), Positives = 121/240 (50%), Gaps = 9/240 (3%)

Query: 42  HTSQPENLFLYGVHTVSAALN-NPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQT 100
           + S  +N  +YGVH V+ AL  N   K++     +        D        +   P +T
Sbjct: 3   YYSYGKNDIVYGVHAVTEALAANTGNKLYIQDDLRGKKVDKIKDLAAEKKVSISWTPKKT 62

Query: 101 IDKIVGKEAVHQGLALETAPLLSPTLDAV------RNSQLLMVLDHVNDPHNIGAILRSA 154
           + ++    AVHQG  L  A       + +       ++ LL++LD + DPHN+G+ILR+A
Sbjct: 63  LQEMT-DGAVHQGFVLRVAEFAYTDFEVLLKKAEQEDNPLLLILDGLTDPHNLGSILRTA 121

Query: 155 VAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSS 214
            A +  G+I  K  +   + V+AK+++GA+EHIP  R++NL+  L K+    F   G   
Sbjct: 122 DATNVAGVIIPKHRAVGVTPVVAKTSTGAIEHIPIARVTNLSQTLDKLKEASFWIFGTDM 181

Query: 215 DSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
               P  +     K+ALI+G EGKG+    ++    M  + M G +++LN S AAA+ +Y
Sbjct: 182 QG-TPSHKWNTAGKLALIIGNEGKGISTNIKKQVDEMISIPMNGHVQSLNASVAAAILMY 240


>gi|237798286|ref|ZP_04586747.1| RNA methyltransferase [Pseudomonas syringae pv. oryzae str. 1_6]
 gi|331021138|gb|EGI01195.1| RNA methyltransferase [Pseudomonas syringae pv. oryzae str. 1_6]
          Length = 253

 Score =  111 bits (278), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 76/232 (32%), Positives = 114/232 (49%), Gaps = 8/232 (3%)

Query: 51  LYGVHTVSAAL-NNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEA 109
           +YGVH + A L ++P R     LA      R+    +L     V     +  +     E 
Sbjct: 7   IYGVHALEALLRHHPKRVKHIWLAEGRNDPRVQTLVSLASENRVTIGQAERREMDAWVEG 66

Query: 110 VHQGLALETAP-------LLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGI 162
           VHQG+  + +P       +L   LD      LL+VLD V DPHN+GA LR+A A     +
Sbjct: 67  VHQGVVADVSPSQVWGEAMLDELLDRSEGPPLLLVLDGVTDPHNLGACLRTADAAGALAV 126

Query: 163 ITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQ 222
           I  K  S + +  + K A GA E IP + ++NL   L+K+   G   +G + +++  L Q
Sbjct: 127 IVPKDKSATLTPAVRKVACGAAEVIPLVAVTNLARTLEKLQQRGLWVVGTAGEAEVELYQ 186

Query: 223 EIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
           +       +I+GAEGKG+R  T+E    +  L M G + +LNVS A  V L+
Sbjct: 187 QDLTGPTIIIMGAEGKGMRRLTREHCDYLVRLPMAGSVSSLNVSVATGVCLF 238


>gi|322513916|ref|ZP_08066993.1| 23S rRNA (guanosine-2'-O-)-methyltransferase RlmB [Actinobacillus
           ureae ATCC 25976]
 gi|322120251|gb|EFX92204.1| 23S rRNA (guanosine-2'-O-)-methyltransferase RlmB [Actinobacillus
           ureae ATCC 25976]
          Length = 247

 Score =  111 bits (278), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 79/245 (32%), Positives = 120/245 (48%), Gaps = 33/245 (13%)

Query: 51  LYGVHTVSAALNNPSRKIFQLLATK-----------NALARLDWDANLPHPFPVKTVPPQ 99
           +YG+H V A L+N   ++ ++L  K           N L RL           ++ V  Q
Sbjct: 5   IYGIHAVKAFLDNAPERLIEVLVLKGREDKRLSPLLNELQRLG--------ISIQQVNRQ 56

Query: 100 TIDKIVGKEAVHQGLALETAP---LLSPTLDAV---RNSQLLMVLDHVNDPHNIGAILRS 153
           T+D     E VHQG+  +  P   L    LD +   + +  L++LD V DPHN+GA LR+
Sbjct: 57  TLDNKAQGE-VHQGIIAKVVPQKELNEHDLDVILSQKQNPFLLILDGVTDPHNLGACLRT 115

Query: 154 AVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDA---LQKMHS-WGFQT 209
           A     D +I  K  S   ++   K A GA E +P IR++NL      LQ+ H+ W    
Sbjct: 116 ADVAGVDAVIVPKDKSAQLTSTARKVACGAAETVPLIRVTNLARTMRELQEQHNIW---I 172

Query: 210 IGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAA 269
           +G + ++   + Q      IAL++GAEG G+R  T+E    +  + M G + +LNVS A 
Sbjct: 173 VGTAGEATSGIYQAKLTGAIALVMGAEGDGMRRLTREHCDQLISIPMAGSVSSLNVSVAT 232

Query: 270 AVALY 274
            V L+
Sbjct: 233 GVCLF 237


>gi|319763224|ref|YP_004127161.1| RNA methyltransferase, trmh family, group 3 [Alicycliphilus
           denitrificans BC]
 gi|317117785|gb|ADV00274.1| RNA methyltransferase, TrmH family, group 3 [Alicycliphilus
           denitrificans BC]
          Length = 248

 Score =  111 bits (278), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 63/148 (42%), Positives = 86/148 (58%), Gaps = 1/148 (0%)

Query: 127 DAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEH 186
           D V N  LL+VLD V DPHN+GA LR A       +I  K ++   SA +AK ASGA E 
Sbjct: 95  DGVANP-LLLVLDGVTDPHNLGACLRVADGAGAHAVIAPKDHAVGISATVAKVASGAAET 153

Query: 187 IPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQE 246
           +PY  ++NL   L ++       IG S D+ K L Q      +AL+LGAEG G+R  T++
Sbjct: 154 VPYFMVTNLARTLGELKERNIWVIGTSGDADKTLYQVDLKGPVALVLGAEGPGMRQLTRK 213

Query: 247 TATSMAHLHMPGIIKALNVSNAAAVALY 274
           T   +  + M G +++LNVS A+AV LY
Sbjct: 214 TCDELVSIPMKGAVESLNVSVASAVCLY 241


>gi|260770911|ref|ZP_05879840.1| 23S rRNA (guanosine-2'-O-) -methyltransferase RlmB [Vibrio
           furnissii CIP 102972]
 gi|260614148|gb|EEX39338.1| 23S rRNA (guanosine-2'-O-) -methyltransferase RlmB [Vibrio
           furnissii CIP 102972]
 gi|315178957|gb|ADT85871.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Vibrio furnissii NCTC
           11218]
          Length = 246

 Score =  111 bits (278), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 79/244 (32%), Positives = 121/244 (49%), Gaps = 26/244 (10%)

Query: 48  NLFLYGVHTVSAALN-NPSRKIF----------QLLATKNALARLDWDANLPHPFPVKTV 96
           N F+YG+H V+A L  +P+R +           +LL   N LARL       H   +   
Sbjct: 3   NEFIYGIHAVNAVLERDPARFVEAYVLKGRQDDRLLPVLNELARLGISIQEMHRKALD-- 60

Query: 97  PPQTIDKIVGKEAVHQGLALETAP---LLSPTLDAVRNSQ---LLMVLDHVNDPHNIGAI 150
                DK  G  A HQG+  +  P   L    LD +       LL+VLD V DPHN+GA 
Sbjct: 61  -----DKAQG--ANHQGVIAKVKPAKQLNENDLDDIIAQHPQPLLLVLDGVTDPHNLGAC 113

Query: 151 LRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTI 210
           LR+A A     +I  K  S   +A ++K A GA E +P +R++NL   ++ +   G   +
Sbjct: 114 LRNADAAGVAAVIVPKDKSAPMTATVSKVACGAAETVPLVRVTNLARTMRALQEKGIWFV 173

Query: 211 GLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAA 270
           G + ++   + Q      +A+++GAEG G+R  T+ET   +  + M G + +LNVS A  
Sbjct: 174 GTAGEATHDIYQSKLTGPLAIVMGAEGDGMRRLTRETCDDLIKIPMAGSVSSLNVSVATG 233

Query: 271 VALY 274
           + L+
Sbjct: 234 ICLF 237


>gi|300859174|ref|YP_003784157.1| hypothetical protein cpfrc_01757 [Corynebacterium
           pseudotuberculosis FRC41]
 gi|300686628|gb|ADK29550.1| hypothetical protein cpfrc_01757 [Corynebacterium
           pseudotuberculosis FRC41]
 gi|302331428|gb|ADL21622.1| SpoU rRNA Methylase family protein [Corynebacterium
           pseudotuberculosis 1002]
 gi|308277116|gb|ADO27015.1| SpoU rRNA Methylase family protein [Corynebacterium
           pseudotuberculosis I19]
          Length = 313

 Score =  111 bits (277), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 74/268 (27%), Positives = 134/268 (50%), Gaps = 24/268 (8%)

Query: 18  SHYAKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNN--PSRKIFQLLATK 75
           +H  KL +  RD         + RH  +     + G + V   L++  P+  ++    TK
Sbjct: 48  AHKRKLEKQRRD---------QGRHKKEETAELVVGRNPVVECLHSKVPATSLYIAEGTK 98

Query: 76  NALARLDWDANLPH--PFPVKTVPPQTIDKIVGKEAVHQGLALETAP--------LLSPT 125
           N  ARL     + H    P+  V    +D++ G   +HQG+ L+  P        L++  
Sbjct: 99  ND-ARLSEAVQMAHRRGIPLIEVARHELDRMTGN-GMHQGIGLQIPPYKYVEVYDLITQA 156

Query: 126 LDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALE 185
            D+     +++VLD++ DP N+GA++RS  AF   G++  +R S S +AV  ++++G   
Sbjct: 157 KDS-GEPGMIVVLDNITDPRNLGAVIRSVAAFGGHGVVIPERRSASVTAVAWRTSAGTAA 215

Query: 186 HIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQ 245
            +P  + +N+T AL++    G+Q +GL +     L+       + +++G+EGKG+    +
Sbjct: 216 RLPVAKATNITRALKEFQQNGYQVVGLDAGGDATLDTYDGKGPVVIVVGSEGKGISRLVR 275

Query: 246 ETATSMAHLHMPGIIKALNVSNAAAVAL 273
           ET  S+  + M   +++LN S AA V L
Sbjct: 276 ETCDSIMSIPMARWVESLNASVAAGVVL 303


>gi|302206864|gb|ADL11206.1| SpoU rRNA Methylase family protein [Corynebacterium
           pseudotuberculosis C231]
          Length = 313

 Score =  111 bits (277), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 74/268 (27%), Positives = 134/268 (50%), Gaps = 24/268 (8%)

Query: 18  SHYAKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNN--PSRKIFQLLATK 75
           +H  KL +  RD         + RH  +     + G + V   L++  P+  ++    TK
Sbjct: 48  AHKRKLEKQRRD---------QGRHKKEETAELVVGRNPVVECLHSKVPATSLYIAEGTK 98

Query: 76  NALARLDWDANLPH--PFPVKTVPPQTIDKIVGKEAVHQGLALETAP--------LLSPT 125
           N  ARL     + H    P+  V    +D++ G   +HQG+ L+  P        L++  
Sbjct: 99  ND-ARLSEAVQMAHRRGIPLIEVARHELDRMTGN-GMHQGIGLQIPPYKYVEVYDLITQA 156

Query: 126 LDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALE 185
            D+     +++VLD++ DP N+GA++RS  AF   G++  +R S S +AV  ++++G   
Sbjct: 157 KDS-GEPGMIVVLDNITDPRNLGAVIRSVAAFGGHGVVIPERRSASVTAVAWRTSAGTAA 215

Query: 186 HIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQ 245
            +P  + +N+T AL++    G+Q +GL +     L+       + +++G+EGKG+    +
Sbjct: 216 RLPVAKATNITRALKEFQQNGYQVVGLDAGGDATLDTYDGKGPVVIVVGSEGKGISRLVR 275

Query: 246 ETATSMAHLHMPGIIKALNVSNAAAVAL 273
           ET  S+  + M   +++LN S AA V L
Sbjct: 276 ETCDSIMSIPMARWVESLNASVAAGVVL 303


>gi|116514573|ref|YP_813479.1| rRNA methylase [Lactobacillus delbrueckii subsp. bulgaricus ATCC
           BAA-365]
 gi|116093888|gb|ABJ59041.1| rRNA methylase [Lactobacillus delbrueckii subsp. bulgaricus ATCC
           BAA-365]
          Length = 249

 Score =  111 bits (277), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 72/241 (29%), Positives = 115/241 (47%), Gaps = 12/241 (4%)

Query: 44  SQPENLFLYGVHTVSAALNNPS----RKIFQLLATKNALARLDWDANLPHPFPVKTVPPQ 99
           S   N F++G H     L         K+F     +   AR  +         ++ VP  
Sbjct: 2   SSTNNDFVFGRHAGIDFLKTQDSEKINKVFLAEGVQEDFAREVYRYAKKKHLIIQRVPKN 61

Query: 100 TIDKIVGKEAVHQGLALETAPLLSPTLDAV------RNSQLLMVLDHVNDPHNIGAILRS 153
            +DK+ G E  HQGL L  A       D +        +  L++LD++ DPHN+G+ILRS
Sbjct: 62  KLDKLTGGEN-HQGLVLAVASFEYADFDQLLDKLDQEEAPFLLMLDNIEDPHNLGSILRS 120

Query: 154 AVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLS 213
           A A    G+I  KR +   ++V+AK+++GA++H+P  R++NL    Q +   G+   G +
Sbjct: 121 ADATGVSGVIIPKRRASGLTSVVAKTSTGAIDHVPVARVNNLVQTCQALKDRGYWIFGTA 180

Query: 214 SDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVAL 273
            +      +   N K  L++G EGKG+ P   +       + M G +++LN S A  V L
Sbjct: 181 MEGDD-YRKWNANGKTVLVIGNEGKGISPLLLKQMDQTLTIPMIGHVQSLNASVATGVLL 239

Query: 274 Y 274
           Y
Sbjct: 240 Y 240


>gi|241765241|ref|ZP_04763223.1| RNA methyltransferase, TrmH family, group 3 [Acidovorax delafieldii
           2AN]
 gi|241365073|gb|EER59958.1| RNA methyltransferase, TrmH family, group 3 [Acidovorax delafieldii
           2AN]
          Length = 248

 Score =  111 bits (277), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 79/238 (33%), Positives = 118/238 (49%), Gaps = 15/238 (6%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLL--ATKNALARLDWDANLPHPFPVKTVPPQT--IDKIV 105
            L+G H V   L    + I ++   AT+   AR+    +       + +   +  I K+ 
Sbjct: 6   VLFGFHAVGVRLKTAPQSIIEIYYEATRRD-ARMRQFLDRAREAGARLIEADSVRIAKLA 64

Query: 106 GKEAVHQGLALETAPLLSPT--------LDAVRNSQ-LLMVLDHVNDPHNIGAILRSAVA 156
           G    HQG+A    P+   T        L+A    Q LL+VLD V DPHN+GA LR A  
Sbjct: 65  GSHG-HQGVAARVEPVAQVTSLDELLENLEAAGIEQPLLLVLDGVTDPHNLGACLRVADG 123

Query: 157 FSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDS 216
                +I  K ++   +A +AK ASGA E +PY  ++NL   L ++       IG S D+
Sbjct: 124 AGAHAVIAPKDHAVGINATVAKVASGAAETMPYFMVTNLARTLGELKERNIWCIGTSDDA 183

Query: 217 KKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
            K + Q      +AL+LGAEG G+R  T++T   +  + M G +++LNVS A+ V LY
Sbjct: 184 PKTIYQVDLKGPVALVLGAEGDGMRQLTRKTCDELVSIPMKGAVESLNVSVASGVCLY 241


>gi|186476454|ref|YP_001857924.1| RNA methyltransferase [Burkholderia phymatum STM815]
 gi|184192913|gb|ACC70878.1| RNA methyltransferase, TrmH family, group 3 [Burkholderia phymatum
           STM815]
          Length = 247

 Score =  111 bits (277), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 60/169 (35%), Positives = 98/169 (57%), Gaps = 5/169 (2%)

Query: 111 HQGLALETA--PL---LSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITT 165
           HQG+       PL   L+  LD ++   LL+VLD + DPHN+GA LR A A     +I  
Sbjct: 69  HQGVVARAGDVPLAQNLAELLDGIQGPPLLLVLDGITDPHNLGACLRVADAAGAHAVIAP 128

Query: 166 KRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIK 225
           +  +   +A  AK ASGA + +PYI ++NL  AL+++   G   +G + ++   L +   
Sbjct: 129 RDRAVGLNATAAKVASGAADTVPYITVTNLARALRELKDAGIWVVGTAGEATASLYETKL 188

Query: 226 NDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
           +  +AL++GAEG+G+R  T++T   +  + M G +++LNVS A+ V L+
Sbjct: 189 DGPVALVMGAEGEGMRRLTRDTCDEVMQIPMAGSVESLNVSVASGVCLF 237


>gi|183602645|ref|ZP_02964009.1| tRNA/rRNA methyltransferase protein [Bifidobacterium animalis
           subsp. lactis HN019]
 gi|219684006|ref|YP_002470389.1| tRNA/rRNA methyltransferase [Bifidobacterium animalis subsp. lactis
           AD011]
 gi|241191611|ref|YP_002969005.1| tRNA/rRNA methyltransferase protein [Bifidobacterium animalis
           subsp. lactis Bl-04]
 gi|241197016|ref|YP_002970571.1| tRNA/rRNA methyltransferase protein [Bifidobacterium animalis
           subsp. lactis DSM 10140]
 gi|183218063|gb|EDT88710.1| tRNA/rRNA methyltransferase protein [Bifidobacterium animalis
           subsp. lactis HN019]
 gi|219621656|gb|ACL29813.1| tRNA/rRNA methyltransferase [Bifidobacterium animalis subsp. lactis
           AD011]
 gi|240250003|gb|ACS46943.1| tRNA/rRNA methyltransferase protein [Bifidobacterium animalis
           subsp. lactis Bl-04]
 gi|240251570|gb|ACS48509.1| tRNA/rRNA methyltransferase protein [Bifidobacterium animalis
           subsp. lactis DSM 10140]
 gi|289177745|gb|ADC84991.1| 23S rRNA Gm2251 methyltransferase [Bifidobacterium animalis subsp.
           lactis BB-12]
 gi|295794603|gb|ADG34138.1| tRNA/rRNA methyltransferase protein [Bifidobacterium animalis
           subsp. lactis V9]
          Length = 331

 Score =  111 bits (277), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 56/146 (38%), Positives = 89/146 (60%), Gaps = 1/146 (0%)

Query: 134 LLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRIS 193
           L + LD + DP N+GA++RSA AF  +G+I  +R S S +A   K ++GA  H+P  R+ 
Sbjct: 176 LFIALDGITDPQNLGAVIRSAAAFGVNGVILPERRSASVNAAAWKVSAGAAAHMPIARVV 235

Query: 194 NLTDALQKMHSWGFQTIGLSSDSKKPL-EQEIKNDKIALILGAEGKGLRPKTQETATSMA 252
           NLT A++ +   G+ +IGL     K + E   + D + ++LG+EGKGL   T+E   ++A
Sbjct: 236 NLTKAIEALKERGYYSIGLDGGGSKLVGETGFETDPLVVVLGSEGKGLSRLTREACDAIA 295

Query: 253 HLHMPGIIKALNVSNAAAVALYITQN 278
            + +   +++LN S AA +ALY T N
Sbjct: 296 SIPITSAVESLNASVAAGIALYATVN 321


>gi|300115389|ref|YP_003761964.1| TrmA family RNA methyltransferase [Nitrosococcus watsonii C-113]
 gi|299541326|gb|ADJ29643.1| RNA methyltransferase, TrmH family, group 3 [Nitrosococcus watsonii
           C-113]
          Length = 284

 Score =  111 bits (277), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 83/244 (34%), Positives = 124/244 (50%), Gaps = 22/244 (9%)

Query: 52  YGVHTVSAALNNPSRKIFQLLATK-------NALARLDWDANLPHPFPVKTVPPQTIDKI 104
           YG+H V AAL  P+ ++  L   +         LA+L +D  L    PVK    + +D++
Sbjct: 31  YGLHAVRAALEQPALQVMALWLDQTRMDQSLQKLAKLAFDRGL-KAQPVKR---EELDEL 86

Query: 105 VGKEAVHQGL--------ALETAPLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVA 156
           V   A HQG+        AL    LL+  LD +    LL++LD V DPHN+GA LR+A A
Sbjct: 87  V-PGARHQGVVARCSVQSALTEEGLLA-FLDQLGTPPLLLLLDGVQDPHNLGACLRTAEA 144

Query: 157 FSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIG-LSSD 215
               G++  K  +   +AV  K ASGA E +P +R++NL   ++ +   G   +G +   
Sbjct: 145 AGVHGVVVPKDRAAGLTAVARKVASGAAERVPLVRVTNLARVMRALRERGLWLVGAVVGG 204

Query: 216 SKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYI 275
           +   L +      + L+LGAE +GLR  TQE    +  + M G + +LNVS AA V L+ 
Sbjct: 205 THATLYETDLQGPLGLVLGAEDRGLRRLTQEHCDCLVQIPMQGAVGSLNVSVAAGVCLFE 264

Query: 276 TQNH 279
            Q  
Sbjct: 265 AQRQ 268


>gi|189424926|ref|YP_001952103.1| RNA methyltransferase, TrmH family, group 3 [Geobacter lovleyi SZ]
 gi|189421185|gb|ACD95583.1| RNA methyltransferase, TrmH family, group 3 [Geobacter lovleyi SZ]
          Length = 246

 Score =  111 bits (277), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 72/236 (30%), Positives = 123/236 (52%), Gaps = 14/236 (5%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLL----ATKNALARLDWDANLPHPFPVKTVPPQTIDKIV 105
            LYG++ V  AL   +RK F+L      T   +A+L   A       V+      ++++ 
Sbjct: 5   ILYGINPVREALRG-NRKAFELFVQTGGTDQRIAKLATLAE-EKGIAVRRRERADLERLA 62

Query: 106 GKEAVHQGLALETAPLLSPTL-DAVRNSQ------LLMVLDHVNDPHNIGAILRSAVAFS 158
           G    HQG+ L+ AP +   L D + N Q       L+VLD + DP N+GA++RSA    
Sbjct: 63  GNPH-HQGVVLKVAPFIYAELEDFLANHQESEGGMFLLVLDRIQDPQNLGALIRSAACAG 121

Query: 159 CDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKK 218
             G+I  K  +   + V+ K+++GA+E IP I+++NL   L+++   G    GL+ ++ K
Sbjct: 122 VQGVIIPKDRACGMTPVVEKASAGAVETIPVIQVTNLVQTLERLKQAGCWIFGLAGEANK 181

Query: 219 PLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
            + Q      +AL++G+EG+G+RP  ++    +  +   G I +LN S A  + L+
Sbjct: 182 DIYQADYRGNLALVVGSEGEGIRPLVRKHCDLLLAIPHYGGISSLNASVAGGIVLF 237


>gi|292489612|ref|YP_003532502.1| putative tRNA/rRNA methyltransferase [Erwinia amylovora CFBP1430]
 gi|292898167|ref|YP_003537536.1| 23S_rRNA (guanosine-2'-O-)-methyltransferase [Erwinia amylovora
           ATCC 49946]
 gi|291198015|emb|CBJ45118.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Erwinia amylovora
           ATCC 49946]
 gi|291555049|emb|CBA23125.1| putative tRNA/rRNA methyltransferase [Erwinia amylovora CFBP1430]
 gi|312173789|emb|CBX82043.1| putative tRNA/rRNA methyltransferase [Erwinia amylovora ATCC
           BAA-2158]
          Length = 245

 Score =  111 bits (277), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 74/234 (31%), Positives = 116/234 (49%), Gaps = 10/234 (4%)

Query: 50  FLYGVHTVSAALNN-PSR--KIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVG 106
            ++G+H V A L++ P R  ++F L    +   +    A       ++    Q +D    
Sbjct: 4   IVFGIHAVQALLDSCPQRFQEVFILKGRDDRRLQTLVKALEAQGIVIQVANKQMLDN-TS 62

Query: 107 KEAVHQGLALETAPLLS------PTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCD 160
           + AVHQG+     P         P L A   +  L++LD V DPHN+GA +RSA A    
Sbjct: 63  EGAVHQGIIARVKPGRQYQEGDLPDLLASLENPFLLILDGVTDPHNLGACMRSADAAGVH 122

Query: 161 GIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPL 220
            +I  K  S + +A   K ASGA EHIP IR++NL   ++ +       +G + ++   L
Sbjct: 123 AVIVPKDRSAALNATAKKVASGAAEHIPLIRVTNLARTMRVLQEANVWIVGTAGEADHTL 182

Query: 221 EQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
            Q      +AL++GAEG+G+R  T+E    +  + M G + +LNVS A  V L+
Sbjct: 183 HQSRMTGPMALVMGAEGEGMRRLTREHCDELISIPMAGSVSSLNVSVATGVCLF 236


>gi|124267007|ref|YP_001021011.1| putative tRNA/rRNA methyltransferase protein [Methylibium
           petroleiphilum PM1]
 gi|124259782|gb|ABM94776.1| putative tRNA/rRNA methyltransferase protein [Methylibium
           petroleiphilum PM1]
          Length = 247

 Score =  111 bits (277), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 64/169 (37%), Positives = 93/169 (55%), Gaps = 5/169 (2%)

Query: 111 HQGLA--LETAPL---LSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITT 165
           HQG+   +  AP    L   LD V    LL+VLD V DPHN+GA LR A       +I  
Sbjct: 70  HQGVVAKVTAAPATKSLDDLLDTVEGPPLLLVLDGVTDPHNLGACLRVADGAGAHAVIAP 129

Query: 166 KRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIK 225
           K ++   +A +AK ASGA E +PY  ++NL   L ++       IG + D+ + L     
Sbjct: 130 KDHAVGINATVAKVASGAAETVPYFMVTNLARTLGELKERNIWVIGTADDAPRTLYAADL 189

Query: 226 NDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
              +AL+LGAEG+G+R  T++T   +  L M G +++LNVS A+ + LY
Sbjct: 190 RQAVALVLGAEGQGMRQLTRKTCDELVSLPMAGAVESLNVSVASGIGLY 238


>gi|264679078|ref|YP_003278985.1| RNA methyltransferase, TrmH family, group 3 [Comamonas testosteroni
           CNB-2]
 gi|299533339|ref|ZP_07046722.1| RNA methyltransferase [Comamonas testosteroni S44]
 gi|262209591|gb|ACY33689.1| RNA methyltransferase, TrmH family, group 3 [Comamonas testosteroni
           CNB-2]
 gi|298718655|gb|EFI59629.1| RNA methyltransferase [Comamonas testosteroni S44]
          Length = 256

 Score =  111 bits (277), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 59/141 (41%), Positives = 84/141 (59%)

Query: 134 LLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRIS 193
           LL+VLD V DPHN+GA LR A       +I  K ++   +A +AK ASGA E +PY  ++
Sbjct: 101 LLLVLDGVTDPHNLGACLRVADGAGVHAVIAPKDHAAGINATVAKVASGAAETVPYFMVT 160

Query: 194 NLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAH 253
           NL   L+++   G   IG S D+ K L Q       AL+LGAEG G+R  T++T  ++  
Sbjct: 161 NLARTLKELKERGIWIIGTSGDADKHLYQMDLTGPTALVLGAEGDGMRQLTRKTCDALVS 220

Query: 254 LHMPGIIKALNVSNAAAVALY 274
           + M G +++LNVS A+ V LY
Sbjct: 221 IPMQGAVESLNVSVASGVCLY 241


>gi|134094504|ref|YP_001099579.1| tRNA (guanosine-2'-O-)-methyltransferase [Herminiimonas
           arsenicoxydans]
 gi|133738407|emb|CAL61452.1| 23S rRNA (guanosine-2'-O-)-methyltransferase RlmB (23S rRNA Gm2251
           2'-O-methyltransferase) [Herminiimonas arsenicoxydans]
          Length = 247

 Score =  111 bits (277), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 67/176 (38%), Positives = 98/176 (55%), Gaps = 6/176 (3%)

Query: 104 IVGKEAVHQGLALETAPL-----LSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFS 158
           IVG    HQG+  +   L     L   LDA+    LL+VLD + DPHN+GA LR A    
Sbjct: 62  IVGTRR-HQGVVAKAGELSLARNLDELLDAIDGPPLLLVLDGITDPHNLGACLRVADGAG 120

Query: 159 CDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKK 218
              +I  K  +   +A  AK ASGA + +PYI ++NL   L+++       IG + DS+K
Sbjct: 121 AHAVIAPKDRAVGLNATAAKVASGAADTVPYITVTNLARTLRELKERDILLIGTTDDSEK 180

Query: 219 PLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
            L +   +   ALI+G+EG+G+R  T+ET   +  + M G +++LNVS A+ V LY
Sbjct: 181 GLYEADFSGPAALIMGSEGEGMRRLTRETCDVLVSIPMFGSVESLNVSVASGVCLY 236


>gi|225871259|ref|YP_002747206.1| SpoU rRNA methylase family protein [Streptococcus equi subsp. equi
           4047]
 gi|225700663|emb|CAW95241.1| SpoU rRNA methylase family protein [Streptococcus equi subsp. equi
           4047]
          Length = 248

 Score =  110 bits (276), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 62/172 (36%), Positives = 101/172 (58%), Gaps = 7/172 (4%)

Query: 109 AVHQGLALETAPLLSPTLDAV------RNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGI 162
           AVHQG AL  +      LD +       ++ LL++LD + DPHN G+ILR+A A    G+
Sbjct: 71  AVHQGFALRVSAFAYTELDELLELAQQEDNPLLLILDGLTDPHNFGSILRTADATGVCGV 130

Query: 163 ITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQ 222
           I  K  +   + V+AK+++GA+EH+P  R++NL+ AL ++ + GF   G +  +  P  +
Sbjct: 131 IIPKHRAVGVTPVVAKTSTGAVEHVPIARVTNLSQALDQLKANGFWVFG-TDVTGTPSYK 189

Query: 223 EIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
              + K+ALI+G EGKG+    ++    M  + M G +++LN S AAA+ +Y
Sbjct: 190 WNTSGKLALIIGNEGKGISANIKKQVDEMITIPMMGHVQSLNASVAAAILMY 241


>gi|109897320|ref|YP_660575.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Pseudoalteromonas
           atlantica T6c]
 gi|109699601|gb|ABG39521.1| 23S rRNA Gm-2251 2'-O-methyltransferase [Pseudoalteromonas
           atlantica T6c]
          Length = 246

 Score =  110 bits (276), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 75/237 (31%), Positives = 119/237 (50%), Gaps = 16/237 (6%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDAN--LPHP----FPVKTVPPQTIDK 103
           +LYG+H + A +     ++ +L   K    R D   N  + H       V+    +T+D 
Sbjct: 6   WLYGIHALEAVIEREPERLIELFVLK---GRDDKPINSIINHARKFGIAVQFCQRKTLDD 62

Query: 104 IVGKEAVHQGLALETAP---LLSPTLDAV---RNSQLLMVLDHVNDPHNIGAILRSAVAF 157
            V  E  HQG+  +  P        LD +     +  L++LD V DPHN+GA LR+A A 
Sbjct: 63  KVNGEQ-HQGVVAKAKPGKQFNENDLDEIIKKSATPFLLILDGVTDPHNLGACLRTADAA 121

Query: 158 SCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSK 217
             D I+  K  S + + V+ K A GA + IP I+++NL   L+++   G   +G + ++ 
Sbjct: 122 GIDAIVVPKDNSVALTPVVRKVACGAADLIPLIQVTNLARTLREIKDAGVWVVGTAGEAT 181

Query: 218 KPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
           + +        IAL++GAEGKG+R  T+E    +  L M G + +LNVS A  + LY
Sbjct: 182 QSIYDCKMQGPIALVMGAEGKGMRRLTREHCDELIKLPMAGSVSSLNVSVATGICLY 238


>gi|257067130|ref|YP_003153386.1| RNA methyltransferase, TrmH family, group 3 [Anaerococcus prevotii
           DSM 20548]
 gi|256799010|gb|ACV29665.1| RNA methyltransferase, TrmH family, group 3 [Anaerococcus prevotii
           DSM 20548]
          Length = 234

 Score =  110 bits (276), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 61/192 (31%), Positives = 110/192 (57%), Gaps = 5/192 (2%)

Query: 91  FPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDHVNDPHNIGAI 150
             +  V  +  DKI   +  HQG+ LE       +L+ + +S  L++LD + DPHN+GAI
Sbjct: 45  IEISFVDKRFFDKI---DMNHQGVMLEVESFKYSSLEDLSDSSRLIILDKIEDPHNLGAI 101

Query: 151 LRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTI 210
           +RSA +F  D +I  +R S S ++ + K+++GA+ +I  +R++NLT  ++ +   GF   
Sbjct: 102 IRSAESFGFDAVIIPERRSASVTSTVYKTSAGAINNIKVVRVTNLTRTIKDLKDKGFWIY 161

Query: 211 GLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAA 270
           GL+ ++   +       K+ L++G EG+G+    +E    + ++ M G + +LN S AAA
Sbjct: 162 GLAGEAHSDISHADLRGKVGLVVGNEGEGISRLVRENCDMLINIPMLGRVNSLNASVAAA 221

Query: 271 VALY--ITQNHF 280
           +++Y  + QN F
Sbjct: 222 ISMYELLRQNGF 233


>gi|329117061|ref|ZP_08245778.1| RNA methyltransferase, TrmH family, group 3 [Streptococcus
           parauberis NCFD 2020]
 gi|326907466|gb|EGE54380.1| RNA methyltransferase, TrmH family, group 3 [Streptococcus
           parauberis NCFD 2020]
          Length = 249

 Score =  110 bits (276), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 77/256 (30%), Positives = 126/256 (49%), Gaps = 35/256 (13%)

Query: 39  KSRHTSQPENLFLYGVHTVSAALN-NPSRKIF-------------QLLATKNALARLDWD 84
           K     +  N  +YGVH V  +L  N   K++             + LAT+  ++ + W 
Sbjct: 2   KDNQLIEENNDMVYGVHAVVESLTANTGNKLYIQDDLRGKNVDKIKALATEKKVS-ISW- 59

Query: 85  ANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAV------RNSQLLMVL 138
                  P K++   T        AVHQG  L  A      LD +       ++ L+++L
Sbjct: 60  ------TPKKSLSEMT------DGAVHQGFVLRVAEYAYAELDEIISKADAEDNPLILIL 107

Query: 139 DHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDA 198
           D + DPHN G+ILR+A A    G+I  K  +   + V+AK+++GA++H+P  R++NL+  
Sbjct: 108 DGITDPHNFGSILRTADATKVAGVIIPKHRAVGVTPVVAKTSTGAIQHMPIARVTNLSQT 167

Query: 199 LQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPG 258
           L K+   G+   G   D   P  +   + K+ALI+G+EGKG+    ++    M  + M G
Sbjct: 168 LDKLKEKGYWIFGTDMDG-TPSPKWNTSGKLALIIGSEGKGVSHNIKKQVDEMITIPMDG 226

Query: 259 IIKALNVSNAAAVALY 274
            +++LN   AAAV +Y
Sbjct: 227 HVQSLNAGVAAAVLMY 242


>gi|37523750|ref|NP_927127.1| tRNA/rRNA methyltransferase [Gloeobacter violaceus PCC 7421]
 gi|35214755|dbj|BAC92122.1| tRNA/rRNA methyltransferase [Gloeobacter violaceus PCC 7421]
          Length = 338

 Score =  110 bits (276), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 75/242 (30%), Positives = 126/242 (52%), Gaps = 20/242 (8%)

Query: 47  ENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLD------WDANLPHPFPVKTVPPQT 100
           E   LYG  +V AAL N SR + ++  T+    R D       DA       +  V P+ 
Sbjct: 89  EAELLYGKQSVLAALQN-SRPLNRVWLTEKL--RYDPRFLRLLDAAKAGGAVIDIVEPRR 145

Query: 101 IDKIVGKEAVHQGLALETAP--------LLSPTLDAVRNSQLLMVLDHVNDPHNIGAILR 152
           +D++      HQG+A + A         L++  ++  R   +L+  D + DPHN+GA++R
Sbjct: 146 LDQLTAG-GNHQGVAAQAAAHPYVEFEELIASLVE--RPDPVLLAADGIEDPHNLGALIR 202

Query: 153 SAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGL 212
           SA AF   GII  +R +   +A +AK A+GA+EH+P  R++NL  A++++   G+Q +G 
Sbjct: 203 SAEAFGFQGIILPQRRAVGVTATVAKVAAGAVEHLPIARVTNLNQAIERLKEAGYQVVGT 262

Query: 213 SSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVA 272
              + + L +   +  + +++G+EGKG+   TQ     M  + + G   +LN S A  + 
Sbjct: 263 QEKASQALYELKLDGPLVVVVGSEGKGISLLTQRHCDHMVSIPLAGKTTSLNASVAGGIM 322

Query: 273 LY 274
           LY
Sbjct: 323 LY 324


>gi|325697470|gb|EGD39356.1| RNA methyltransferase [Streptococcus sanguinis SK160]
          Length = 242

 Score =  110 bits (276), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 73/235 (31%), Positives = 119/235 (50%), Gaps = 9/235 (3%)

Query: 47  ENLFLYGVHTVSAALN-NPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIV 105
           +N  +YGVH V+ AL  N   K++     +        D        +   P +T+ ++ 
Sbjct: 3   KNDIVYGVHAVTEALAANTGNKLYIQDDLRGKKVDKIKDLAAEKKVSISWTPKKTLQEMT 62

Query: 106 GKEAVHQGLALETAPLLSPTLDAV------RNSQLLMVLDHVNDPHNIGAILRSAVAFSC 159
              AVHQG  L  A       + +       ++ LL++LD + DPHN+G+ILR+A A + 
Sbjct: 63  -DGAVHQGFVLRVAEFAYTDFEVLLKKAEQEDNPLLLILDGLTDPHNLGSILRTADATNV 121

Query: 160 DGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKP 219
            G+I  K  +   + V+AK+++GA+EHIP  R++NL+  L K+   GF   G       P
Sbjct: 122 AGVIIPKHRAVGVTPVVAKTSTGAIEHIPIARVTNLSQTLDKLKEAGFWIFGTDMQG-TP 180

Query: 220 LEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
             +     K+ALI+G E KG+    ++    M  + M G +++LN S AAA+ +Y
Sbjct: 181 SHKWNTAGKLALIIGNEAKGISSNIKKQVDEMISIPMNGHVQSLNASVAAAILMY 235


>gi|120555299|ref|YP_959650.1| RNA methyltransferase [Marinobacter aquaeolei VT8]
 gi|120325148|gb|ABM19463.1| 23S rRNA Gm-2251 2'-O-methyltransferase [Marinobacter aquaeolei
           VT8]
          Length = 245

 Score =  110 bits (276), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 77/235 (32%), Positives = 117/235 (49%), Gaps = 12/235 (5%)

Query: 50  FLYGVHTVSAAL-NNPSR--KIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVG 106
           +++G H V A L   P R  +++     ++   +   DA      P K V  + +D+ V 
Sbjct: 5   YVFGWHAVDAVLKREPERLQRVWIQTGRQDKRVKSVTDALDGLGVPWKVVHRKELDERV- 63

Query: 107 KEAVHQGLALETAPLLSPTLD-------AVRNSQLLMVLDHVNDPHNIGAILRSAVAFSC 159
              VHQG+    A     T D       A      L+VLD V DPHN+GA +R+A A   
Sbjct: 64  -SGVHQGVVAAVAESREWTEDDLLAQLAASDKPPFLLVLDGVTDPHNLGACMRTADAAGV 122

Query: 160 DGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKP 219
             +I  K  S S + V  K A GA E +P++R++NL   L+++   G   IG + ++   
Sbjct: 123 QAVIVPKDKSASLTPVARKVACGAAETVPFVRVTNLARFLRELKDQGVWLIGTAGEADAT 182

Query: 220 LEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
           L Q      +AL++GAEGKG+R  T+E    + ++ M G + +LNVS A  V LY
Sbjct: 183 LYQADFKGPVALVMGAEGKGMRRLTREHCDQLINIPMLGHVDSLNVSVATGVCLY 237


>gi|295396932|ref|ZP_06807055.1| RNA methyltransferase [Aerococcus viridans ATCC 11563]
 gi|294974825|gb|EFG50529.1| RNA methyltransferase [Aerococcus viridans ATCC 11563]
          Length = 271

 Score =  110 bits (276), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 80/266 (30%), Positives = 136/266 (51%), Gaps = 26/266 (9%)

Query: 28  RDYKKMQSFNQKSRHTSQPENL-----FLYGVHTVSAAL--NNPSRKIF--QLLATKNAL 78
           RD ++ Q+ +++ R T+  E L     F+YG H     L  ++   K+F    L  KNA 
Sbjct: 3   RDNQRQQNRDRRPRSTNNEEELDQSPDFVYGFHAAMEVLEGDHDVNKVFLQTGLNEKNAQ 62

Query: 79  ARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAV-------RN 131
           A L   A       V  VP + +D +      HQG+ +  A      L+ +         
Sbjct: 63  AILK--AANKRNILVSNVPKEKLDTL-SDGGNHQGVVMAIAAYKYAELEDIFKKAEEANE 119

Query: 132 SQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIR 191
             ++MVLD + DPHN+G+ILR+A A    G+I   R +   + V+AK+++GA+EH+P +R
Sbjct: 120 DPIIMVLDGIEDPHNLGSILRTADASGVHGVIIQNRRAVGLTQVVAKTSTGAIEHVPVVR 179

Query: 192 ISNLT---DALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETA 248
           ++N++   D L++   W F T  +   S   ++  +    IA+++G EGKG+ P  ++  
Sbjct: 180 VTNISKTIDLLKERGVWVFGT-DMKGQSMWQMDAAL---PIAVVIGNEGKGVSPGVKKHL 235

Query: 249 TSMAHLHMPGIIKALNVSNAAAVALY 274
             M  + M G +++LN S AA + +Y
Sbjct: 236 DGMITIPMRGHVQSLNASVAAGLLMY 261


>gi|330825418|ref|YP_004388721.1| TrmH family RNA methyltransferase [Alicycliphilus denitrificans
           K601]
 gi|329310790|gb|AEB85205.1| RNA methyltransferase, TrmH family, group 3 [Alicycliphilus
           denitrificans K601]
          Length = 248

 Score =  110 bits (276), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 63/148 (42%), Positives = 86/148 (58%), Gaps = 1/148 (0%)

Query: 127 DAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEH 186
           D V N  LL+VLD V DPHN+GA LR A       +I  K ++   SA +AK ASGA E 
Sbjct: 95  DGVANP-LLLVLDGVTDPHNLGACLRVADGAGAHAVIAPKDHAVGISATVAKVASGAAET 153

Query: 187 IPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQE 246
           +PY  ++NL   L ++       IG S D+ K L Q      +AL+LGAEG G+R  T++
Sbjct: 154 MPYFMVTNLARTLGELKERNIWVIGTSGDADKTLYQVDLKGPVALVLGAEGPGMRQLTRK 213

Query: 247 TATSMAHLHMPGIIKALNVSNAAAVALY 274
           T   +  + M G +++LNVS A+AV LY
Sbjct: 214 TCDELVSIPMKGAVESLNVSVASAVCLY 241


>gi|170723830|ref|YP_001751518.1| RNA methyltransferase [Pseudomonas putida W619]
 gi|169761833|gb|ACA75149.1| RNA methyltransferase, TrmH family, group 3 [Pseudomonas putida
           W619]
          Length = 248

 Score =  110 bits (276), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 73/232 (31%), Positives = 120/232 (51%), Gaps = 8/232 (3%)

Query: 51  LYGVHTVSAALNNPSRKIFQL-LATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEA 109
           +YGVH V A L +  +++ Q+ L+   +  R+     L     V+    +  +     E 
Sbjct: 7   IYGVHAVQALLQHHPKRVKQIWLSEGRSEPRIQALLALAAENRVQVGQAERRELDAWVEG 66

Query: 110 VHQGLALETAP-------LLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGI 162
           VHQG+  E +P       +L   L+      L++VLD V DPHN+GA LR+A A     +
Sbjct: 67  VHQGVVAEVSPSQVWGELMLEELLERTETPPLILVLDGVTDPHNLGACLRTADAAGATAV 126

Query: 163 ITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQ 222
           +  K  S + + V+ K A GA E IP + ++NL   L+K+   G   +G + ++++ + Q
Sbjct: 127 VVPKDKSATLTPVVRKVACGAAEVIPLVAVTNLARTLEKLQQRGLWVVGTAGEAEQEIYQ 186

Query: 223 EIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
           +     + +I+GAEGKG+R  T+E    +  L M G + +LNVS A  V L+
Sbjct: 187 QDLTGPLVMIMGAEGKGMRRLTREHCDFLVKLPMSGSVSSLNVSVATGVCLF 238


>gi|300311188|ref|YP_003775280.1| tRNA/rRNA methyltransferase [Herbaspirillum seropedicae SmR1]
 gi|300073973|gb|ADJ63372.1| tRNA/rRNA methyltransferase protein [Herbaspirillum seropedicae
           SmR1]
          Length = 245

 Score =  110 bits (276), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 63/169 (37%), Positives = 95/169 (56%), Gaps = 5/169 (2%)

Query: 111 HQGL-----ALETAPLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITT 165
           HQG+     AL  A  L   LDAV    LL++LD + DPHN+GA LR A       +I  
Sbjct: 68  HQGVVAKAAALSLARTLDELLDAVVGPPLLLILDGITDPHNLGACLRVADGAGAHAVIAP 127

Query: 166 KRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIK 225
           K  +   +A   K +SGA + +PYI ++NL   ++ +   G   IG S D++K L +   
Sbjct: 128 KDRAVGLNATAMKVSSGASDTVPYITVTNLARTMRDLKERGVWIIGTSDDAEKGLYEGDF 187

Query: 226 NDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
               AL++G+EG+G+R  T+ET   + ++ M G +++LNVS A+ V LY
Sbjct: 188 TGPTALVMGSEGEGMRRLTRETCDVLVNIPMFGSVESLNVSVASGVCLY 236


>gi|257465576|ref|ZP_05629947.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Actinobacillus minor
           202]
 gi|257451236|gb|EEV25279.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Actinobacillus minor
           202]
          Length = 246

 Score =  110 bits (275), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 79/245 (32%), Positives = 121/245 (49%), Gaps = 33/245 (13%)

Query: 51  LYGVHTVSAALNNPSRKIFQLLATK-----------NALARLDWDANLPHPFPVKTVPPQ 99
           +YG+H V A L+N   ++ ++   K           N L RL           ++ V  Q
Sbjct: 5   IYGIHAVKAFLDNAPERLIEVFVLKGREDKRLIPLLNELQRLG--------IAIQQVNRQ 56

Query: 100 TIDKIVGKEAVHQGLALETAP---LLSPTLDAVRNSQ---LLMVLDHVNDPHNIGAILRS 153
           T+D     E VHQG+  +  P   L    LD +  S+   LL++LD V DPHN+GA LR+
Sbjct: 57  TLDNKSQGE-VHQGIIAKVVPQKELNEHDLDRILASKSQPLLLILDGVTDPHNLGACLRT 115

Query: 154 AVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDA---LQKMHS-WGFQT 209
           A A   D +I  K  S   ++   K A GA E +P IR++NL      LQ+ H+ W    
Sbjct: 116 ADATGVDAVIVPKDKSAQLTSTARKVACGAAETVPLIRVTNLARTMRELQEQHNVW---I 172

Query: 210 IGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAA 269
           +G + ++   + +      IAL++GAEG G+R  T+E    +  + M G + +LNVS A 
Sbjct: 173 VGTAGEATSSIYEAKLTGAIALVMGAEGDGMRRLTREHCDQLISIPMAGSVSSLNVSVAT 232

Query: 270 AVALY 274
            + L+
Sbjct: 233 GICLF 237


>gi|126696248|ref|YP_001091134.1| RNA methyltransferase TrmH, group 3 [Prochlorococcus marinus str.
           MIT 9301]
 gi|126543291|gb|ABO17533.1| RNA methyltransferase TrmH, group 3 [Prochlorococcus marinus str.
           MIT 9301]
          Length = 334

 Score =  110 bits (275), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 62/173 (35%), Positives = 99/173 (57%), Gaps = 7/173 (4%)

Query: 109 AVHQGLALE-----TAPLLSPTLDAVRN--SQLLMVLDHVNDPHNIGAILRSAVAFSCDG 161
           A HQG+AL+     T PL      +  N  + +++  D + DPHN+GAI+RSA AF C G
Sbjct: 157 ASHQGVALQLACSKTIPLEQLIYFSKHNCPNPIIVAFDGITDPHNVGAIIRSAEAFDCKG 216

Query: 162 IITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLE 221
           +I  +R S   +  +AK A+GALEH+   R+ NL  AL+++   GF  +GLS D +  + 
Sbjct: 217 VIIPQRRSAGLTGTVAKVAAGALEHLHVSRVVNLNRALEELKKNGFLVVGLSGDGQISIS 276

Query: 222 QEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
              +   + +++G+E KG+   TQ+    +  + + G   +LN S AAA++LY
Sbjct: 277 NFQEKAPLVVVVGSEDKGISLLTQKKCDYILSIPLKGKTSSLNASVAAAISLY 329


>gi|227510713|ref|ZP_03940762.1| TrmH family tRNA/rRNA methyltransferase [Lactobacillus brevis
           subsp. gravesensis ATCC 27305]
 gi|227189834|gb|EEI69901.1| TrmH family tRNA/rRNA methyltransferase [Lactobacillus brevis
           subsp. gravesensis ATCC 27305]
          Length = 255

 Score =  110 bits (275), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 76/246 (30%), Positives = 126/246 (51%), Gaps = 16/246 (6%)

Query: 41  RHTSQPENLFLYGVHTVSAAL--NNPSRKIFQLLATKNALARLDWDANLPHP--FPVKTV 96
           +H  + E  F+ G H V AAL  ++P  K+F     K     +     L       +  V
Sbjct: 2   KHDQENEE-FVMGRHPVVAALKSDSPINKLFIQTGIKKDENIISEILKLARKKRLVISEV 60

Query: 97  PPQTIDKI-VGKEAVHQGLALETAPLLSPTLDAV-------RNSQLLMVLDHVNDPHNIG 148
           P Q +D++ VG+   HQG+ L  A     T+D +             ++LD++ DPHN+G
Sbjct: 61  PKQKLDRLSVGQN--HQGVVLSVAAFEYATVDDLFVNAKKQETEPFFVILDNIEDPHNLG 118

Query: 149 AILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQ 208
           +I+R+A A    GII  K  +   +AV+AK+++GA+E +P  R++NL   ++++ S G  
Sbjct: 119 SIIRTADAAGVSGIIIPKHRAVGLTAVVAKTSAGAIERVPVARVTNLAATIKELKSRGMW 178

Query: 209 TIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNA 268
             G   +       + K   +A+I+G EGKG+ P  ++    M  + M G I++LN S A
Sbjct: 179 VFGTDIEGTDYRRWDAKG-SVAIIIGNEGKGISPLLKKQVDEMLTIPMVGDIQSLNASVA 237

Query: 269 AAVALY 274
           A+V +Y
Sbjct: 238 ASVLIY 243


>gi|188535077|ref|YP_001908874.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Erwinia tasmaniensis
           Et1/99]
 gi|188030119|emb|CAO98005.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Erwinia tasmaniensis
           Et1/99]
          Length = 245

 Score =  110 bits (275), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 74/234 (31%), Positives = 117/234 (50%), Gaps = 10/234 (4%)

Query: 50  FLYGVHTVSAALN-NPSR--KIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVG 106
            ++G+H V A L+ +P R  ++F L   ++   +    A       ++    Q +D    
Sbjct: 4   IVFGIHAVQALLDSDPQRFQEVFILKGREDRRLQTLVKALEAQGIVIQVANKQMLDN-TS 62

Query: 107 KEAVHQGLALETAPLLS------PTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCD 160
           + AVHQG+     P         P L    ++  L++LD V DPHN+GA +RSA A    
Sbjct: 63  EGAVHQGIIARVKPGRQYQEGDLPDLLNSLDNPFLLILDGVTDPHNLGACMRSADAAGVH 122

Query: 161 GIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPL 220
            II  K  S + +A   K ASGA EHIP IR++NL   ++ +       +G + ++   L
Sbjct: 123 AIIVPKDRSAALNATAKKVASGAAEHIPLIRVTNLARTMRVLQEANVWIVGTAGEADHTL 182

Query: 221 EQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
            Q      +AL++GAEG+G+R  T+E    +  + M G + +LNVS A  V L+
Sbjct: 183 YQSKMTGPMALVMGAEGEGMRRLTREHCDELISIPMAGSVSSLNVSVATGVCLF 236


>gi|152979716|ref|YP_001345345.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Actinobacillus
           succinogenes 130Z]
 gi|150841439|gb|ABR75410.1| RNA methyltransferase, TrmH family, group 3 [Actinobacillus
           succinogenes 130Z]
          Length = 245

 Score =  110 bits (275), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 79/234 (33%), Positives = 118/234 (50%), Gaps = 11/234 (4%)

Query: 51  LYGVHTVSAALNNPSRKIFQLLATKNAL-ARLDWDANLPH--PFPVKTVPPQTIDKIVGK 107
           +YG+H V + L      + ++ A K     RL    N  H     V+ +  QT+D     
Sbjct: 5   IYGIHAVKSFLERTPELVVEVYALKGRDDKRLQPLLNELHNLGISVQFLNRQTLDNKAHG 64

Query: 108 EAVHQGLALETAP---LLSPTLDAVRNSQ---LLMVLDHVNDPHNIGAILRSAVAFSCDG 161
           E VHQG+     P   L    LD + N +   LL+VLD V DPHN+GA LR+A A   D 
Sbjct: 65  E-VHQGIIARVQPAKELNESDLDNILNGKPNPLLLVLDGVTDPHNLGACLRTADAAGVDA 123

Query: 162 IITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKM-HSWGFQTIGLSSDSKKPL 220
           +I  K  S   +++  K A GA E +P IR++NL   L+ +  S     +G + ++ + L
Sbjct: 124 VIVPKDKSAQLTSIARKVACGAAEVLPLIRVTNLARTLRDIQQSHNIWVVGTAGEASETL 183

Query: 221 EQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
            Q      +AL++GAEG G+R  T+E    +  + M G + +LNVS A  V L+
Sbjct: 184 YQTELTGSLALVMGAEGDGMRRLTRECCDQLISIPMAGSVSSLNVSVATGVCLF 237


>gi|312865506|ref|ZP_07725733.1| RNA methyltransferase, TrmH family, group 3 [Streptococcus downei
           F0415]
 gi|311099024|gb|EFQ57241.1| RNA methyltransferase, TrmH family, group 3 [Streptococcus downei
           F0415]
          Length = 246

 Score =  110 bits (275), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 78/249 (31%), Positives = 127/249 (51%), Gaps = 23/249 (9%)

Query: 45  QPENLFLYGVH-TVSAALNNPSRKIF--QLLATKN-----ALARLDWDANLPHPFPVKTV 96
           Q  +  +YG+H TV A   N   K++    L  KN     ALA             +  +
Sbjct: 5   QEHDDIVYGLHATVEALEANTGNKLYIQDDLKGKNVDKIKALAA-------QKKVAISWI 57

Query: 97  PPQTIDKIVGKEAVHQGLALETAPLLSPTLDAV------RNSQLLMVLDHVNDPHNIGAI 150
           P +++ ++  + AVHQG  L  +      L A+       ++ L+++LD + DPHN+G+I
Sbjct: 58  PKKSLSEMT-QGAVHQGFVLRVSEFAYSDLAAILAQADQEDNPLILILDGLTDPHNLGSI 116

Query: 151 LRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTI 210
           LR+A A    GII  K  +   + V+AK+++GA+EH+P  R++NL+  L K+   G+   
Sbjct: 117 LRTADATGVAGIIIPKHRAVGVTPVVAKTSTGAVEHVPIARVTNLSQTLDKLKEAGYWIF 176

Query: 211 GLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAA 270
           G   D   P  +     K+ALI+G EG+G+    ++    M  + M G +++LN S AAA
Sbjct: 177 GTDMDG-TPSHKWNTAGKLALIIGNEGRGISANLKKQVDEMITIPMTGHVQSLNASVAAA 235

Query: 271 VALYITQNH 279
           V +Y    H
Sbjct: 236 VLMYEVFRH 244


>gi|313201452|ref|YP_004040110.1| TrmH family RNA methyltransferase [Methylovorus sp. MP688]
 gi|312440768|gb|ADQ84874.1| RNA methyltransferase, TrmH family, group 3 [Methylovorus sp.
           MP688]
          Length = 249

 Score =  110 bits (275), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 75/235 (31%), Positives = 117/235 (49%), Gaps = 10/235 (4%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLATKNAL-ARLDWDANLPHPFPVK--TVPPQTIDKIVG 106
            L+G H V + L      + ++L  K+ + AR+    NL     V+   V    +D + G
Sbjct: 6   ILFGFHAVLSRLRQHGASVQEILIDKDRVDARMKDLINLAEGASVRLMQVERSRLDGMAG 65

Query: 107 KEAVHQGLALETA--PLLSPTLDAVRNSQL-----LMVLDHVNDPHNIGAILRSAVAFSC 159
               HQG+       P+    +  +  S L      +VLD V DPHN+GA LR A A   
Sbjct: 66  ANGRHQGVIARVVDTPIPYKDIHDILESDLTEPPFFLVLDGVEDPHNLGACLRVADAMGV 125

Query: 160 DGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKP 219
             +I  K  +   +A + K A GA E IP+I ++NL   L+++   G   +G ++D+   
Sbjct: 126 HAVIAPKDRAAGLNATVRKVACGAAETIPFIAVTNLARTLRELQEAGVFVVGAAADAPGN 185

Query: 220 LEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
           L     +  +AL+LGAEG GLR  T ET  ++  + M G +++LNVS A+ + LY
Sbjct: 186 LFTTKLDGPLALVLGAEGAGLRRLTAETCDTLVSIPMFGSVESLNVSVASGICLY 240


>gi|269467951|gb|EEZ79686.1| rRNA methylase [uncultured SUP05 cluster bacterium]
          Length = 247

 Score =  110 bits (275), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 79/249 (31%), Positives = 127/249 (51%), Gaps = 29/249 (11%)

Query: 47  ENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANL------PHPFPVKTVPPQT 100
           ++LF+YG H + A L+   + I ++    N   R D   N        H   V+    Q 
Sbjct: 3   KSLFIYGFHGIQAQLDTNPQNILKVSTLDN---RQDKRLNTLIQQLDQHGIRVEKTSKQK 59

Query: 101 IDKIVGKEAVHQGLALETAPLLSPTL---DAVRNS-------QLLMVLDHVNDPHNIGAI 150
           ++K+ G    HQG+    A +L PTL   D + N         L+++LD + DP N+GA 
Sbjct: 60  LEKLSGSRT-HQGVV---AEVLLPTLPNHDELLNHVSKLNHPSLILILDSIQDPRNLGAC 115

Query: 151 LRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLT---DALQKMHSWGF 207
           LRSA A   D ++  K  S   +A++ K+++GAL  +    ++NL+    ALQK   W  
Sbjct: 116 LRSANAAGVDCVVINKDGSAPVNALVHKTSAGALNQLKVFSVTNLSRSIKALQKQDIW-- 173

Query: 208 QTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSN 267
             IGL   + +   Q   +  IA+++G EG GLR  T+++   +A + M G +++LNVS 
Sbjct: 174 -IIGLDGSTDQSFYQIDLSSSIAIVMGTEGSGLRRLTKQSCDQLAMIPMKGNVESLNVSV 232

Query: 268 AAAVALYIT 276
           A  +AL+ T
Sbjct: 233 ATGIALFET 241


>gi|118586220|ref|ZP_01543685.1| tRNA/rRNA methyltransferase [Oenococcus oeni ATCC BAA-1163]
 gi|118433349|gb|EAV40050.1| tRNA/rRNA methyltransferase [Oenococcus oeni ATCC BAA-1163]
          Length = 254

 Score =  110 bits (275), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 76/235 (32%), Positives = 124/235 (52%), Gaps = 15/235 (6%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLATK----NALARLDWDANLPHPFPVKTVPPQTIDKIV 105
            +YGVH     L N ++ I +L  +K    N   +    A   +   V+ V  Q +D++ 
Sbjct: 14  IVYGVHASMETLEN-NQTINKLYLSKSLAKNRAQQFRQTAE-QNKIVVQEVDNQRLDELT 71

Query: 106 GKEAVHQGLALETAPLLSPTLDAVRNS-----QLLMVLDHVNDPHNIGAILRSAVAFSCD 160
                HQG+AL  A      LD + N        L++LD + DPHN+G+ILR+A A   D
Sbjct: 72  -NHGNHQGIALSIAAYEYVPLDDILNGIKGHDPFLVILDEIEDPHNLGSILRTADATGVD 130

Query: 161 GIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPL 220
           GII  KR +   + V+AK+++GA+EH+P  R+ N+ + + K+    F   G  +D K   
Sbjct: 131 GIIIPKRRAVQLTQVVAKTSTGAIEHVPVARVVNINNTIDKLKKANFWIFG--TDMKGAD 188

Query: 221 EQEIKNDK-IALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
             +   D  +A+++G EGKG+  +T++    M  + M G +++LN S AAA+ +Y
Sbjct: 189 YTDWNADGPVAIVIGNEGKGISAQTKKKVDQMLTIPMIGHVQSLNASVAAALLIY 243


>gi|117617585|ref|YP_855245.1| RNA methyltransferase [Aeromonas hydrophila subsp. hydrophila ATCC
           7966]
 gi|117558992|gb|ABK35940.1| RNA methyltransferase, TrmH family, group 3 [Aeromonas hydrophila
           subsp. hydrophila ATCC 7966]
          Length = 249

 Score =  110 bits (274), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 78/244 (31%), Positives = 123/244 (50%), Gaps = 26/244 (10%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLATKNA--------LARLDWDANLPHPFPVKTVPPQTI 101
            +YG+H VSA L     +  ++ A K          LA LD          V++V  +T+
Sbjct: 5   LIYGIHAVSALLERTPERFIEVWALKGRDDDRLQPLLAELD-----ALGLKVQSVNRKTL 59

Query: 102 D-KIVGKEAVHQGLA--LETAPLLSP-----TLDAVRNSQ---LLMVLDHVNDPHNIGAI 150
           D K  G    HQG+   ++ AP L+       LD +   Q    L+VLD V DPHN+GA 
Sbjct: 60  DDKAEGNN--HQGIMARVKEAPKLAEHDLASLLDKLAEQQTQPFLLVLDGVTDPHNLGAC 117

Query: 151 LRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTI 210
           LRSA A     +I  +  +   + ++ K A GA E +P I+++NL  +L+++   G   +
Sbjct: 118 LRSADAAGVHAVIVPRDKATGLTPIVRKVACGAAEVVPLIQVTNLARSLRELQERGVWIV 177

Query: 211 GLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAA 270
           G + ++   + Q      +AL++GAEGKG+R  T+E    +  + M G + +LNVS A  
Sbjct: 178 GTAGEADHDVYQAKLTGPMALVMGAEGKGMRRLTREHCDELVSIPMAGAVSSLNVSVATG 237

Query: 271 VALY 274
           V L+
Sbjct: 238 VCLF 241


>gi|312138101|ref|YP_004005437.1| tRNA/rRNA methyltransferase [Rhodococcus equi 103S]
 gi|311887440|emb|CBH46752.1| putative tRNA/rRNA methyltransferase [Rhodococcus equi 103S]
          Length = 322

 Score =  110 bits (274), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 64/185 (34%), Positives = 102/185 (55%), Gaps = 8/185 (4%)

Query: 96  VPPQTIDKIVGKEAVHQGLALETAPLL----SPTLDAVRNSQ---LLMVLDHVNDPHNIG 148
           VP   +D++     +HQG+AL+  P         L A R+ Q   LL+ LD++ DP N+G
Sbjct: 130 VPRTDLDRM-SANGMHQGIALQVPPYRYAHPDDLLTAARSRQEPALLVALDNITDPRNLG 188

Query: 149 AILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQ 208
           A++RS  AF   G++  +R S S +AV  ++++GA   +P  R +NLT  L+   S G Q
Sbjct: 189 AVVRSVAAFGGHGVVIPQRRSASVTAVAWRTSAGAAARLPVARATNLTRTLKDWQSKGVQ 248

Query: 209 TIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNA 268
            +GL +     L+       + +++G+EGKGL    +ET  S+  + M G +++LN S A
Sbjct: 249 VVGLDAGGDTSLDNYEGTGPVVIVVGSEGKGLSRLVRETCDSILSIPMAGEVESLNASVA 308

Query: 269 AAVAL 273
           A V L
Sbjct: 309 AGVVL 313


>gi|238918378|ref|YP_002931892.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Edwardsiella ictaluri
           93-146]
 gi|238867946|gb|ACR67657.1| conserved hypothetical protein [Edwardsiella ictaluri 93-146]
          Length = 247

 Score =  110 bits (274), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 71/235 (30%), Positives = 113/235 (48%), Gaps = 11/235 (4%)

Query: 50  FLYGVHTVSAALN-NPSR--KIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVG 106
            +YG+H V A L  +P R   +F +   ++                V+    Q +D+ V 
Sbjct: 4   IIYGIHAVKALLEQDPQRFLDVFVMKGREDRRLLPLLQQLEECGIRVQVAQRQWLDEKV- 62

Query: 107 KEAVHQGLALETAPL-------LSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSC 159
           + AVHQG+     P        L   L  + +   L++LD V DPHN+GA LRSA A   
Sbjct: 63  EGAVHQGIVARVKPGRQYQENDLPDLLAGLEHPPFLLILDGVTDPHNLGACLRSADAAGV 122

Query: 160 DGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKP 219
           D +I  +  S   +A   K A GA E++P IR++NL   ++ +       +G + ++   
Sbjct: 123 DAVIVPRDRSAQLNATAKKVACGAAENVPLIRVTNLARTIRLLQQENIWIVGTAGEADHS 182

Query: 220 LEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
           L Q      +AL++GAEG G+R  T+E    +  + M G + +LNVS A  + L+
Sbjct: 183 LYQSRMTGAMALVMGAEGDGMRRLTREHCDELISIPMAGSVSSLNVSVATGICLF 237


>gi|325674995|ref|ZP_08154682.1| RNA methyltransferase [Rhodococcus equi ATCC 33707]
 gi|325554581|gb|EGD24256.1| RNA methyltransferase [Rhodococcus equi ATCC 33707]
          Length = 321

 Score =  110 bits (274), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 64/185 (34%), Positives = 102/185 (55%), Gaps = 8/185 (4%)

Query: 96  VPPQTIDKIVGKEAVHQGLALETAPLL----SPTLDAVRNSQ---LLMVLDHVNDPHNIG 148
           VP   +D++     +HQG+AL+  P         L A R+ Q   LL+ LD++ DP N+G
Sbjct: 129 VPRTDLDRM-SANGMHQGIALQVPPYRYAHPDDLLTAARSRQEPALLVALDNITDPRNLG 187

Query: 149 AILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQ 208
           A++RS  AF   G++  +R S S +AV  ++++GA   +P  R +NLT  L+   S G Q
Sbjct: 188 AVVRSVAAFGGHGVVIPQRRSASVTAVAWRTSAGAAARLPVARATNLTRTLKDWQSKGVQ 247

Query: 209 TIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNA 268
            +GL +     L+       + +++G+EGKGL    +ET  S+  + M G +++LN S A
Sbjct: 248 VVGLDAGGDTSLDNYEGTGPVVIVVGSEGKGLSRLVRETCDSILSIPMAGEVESLNASVA 307

Query: 269 AAVAL 273
           A V L
Sbjct: 308 AGVVL 312


>gi|222110801|ref|YP_002553065.1| TrmH family RNA methyltransferase [Acidovorax ebreus TPSY]
 gi|221730245|gb|ACM33065.1| RNA methyltransferase, TrmH family, group 3 [Acidovorax ebreus
           TPSY]
          Length = 248

 Score =  110 bits (274), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 68/174 (39%), Positives = 95/174 (54%), Gaps = 11/174 (6%)

Query: 111 HQGLALETAPL-----LSPTLD-----AVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCD 160
           HQG+A     +     L   LD      V+N  LL+VLD V DPHN+GA LR A      
Sbjct: 69  HQGVAARVEAVAQVRTLDELLDELEARGVKNP-LLLVLDGVTDPHNLGACLRVADGAGAH 127

Query: 161 GIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPL 220
            +I  K ++   +A +AK ASGA E +PY  ++NL   L ++       IG S D+ K L
Sbjct: 128 AVIAPKDHAVGINATVAKVASGAAETVPYFMVTNLARTLNELKERNIWVIGTSGDADKTL 187

Query: 221 EQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
            Q      +AL+LGAEG G+R  T++T   +  + M G +++LNVS A+AV LY
Sbjct: 188 YQVDLKGPVALVLGAEGPGMRQLTRKTCDELVGIPMQGAVESLNVSVASAVCLY 241


>gi|167855195|ref|ZP_02477965.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Haemophilus parasuis
           29755]
 gi|167853648|gb|EDS24892.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Haemophilus parasuis
           29755]
          Length = 244

 Score =  110 bits (274), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 73/241 (30%), Positives = 117/241 (48%), Gaps = 26/241 (10%)

Query: 51  LYGVHTVSAALNNPSRKIFQLLATK-----------NALARLDWDANLPHPFPVKTVPPQ 99
           +YG+H V + L+    ++ ++   K           N L RL           V+ V  Q
Sbjct: 5   IYGIHAVKSFLDVAPERLIEVFVLKGREDKRLTPLLNELQRLG--------IRVQQVNRQ 56

Query: 100 TIDKIVGKEAVHQGLA---LETAPLLSPTLDAVRNSQ---LLMVLDHVNDPHNIGAILRS 153
            +D     E VHQG+    ++   L    LD + + +    L++LD V DPHN+GA LR+
Sbjct: 57  ALDNKAQGE-VHQGIIAKIIQAKELNESDLDQILDRKANPFLLILDGVTDPHNLGACLRT 115

Query: 154 AVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLS 213
           A A   D +I  K  S   ++   K A GA E +P IR++NL   ++++       +G +
Sbjct: 116 ADAAGVDAVIVPKDKSAQLTSTARKVACGAAETVPLIRVTNLARTMRELQERNIWIVGTA 175

Query: 214 SDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVAL 273
            ++ + L Q      IAL++GAEG G+R  T+E    +  + M G + +LNVS A  V L
Sbjct: 176 GEATESLYQVKLTGSIALVMGAEGDGMRRLTREHCDQLVSIPMAGSVSSLNVSVATGVCL 235

Query: 274 Y 274
           +
Sbjct: 236 F 236


>gi|119502817|ref|ZP_01624902.1| RNA methyltransferase TrmH, group 3 [marine gamma proteobacterium
           HTCC2080]
 gi|119461163|gb|EAW42253.1| RNA methyltransferase TrmH, group 3 [marine gamma proteobacterium
           HTCC2080]
          Length = 247

 Score =  110 bits (274), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 74/250 (29%), Positives = 123/250 (49%), Gaps = 28/250 (11%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLATKN-------ALARLDWDANLPHPFPVKTVPPQTID 102
           ++YG H V A L    R I  L    N        L +L  D  +     V+ V    +D
Sbjct: 4   WVYGFHAVEALLRREPRAIATLWLETNRRDKRAQTLLQLAADQGVA----VERVSGAALD 59

Query: 103 KIVGKEAVHQGLALETAPLLSPTLDAV-----------RNSQLLMVLDHVNDPHNIGAIL 151
           ++      HQG+A++       T +A+           ++S LL++LD V DPHN+GA L
Sbjct: 60  EVAAGR--HQGIAVQVKS--GATTEAIDEAGLMVLLQRQDSPLLLILDGVTDPHNLGACL 115

Query: 152 RSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIG 211
           R+A A     ++  +  +   S V  K A GA + +P++R++NL   L ++ + G   IG
Sbjct: 116 RTADAAGVTAVVVPQDGAAGLSPVARKVACGAADTVPFVRVTNLARTLGQLKAAGVWLIG 175

Query: 212 LSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAV 271
            S  + + L ++  +  +A+++GAEG G+R  T+E    +  L M G + +LNVS A  +
Sbjct: 176 TSDKASRTLFEQDFSGPVAIVMGAEGAGMRRLTEENCDFLVSLPMQGAVSSLNVSVATGI 235

Query: 272 ALY--ITQNH 279
            L+  + Q H
Sbjct: 236 CLFEAVRQRH 245


>gi|221066327|ref|ZP_03542432.1| RNA methyltransferase, TrmH family, group 3 [Comamonas testosteroni
           KF-1]
 gi|220711350|gb|EED66718.1| RNA methyltransferase, TrmH family, group 3 [Comamonas testosteroni
           KF-1]
          Length = 256

 Score =  110 bits (274), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 58/141 (41%), Positives = 84/141 (59%)

Query: 134 LLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRIS 193
           LL+VLD V DPHN+GA LR A       +I  K ++   +A +AK ASGA E +PY  ++
Sbjct: 101 LLLVLDGVTDPHNLGACLRVADGAGVHAVIAPKDHAAGINATVAKVASGAAETVPYFMVT 160

Query: 194 NLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAH 253
           NL   L+++   G   IG S D+ + L Q       AL+LGAEG G+R  T++T  ++  
Sbjct: 161 NLARTLKELKERGIWIIGTSGDADRHLYQMDLTGPTALVLGAEGDGMRQLTRKTCDALVS 220

Query: 254 LHMPGIIKALNVSNAAAVALY 274
           + M G +++LNVS A+ V LY
Sbjct: 221 IPMQGAVESLNVSVASGVCLY 241


>gi|121610346|ref|YP_998153.1| RNA methyltransferase [Verminephrobacter eiseniae EF01-2]
 gi|121554986|gb|ABM59135.1| RNA methyltransferase, TrmH family, group 3 [Verminephrobacter
           eiseniae EF01-2]
          Length = 248

 Score =  110 bits (274), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 67/183 (36%), Positives = 95/183 (51%), Gaps = 10/183 (5%)

Query: 101 IDKIVGKEAVHQGLALETAP---------LLSPTLDAVRNSQLLMVLDHVNDPHNIGAIL 151
           I K+ G    HQG+A    P         LL     A     LL+VLD V DPHN+GA L
Sbjct: 60  IAKLAGSHG-HQGVAARVQPVAPISSLDELLEKLQAAGSGPPLLLVLDGVTDPHNLGACL 118

Query: 152 RSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIG 211
           R A       +I  K ++   +A +AK ASGA E +PY  ++NL   L ++       IG
Sbjct: 119 RVADGAGAHAVIAPKDHAVGINATVAKVASGAAETMPYFMVTNLARTLDELKERSIWCIG 178

Query: 212 LSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAV 271
              D+   L Q      +AL+LGAEG G+R +T++T   +A + M G +++LNVS A+ +
Sbjct: 179 TCDDAPGTLYQLDLKGPVALVLGAEGSGMRQRTRKTCDELARIPMQGAVESLNVSVASGI 238

Query: 272 ALY 274
            LY
Sbjct: 239 CLY 241


>gi|121594611|ref|YP_986507.1| RNA methyltransferase [Acidovorax sp. JS42]
 gi|120606691|gb|ABM42431.1| 23S rRNA Gm-2251 2'-O-methyltransferase [Acidovorax sp. JS42]
          Length = 248

 Score =  110 bits (274), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 68/174 (39%), Positives = 95/174 (54%), Gaps = 11/174 (6%)

Query: 111 HQGLALETAPL-----LSPTLD-----AVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCD 160
           HQG+A     +     L   LD      V+N  LL+VLD V DPHN+GA LR A      
Sbjct: 69  HQGVAARVEAVAQVRTLDELLDELEARGVKNP-LLLVLDGVTDPHNLGACLRVADGAGAH 127

Query: 161 GIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPL 220
            +I  K ++   +A +AK ASGA E +PY  ++NL   L ++       IG S D+ K L
Sbjct: 128 AVIAPKDHAVGINATVAKVASGAAETVPYFMVTNLARTLNELKERNIWVIGTSGDADKTL 187

Query: 221 EQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
            Q      +AL+LGAEG G+R  T++T   +  + M G +++LNVS A+AV LY
Sbjct: 188 YQVDLKGPVALVLGAEGPGMRQLTRKTCDELVGIPMQGAVESLNVSVASAVCLY 241


>gi|311070743|ref|YP_003975666.1| 23S rRNA methyltransferase [Bacillus atrophaeus 1942]
 gi|310871260|gb|ADP34735.1| 23S rRNA methyltransferase [Bacillus atrophaeus 1942]
          Length = 249

 Score =  110 bits (274), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 59/189 (31%), Positives = 106/189 (56%), Gaps = 9/189 (4%)

Query: 93  VKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAV------RNSQ-LLMVLDHVNDPH 145
           ++ VP + +D++V  +  HQG+  + A      LD +      +N Q   +VLD + DPH
Sbjct: 52  IQYVPRKKLDQMVSGQ--HQGIVAQVAAYEYAELDDLYKRAEEKNEQPFFLVLDELEDPH 109

Query: 146 NIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSW 205
           N+G+I+R+A A    GI+  KR +   +  +AK+++GA+EHIP ++++NL   L++M   
Sbjct: 110 NLGSIMRTADAVGAHGIVIPKRRAVGLTTTVAKASTGAIEHIPVVKVTNLARTLEEMKER 169

Query: 206 GFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNV 265
           G   +G  + +++          +AL++G+EGKG+    +E    +  L M G + +LN 
Sbjct: 170 GIWVVGTDASAREDYRTMDGTMPLALVIGSEGKGMGRLVKEKCDFLIKLPMAGKVTSLNA 229

Query: 266 SNAAAVALY 274
           S AA + +Y
Sbjct: 230 SVAAGLLMY 238


>gi|256824258|ref|YP_003148218.1| rRNA methylase, , group 3 [Kytococcus sedentarius DSM 20547]
 gi|256687651|gb|ACV05453.1| rRNA methylase, putative, group 3 [Kytococcus sedentarius DSM
           20547]
          Length = 323

 Score =  110 bits (274), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 65/180 (36%), Positives = 100/180 (55%), Gaps = 7/180 (3%)

Query: 101 IDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQ-----LLMVLDHVNDPHNIGAILRSAV 155
           +D++   E VHQGL L+  P     LD + ++      L + LD + DP N+GAI+RSA 
Sbjct: 134 LDRLSNGE-VHQGLVLQVPPYTYGDLDTLLDATADVTPLFVALDGITDPRNLGAIIRSAA 192

Query: 156 AFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSD 215
           AF   GII T+R S   +A   ++++GA   +P  R++NL  ALQ++ S G   IGL +D
Sbjct: 193 AFGAHGIIITERRSAGVTAAAWRTSAGAAARLPVARVTNLNRALQELRSQGIFVIGLDAD 252

Query: 216 SKKPLEQ-EIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
               L    +  D + +++G+EGKG+   T+E    +  + M    ++LN   AAAV LY
Sbjct: 253 GDVELPGLPLAPDPLVVVVGSEGKGISRLTREHCDQIVSIPMTAGNESLNAGTAAAVTLY 312


>gi|315037582|ref|YP_004031150.1| tRNA-rRNA methyltransferase [Lactobacillus amylovorus GRL 1112]
 gi|325956064|ref|YP_004286674.1| tRNA-rRNA methyltransferase [Lactobacillus acidophilus 30SC]
 gi|312275715|gb|ADQ58355.1| tRNA-rRNA methyltransferase [Lactobacillus amylovorus GRL 1112]
 gi|325332629|gb|ADZ06537.1| tRNA-rRNA methyltransferase [Lactobacillus acidophilus 30SC]
 gi|327182878|gb|AEA31325.1| tRNA-rRNA methyltransferase [Lactobacillus amylovorus GRL 1118]
          Length = 250

 Score =  110 bits (274), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 68/192 (35%), Positives = 106/192 (55%), Gaps = 15/192 (7%)

Query: 93  VKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRN-------SQLLMVLDHVNDPH 145
           V+TVP   +D++V +   HQGL L  +      LD + +          L++LD + DPH
Sbjct: 54  VQTVPKNKLDRLV-EGGNHQGLVLAISSFEYANLDQLLDQFDQEGKEPFLLMLDSIEDPH 112

Query: 146 NIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNL---TDALQKM 202
           N+G+ILRSA A   DGII  KR++   ++V+AK+++GA++++P  R++NL   T  L+K 
Sbjct: 113 NLGSILRSADATGVDGIIIPKRHATGLTSVVAKTSTGAIDYVPVARVNNLVQTTKELKKR 172

Query: 203 HSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKA 262
             W F T     D +    +   N K  L++G EGKG+ P  ++       L M G +++
Sbjct: 173 GYWIFGTDMAGVDYR----EWNANGKTVLVIGNEGKGIAPLLKKQMDQTITLPMIGHVQS 228

Query: 263 LNVSNAAAVALY 274
           LN S A  V LY
Sbjct: 229 LNASVATGVLLY 240


>gi|254413736|ref|ZP_05027505.1| RNA methyltransferase, TrmH family, group 3 [Microcoleus
           chthonoplastes PCC 7420]
 gi|196179333|gb|EDX74328.1| RNA methyltransferase, TrmH family, group 3 [Microcoleus
           chthonoplastes PCC 7420]
          Length = 328

 Score =  110 bits (274), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 77/241 (31%), Positives = 124/241 (51%), Gaps = 19/241 (7%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKI----- 104
            LYG H V AAL N  R++ ++      L +L +D                ID++     
Sbjct: 70  LLYGRHPVLAALEN-QRQLNRVWI----LPQLRYDHRFHSLLLQAKANGTVIDEVDSRRL 124

Query: 105 --VGKEAVHQGLALETAPL----LSPTLDAVRNSQ---LLMVLDHVNDPHNIGAILRSAV 155
             V + A HQG+A + AP     L   + A +++    +++V D + DPHN+GAI+R+A 
Sbjct: 125 SQVTQGANHQGVAAQVAPYSYKELGDLIKAAKSTSQYPVIVVCDGITDPHNLGAIIRTAE 184

Query: 156 AFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSD 215
           A    G++  +R +   ++ + K A+GALE +P  R+ NL+ AL+++ + GF   G  +D
Sbjct: 185 ALGAQGLVIPQRRAVGVTSTVMKVAAGALETLPIARVVNLSRALEELKTAGFWIYGTCAD 244

Query: 216 SKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYI 275
           + K L     N  I L++G+EG GL   TQ     +  + + G   +LN S AAA+ LY 
Sbjct: 245 AGKLLHTVDLNGSIVLVIGSEGSGLSLLTQRCCDVLVSIPLYGKTPSLNASVAAAMTLYE 304

Query: 276 T 276
           T
Sbjct: 305 T 305


>gi|282899513|ref|ZP_06307477.1| RNA methyltransferase TrmH, group 3 [Cylindrospermopsis raciborskii
           CS-505]
 gi|281195392|gb|EFA70325.1| RNA methyltransferase TrmH, group 3 [Cylindrospermopsis raciborskii
           CS-505]
          Length = 320

 Score =  110 bits (274), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 80/270 (29%), Positives = 133/270 (49%), Gaps = 29/270 (10%)

Query: 28  RDYKKMQSFNQKSRHTSQP---------ENLFLYGVHTVSAALNNPSRKIFQLLATKNAL 78
           R +KK +    K R   QP         +N  +YG H V +AL +  R + +L  T    
Sbjct: 33  RTHKKAEVIPPKPRLLDQPVQTKNSEEQDNDLIYGRHPVLSALES-HRNLNRLWIT---- 87

Query: 79  ARLDWDANLPHPF--------PVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTL-DAV 129
           +RL +D    H           +  V P+ +D+I      HQG+A + AP     L D +
Sbjct: 88  SRLRYDPRFHHLVLQAKDNGTVIDEVDPKRLDQITNG-GNHQGVAAQIAPYTYTELEDLI 146

Query: 130 RNSQ-----LLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGAL 184
             +Q     +++V D + DPHN+GAI+R+A A    G++  +R +   ++ + K A+GAL
Sbjct: 147 SQAQTVSEPVIVVADGITDPHNLGAIIRTAEAIGAQGLVIPQRRAVGITSTVVKVAAGAL 206

Query: 185 EHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKT 244
           E+    R+ NL+ AL+++   GF   G ++   +PL          L++G+EG+GL   T
Sbjct: 207 ENFSVARVVNLSRALEQLKESGFWIYGTAATGSEPLHSVRFTGSTVLVVGSEGEGLSMLT 266

Query: 245 QETATSMAHLHMPGIIKALNVSNAAAVALY 274
           Q++   +  + + G   +LN S A  +ALY
Sbjct: 267 QKSCDVLVSIPLQGKTPSLNASVATGMALY 296


>gi|269137719|ref|YP_003294419.1| 23S rRNA (guanosine-2-O-)-methyltransferase [Edwardsiella tarda
           EIB202]
 gi|267983379|gb|ACY83208.1| 23S rRNA (guanosine-2-O-)-methyltransferase [Edwardsiella tarda
           EIB202]
 gi|304557775|gb|ADM40439.1| 23S rRNA (guanosine-2'-O-) -methyltransferase rlmB [Edwardsiella
           tarda FL6-60]
          Length = 247

 Score =  109 bits (273), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 71/235 (30%), Positives = 113/235 (48%), Gaps = 11/235 (4%)

Query: 50  FLYGVHTVSAALN-NPSR--KIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVG 106
            +YG+H V A L  +P R   +F +   ++                V+    Q +D+ V 
Sbjct: 4   IIYGIHAVKALLEQDPQRFLDVFVMKGREDRRLLPLLQQLEECGIRVQVAQRQWLDEKV- 62

Query: 107 KEAVHQGLALETAPL-------LSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSC 159
           + AVHQG+     P        L   L  + +   L++LD V DPHN+GA LRSA A   
Sbjct: 63  EGAVHQGIVARVKPGRQYQENDLPDLLAGLDHPPFLLILDGVTDPHNLGACLRSADAAGV 122

Query: 160 DGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKP 219
           D +I  +  S   +A   K A GA E++P IR++NL   ++ +       +G + ++   
Sbjct: 123 DAVIVPRDRSAQLNATAKKVACGAAENVPLIRVTNLARTMRLLQQESIWIVGTAGEADHS 182

Query: 220 LEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
           L Q      +AL++GAEG G+R  T+E    +  + M G + +LNVS A  + L+
Sbjct: 183 LYQSRMTGAMALVMGAEGDGMRRLTREHCDELISIPMAGSVSSLNVSVATGICLF 237


>gi|145589451|ref|YP_001156048.1| RNA methyltransferase [Polynucleobacter necessarius subsp.
           asymbioticus QLW-P1DMWA-1]
 gi|145047857|gb|ABP34484.1| 23S rRNA Gm-2251 2'-O-methyltransferase [Polynucleobacter
           necessarius subsp. asymbioticus QLW-P1DMWA-1]
          Length = 251

 Score =  109 bits (273), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 59/172 (34%), Positives = 98/172 (56%), Gaps = 8/172 (4%)

Query: 111 HQGLA-----LETAPLLSPTLDAVRNSQ---LLMVLDHVNDPHNIGAILRSAVAFSCDGI 162
           HQG+      +  A  ++  ++   ++Q   L +VLD V DPHN GA LR A     D +
Sbjct: 68  HQGVVALAEKITVARTITEVVEDAESAQKKPLFLVLDGVTDPHNFGACLRVADGAGVDAV 127

Query: 163 ITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQ 222
           +  K  S S +A ++K +SGA E IP I ++NL  ++++M   G   +G   +++K +  
Sbjct: 128 VIPKDRSASINATVSKVSSGASEVIPVITVTNLVRSMKEMQEAGVWLVGTDDEAEKSIYD 187

Query: 223 EIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
                 IA+++GAEG+G+R  T+ET   +  + M G++++LNVS A+ V LY
Sbjct: 188 LDLTGPIAIVMGAEGEGMRRLTRETCDELVRIPMQGVVESLNVSVASGVCLY 239


>gi|240948309|ref|ZP_04752695.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Actinobacillus minor
           NM305]
 gi|240297348|gb|EER47889.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Actinobacillus minor
           NM305]
          Length = 246

 Score =  109 bits (273), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 80/245 (32%), Positives = 120/245 (48%), Gaps = 33/245 (13%)

Query: 51  LYGVHTVSAALNNPSRKIFQLLATK-----------NALARLDWDANLPHPFPVKTVPPQ 99
           +YG+H V A L+N   ++ ++   K           N L RL           ++ V  Q
Sbjct: 5   IYGIHAVKAFLDNAPERLIEVFVLKGREDKRLIPLLNELQRLG--------IAIQQVNRQ 56

Query: 100 TIDKIVGKEAVHQGLALETAP---LLSPTLDAVRNSQ---LLMVLDHVNDPHNIGAILRS 153
           T+D     E VHQG+  +  P   L    LD +  S+   LL++LD V DPHN+GA LR+
Sbjct: 57  TLDNKSQGE-VHQGIIAKVVPQKELNEHDLDRILASKPQPLLLILDGVTDPHNLGACLRT 115

Query: 154 AVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDA---LQKMHS-WGFQT 209
           A A   D +I  K  S   ++   K A GA E +P IR++NL      LQ+ H+ W    
Sbjct: 116 ADAAGVDAVIVPKDKSAQLTSTARKVACGAAETVPLIRVTNLARTMRELQEQHNVW---I 172

Query: 210 IGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAA 269
           +G + ++   +        IAL++GAEG G+R  T+E    +  + M G + +LNVS A 
Sbjct: 173 VGTAGEATSSIYDAKLTGAIALVMGAEGDGMRRLTREHCDQLISIPMAGSVSSLNVSVAT 232

Query: 270 AVALY 274
            V L+
Sbjct: 233 GVCLF 237


>gi|148242427|ref|YP_001227584.1| tRNA/rRNA methyltransferase [Synechococcus sp. RCC307]
 gi|147850737|emb|CAK28231.1| Possible tRNA/rRNA methyltransferase [Synechococcus sp. RCC307]
          Length = 442

 Score =  109 bits (273), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 59/173 (34%), Positives = 100/173 (57%), Gaps = 7/173 (4%)

Query: 109 AVHQGLALETAPLLSPTLDAVRNS-------QLLMVLDHVNDPHNIGAILRSAVAFSCDG 161
           AVHQG+ L+TA   +  L+ + +S        LLM +D + DPHN+GAI+RSA A    G
Sbjct: 213 AVHQGIVLQTAAAQTHDLETLIDSCAGLGEAPLLMAVDGLTDPHNLGAIVRSAEALGAHG 272

Query: 162 IITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLE 221
           ++  +R S   +  +AK A+GALEH+P  R+ NL  +L+++   G++ +GL+ +    L 
Sbjct: 273 LVLPQRRSAGLTGSVAKVAAGALEHLPVARVVNLNRSLERLKDAGYRVVGLAEEGSATLA 332

Query: 222 QEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
           +   +  + ++ G+EG+GL   T+     +  + + G+  +LN S A A+ LY
Sbjct: 333 EADLDGPLVVVTGSEGQGLSMLTRRHCDQLVRIPLRGVTPSLNASVATALLLY 385


>gi|225867831|ref|YP_002743779.1| SpoU rRNA methylase family protein [Streptococcus equi subsp.
           zooepidemicus]
 gi|225701107|emb|CAW97954.1| SpoU rRNA methylase family protein [Streptococcus equi subsp.
           zooepidemicus]
          Length = 248

 Score =  109 bits (273), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 61/172 (35%), Positives = 100/172 (58%), Gaps = 7/172 (4%)

Query: 109 AVHQGLALETAPLLSPTLDAV------RNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGI 162
           AVHQG  L  +      LD +       ++ LL++LD + DPHN G+ILR+A A    G+
Sbjct: 71  AVHQGFVLRVSAFAYTELDELLELAQQEDNPLLLILDGLTDPHNFGSILRTADATGVCGV 130

Query: 163 ITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQ 222
           I  K  +   + V+AK+++GA+EH+P  R++NL+ AL ++ + GF   G +  +  P  +
Sbjct: 131 IIPKHRAVGVTPVVAKTSTGAVEHVPIARVTNLSQALDQLKANGFWVFG-TDVTGTPSYK 189

Query: 223 EIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
              + K+ALI+G EGKG+    ++    M  + M G +++LN S AAA+ +Y
Sbjct: 190 WNTSGKLALIIGNEGKGISANIKKQVDEMITIPMMGHVQSLNASVAAAILMY 241


>gi|319442437|ref|ZP_07991593.1| putative rRNA methylase [Corynebacterium variabile DSM 44702]
          Length = 318

 Score =  109 bits (273), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 63/200 (31%), Positives = 106/200 (53%), Gaps = 14/200 (7%)

Query: 91  FPVKTVPPQTIDKIVGKEAVHQGLALETAP--------LLSPTLDAVRNSQLLMVLDHVN 142
            PV  V    +D++ G   +HQG+ L+  P        L+    D+ R   L++VLD++ 
Sbjct: 118 IPVLEVARDEMDRMTGN-GMHQGIGLQVPPYKYAADDDLIERAKDSGRPG-LIVVLDNIT 175

Query: 143 DPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKM 202
           DP N+GA++RS  AF   G++  +R S S +AV  ++++G    +P  R +NL  +L+K 
Sbjct: 176 DPRNLGAVIRSVAAFGGHGVVIPERRSASVTAVTWRTSAGTAARLPVARATNLVRSLKKF 235

Query: 203 HSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKA 262
              G+Q +GL +     L+     D + +++G+EGKGL     ET   +  + M   +++
Sbjct: 236 QQSGYQVVGLDAGGSHTLDTYDGTDPVVVVVGSEGKGLSRLVGETCDDILSIPMTSTVES 295

Query: 263 LNVSNAAAVALYITQNHFAK 282
           LN S AA V L    + FA+
Sbjct: 296 LNASVAAGVVL----SEFAR 311


>gi|166365581|ref|YP_001657854.1| tRNA/rRNA methyltransferase [Microcystis aeruginosa NIES-843]
 gi|166087954|dbj|BAG02662.1| probable tRNA/rRNA methyltransferase [Microcystis aeruginosa
           NIES-843]
          Length = 288

 Score =  109 bits (273), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 61/181 (33%), Positives = 106/181 (58%), Gaps = 8/181 (4%)

Query: 101 IDKIVGKEAVHQGLALETAPL----LSPTLDAVRNSQ---LLMVLDHVNDPHNIGAILRS 153
           +D+I  K A HQG+A + +P     L+  ++  +      ++++ + + DPHN+GAI+R+
Sbjct: 97  LDQITSK-ANHQGIAAQMSPYEYIELADLIEKAKGKSRHPVIVIAEGITDPHNLGAIIRT 155

Query: 154 AVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLS 213
           A A  C G++  +R +   ++ + K A+GALE++P  R+ NL  AL+++ + GF   G +
Sbjct: 156 AEAMGCQGVVIPQRRAAGVTSTVMKVAAGALEYLPVARVVNLNRALEELKAAGFWLYGAA 215

Query: 214 SDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVAL 273
           + S K L        I L+LG+EG+GL   TQ++   +  + + G   +LN S AAA+AL
Sbjct: 216 AKSGKSLHTINLTGAIGLVLGSEGEGLSLLTQKSCDELVSIPLAGKTPSLNASVAAAMAL 275

Query: 274 Y 274
           Y
Sbjct: 276 Y 276


>gi|254362632|ref|ZP_04978721.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Mannheimia
           haemolytica PHL213]
 gi|153094246|gb|EDN75117.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Mannheimia
           haemolytica PHL213]
          Length = 247

 Score =  109 bits (273), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 80/245 (32%), Positives = 122/245 (49%), Gaps = 33/245 (13%)

Query: 51  LYGVHTVSAALNNPSRKIFQLLATK-----------NALARLDWDANLPHPFPVKTVPPQ 99
           +YG+H V A L+N   ++ ++L  K           N L RL           ++ V  Q
Sbjct: 5   IYGIHAVKAFLDNAPERLIEVLVLKGREDKRLMPLLNELQRLG--------VAIQQVNRQ 56

Query: 100 TIDKIVGKEAVHQGLALETAP---LLSPTLDAV---RNSQLLMVLDHVNDPHNIGAILRS 153
           T+D     E VHQG+     P   L    L+A+   + + LL++LD V DPHN+GA LR+
Sbjct: 57  TLDNKSQGE-VHQGIIARVVPQKELNEHDLEAILSQKKNPLLLILDGVTDPHNLGACLRT 115

Query: 154 AVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDA---LQKMHS-WGFQT 209
           A A   D +I  K  S   +    K A GA E +P IR++NL      LQ+ H+ W    
Sbjct: 116 ADAAGVDAVIVPKDKSAQLTPTARKVACGAAEVMPLIRVTNLARTMRDLQERHNVW---I 172

Query: 210 IGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAA 269
           +G + +++  + +      IAL++GAEG G+R  T+E    +  + M G + +LNVS A 
Sbjct: 173 VGTAGEAESGIYEAKLTGSIALVMGAEGDGMRRLTREHCDQLISIPMAGSVSSLNVSVAT 232

Query: 270 AVALY 274
            V L+
Sbjct: 233 GVCLF 237


>gi|27364705|ref|NP_760233.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Vibrio vulnificus
           CMCP6]
 gi|37681244|ref|NP_935853.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Vibrio vulnificus
           YJ016]
 gi|320155098|ref|YP_004187477.1| 23S rRNA (guanosine-2'-O-) -methyltransferase RlmB [Vibrio
           vulnificus MO6-24/O]
 gi|52783298|sp|Q7MH13|RLMB_VIBVY RecName: Full=23S rRNA (guanosine-2'-O-)-methyltransferase RlmB;
           AltName: Full=23S rRNA Gm2251 2'-O-methyltransferase
 gi|52783314|sp|Q8DCT8|RLMB_VIBVU RecName: Full=23S rRNA (guanosine-2'-O-)-methyltransferase RlmB;
           AltName: Full=23S rRNA Gm2251 2'-O-methyltransferase
 gi|27360850|gb|AAO09760.1| 23S rRNA (guanosine-2'-O-) -methyltransferase rlmB [Vibrio
           vulnificus CMCP6]
 gi|37199995|dbj|BAC95824.1| rRNA methylase [Vibrio vulnificus YJ016]
 gi|319930410|gb|ADV85274.1| 23S rRNA (guanosine-2'-O-) -methyltransferase RlmB [Vibrio
           vulnificus MO6-24/O]
          Length = 247

 Score =  109 bits (273), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 76/241 (31%), Positives = 120/241 (49%), Gaps = 20/241 (8%)

Query: 48  NLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLP--HPFPVKTVPPQTI---- 101
           N F+YG+H V A L+    +  +    K    R D D  +P  +   +  V  Q +    
Sbjct: 3   NEFIYGIHAVRAVLDKEPERFIEAYVLKG---RQD-DRLMPILNELQMVGVSLQQMTRKT 58

Query: 102 --DKIVGKEAVHQGLALETAP---LLSPTLDAV---RNSQLLMVLDHVNDPHNIGAILRS 153
             DK  G  A HQG+     P   L    LD +     S LL++LD V DPHN+GA LR+
Sbjct: 59  LDDKAHG--ANHQGIIARVKPAKQLNENDLDDILAKHASPLLLILDGVTDPHNLGACLRN 116

Query: 154 AVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLS 213
           A A     +I  K  S   +A ++K A GA E +P +R++NL   ++ +   G   +G +
Sbjct: 117 ADAAGVAAVIVPKDKSAPMTATVSKVACGAAETVPLVRVTNLARTMRHLQEQGIWIVGTA 176

Query: 214 SDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVAL 273
            ++   + Q      +A+++GAEG G+R  T+ET   +  + M G + +LNVS A+ + L
Sbjct: 177 GEATHDIYQAKLTGSLAIVMGAEGDGMRRLTRETCDDLIKIPMAGAVSSLNVSVASGICL 236

Query: 274 Y 274
           +
Sbjct: 237 F 237


>gi|116491407|ref|YP_810951.1| rRNA methylase [Oenococcus oeni PSU-1]
 gi|116092132|gb|ABJ57286.1| rRNA methylase [Oenococcus oeni PSU-1]
          Length = 233

 Score =  109 bits (273), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 65/188 (34%), Positives = 106/188 (56%), Gaps = 9/188 (4%)

Query: 93  VKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNS-----QLLMVLDHVNDPHNI 147
           V+ V  Q +D++      HQG+AL  A      LD + N        L++LD + DPHN+
Sbjct: 38  VQEVDNQRLDELT-NHGNHQGIALSIAAYEYVPLDDILNGIKDHDPFLVILDEIEDPHNL 96

Query: 148 GAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGF 207
           G+ILR+A A   DGII  KR +   + V+AK+++GA+EH+P  R+ N+ + + K+    F
Sbjct: 97  GSILRTADATGVDGIIIPKRRAVQLTQVVAKTSTGAIEHVPVARVVNVNNTIDKLKKANF 156

Query: 208 QTIGLSSDSKKPLEQEIKNDK-IALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVS 266
              G  +D K     +   D  +A+++G EGKG+  +T++    M  + M G +++LN S
Sbjct: 157 WIFG--TDMKGTDYTDWNADGPVAIVIGNEGKGISAQTKKKVDQMLTIPMIGHVQSLNAS 214

Query: 267 NAAAVALY 274
            AAA+ +Y
Sbjct: 215 VAAALLIY 222


>gi|149926252|ref|ZP_01914514.1| RNA methyltransferase TrmH, group 3 [Limnobacter sp. MED105]
 gi|149825070|gb|EDM84282.1| RNA methyltransferase TrmH, group 3 [Limnobacter sp. MED105]
          Length = 244

 Score =  109 bits (273), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 79/243 (32%), Positives = 118/243 (48%), Gaps = 11/243 (4%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLAT---KNALARLDWDANLPHPFPVKTVPPQTIDKIVG 106
            LYG H VSA +      + ++L     K+   +   D        V       ++K  G
Sbjct: 3   ILYGFHAVSARVKTAPASVEEVLVDQHRKDKRMQQFIDKVKAAGVKVSAADSDRLEKAAG 62

Query: 107 KEAVHQGLALETAPL-----LSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDG 161
            +  HQG+      L     L   +D    + LL+VLD V DPHN+GA LRSA A     
Sbjct: 63  HKQ-HQGVVAFAKELVKSNDLFEIIDTHGKNTLLLVLDGVTDPHNLGACLRSADAAGVHA 121

Query: 162 IITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLE 221
           ++  K  S   + V++K A GA E IP I ++NL   L+++   G   IG + ++   L 
Sbjct: 122 VVLPKDKSVGITPVVSKVACGAAETIPVITVTNLARTLEEIQDAGVWCIGTAGEATDTLY 181

Query: 222 QEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYIT--QNH 279
               N  IA +LGAEG G+R  T+E    +  + M G +++LNVS A++V L+ T  Q  
Sbjct: 182 DADLNGPIAWVLGAEGDGMRRLTREKCDQLVQIPMIGSVESLNVSVASSVCLFETLRQRQ 241

Query: 280 FAK 282
           F+K
Sbjct: 242 FSK 244


>gi|145297770|ref|YP_001140611.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Aeromonas salmonicida
           subsp. salmonicida A449]
 gi|142850542|gb|ABO88863.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Aeromonas salmonicida
           subsp. salmonicida A449]
          Length = 249

 Score =  109 bits (273), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 79/245 (32%), Positives = 125/245 (51%), Gaps = 28/245 (11%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPF---------PVKTVPPQT 100
            +YG+H VSA L     +  ++ A K        D +  HP           V++V  +T
Sbjct: 5   LIYGIHAVSALLERTPERFIEVWALKGR------DDDRLHPLLAEMESLGLKVQSVNRKT 58

Query: 101 ID-KIVGKEAVHQGL---ALETAPL----LSPTLD--AVRNSQ-LLMVLDHVNDPHNIGA 149
           +D K  G    HQG+    +E   L    L+  LD  A + +Q  L+VLD V DPHN+GA
Sbjct: 59  LDDKAEGNN--HQGIMAKVIEAPKLAEHDLASLLDNLAEQKAQPFLLVLDGVTDPHNLGA 116

Query: 150 ILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQT 209
            LRSA A     +I  +  +   ++V+ K A GA E +P I+++NL  +L+++   G   
Sbjct: 117 CLRSADAAGVHAVIVPRDKASGLTSVVRKVACGAAEVVPLIQVTNLARSLRELKDRGVWI 176

Query: 210 IGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAA 269
           +G + ++   + Q      +AL++GAEGKG+R  T+E    +  + M G + +LNVS A 
Sbjct: 177 VGTAGEADHDVYQAKLTGPMALVMGAEGKGMRRLTREHCDELVSIPMAGAVSSLNVSVAT 236

Query: 270 AVALY 274
            V L+
Sbjct: 237 GVCLF 241


>gi|330951485|gb|EGH51745.1| RNA methyltransferase TrmH, group 3 [Pseudomonas syringae Cit 7]
          Length = 234

 Score =  109 bits (273), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 76/243 (31%), Positives = 113/243 (46%), Gaps = 38/243 (15%)

Query: 51  LYGVHTVSAAL----------------NNPSRKIFQLLATKNALARLDWDANLPHPFPVK 94
           +YGVH V A L                N+P  +    LA +N +              + 
Sbjct: 7   IYGVHAVEALLRHHPKRVKHIWLAEGRNDPRVQTLVALAAENRVT-------------IG 53

Query: 95  TVPPQTIDKIVGKEAVHQGLALETAP-------LLSPTLDAVRNSQLLMVLDHVNDPHNI 147
               + +D  V  E VHQG+  + +P       +L   LD    S LL+VLD V DPHN+
Sbjct: 54  QAERREMDAWV--EGVHQGVVADVSPSQVWGEAMLDELLDRSEGSPLLLVLDGVTDPHNL 111

Query: 148 GAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGF 207
           GA LR+A A     +I  K  S + +  + K A GA E IP + ++NL   L+K+   G 
Sbjct: 112 GACLRTADAAGALAVIVPKDKSATLTPAVRKVACGAAEVIPLVAVTNLARTLEKLQQRGL 171

Query: 208 QTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSN 267
             +G + +++  L Q+       +I+GAEGKG+R  T+E    +  L M G + +LNVS 
Sbjct: 172 WVVGTAGEAEVELYQQDLTGPTIIIMGAEGKGMRRLTREHCDYLVGLPMAGSVSSLNVSG 231

Query: 268 AAA 270
            A 
Sbjct: 232 GAC 234


>gi|299541908|ref|ZP_07052231.1| trmH family tRNA/rRNA methyltransferase yacO [Lysinibacillus
           fusiformis ZC1]
 gi|298725646|gb|EFI66287.1| trmH family tRNA/rRNA methyltransferase yacO [Lysinibacillus
           fusiformis ZC1]
          Length = 250

 Score =  109 bits (273), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 64/189 (33%), Positives = 103/189 (54%), Gaps = 9/189 (4%)

Query: 93  VKTVPPQTIDKIVGKEAVHQGLALETAPL----LSPTLDAVRNSQ---LLMVLDHVNDPH 145
           V+ VP + +D++    A HQG+    A      L     A  N Q     ++LD + DPH
Sbjct: 53  VQFVPKKKVDQL--SSANHQGIVASVAAYKYAELEDLFAAAANKQEDPFFLILDELEDPH 110

Query: 146 NIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSW 205
           N+G+I+R+A A    GII  KR S S +AV+AK+++GA+EH+P +R++NL   + ++   
Sbjct: 111 NLGSIMRTADAIGAHGIIIPKRRSVSLTAVVAKASTGAIEHVPVVRVNNLAQTIDELKER 170

Query: 206 GFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNV 265
           G    G  +       +      +A+I+G+EGKG+    +E    + HL M G + +LN 
Sbjct: 171 GIWIAGTDAKGSADYRKMDATLPLAIIIGSEGKGMGRLLKEKCDFLYHLPMVGHVTSLNA 230

Query: 266 SNAAAVALY 274
           S AAA+ +Y
Sbjct: 231 SVAAALLMY 239


>gi|126665195|ref|ZP_01736178.1| RNA methyltransferase, TrmH family, group 3 [Marinobacter sp.
           ELB17]
 gi|126630565|gb|EBA01180.1| RNA methyltransferase, TrmH family, group 3 [Marinobacter sp.
           ELB17]
          Length = 266

 Score =  109 bits (272), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 73/235 (31%), Positives = 119/235 (50%), Gaps = 12/235 (5%)

Query: 50  FLYGVHTVSAALNNPSRKIFQL-LATKNALARLDWDANLPHPFPV--KTVPPQTIDKIVG 106
           F++G H V A L     ++ Q+ + T     R+     L     V  + V  + +D  V 
Sbjct: 24  FVFGWHAVEAVLKREPERLLQVWIQTGRQDKRVKSTTELLDTLGVSWEIVHRKLLDSRVA 83

Query: 107 KEAVHQGLALETAPLLSPTLD----AVRNSQ---LLMVLDHVNDPHNIGAILRSAVAFSC 159
              VHQG+    +     + D     + NS+    L++LD V DPHN+GA +R+A A   
Sbjct: 84  --GVHQGIVASVSESREWSEDDLLAMLANSEKPPFLLILDGVTDPHNLGACMRTADAVGV 141

Query: 160 DGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKP 219
             +I  K  S + + V  K A GA E +P++R++NL   L+ +   G   +G + ++   
Sbjct: 142 QAVIVPKDKSATLTPVARKVACGAAETVPFVRVTNLARLLRTLQEQGVWLVGTAGEASIT 201

Query: 220 LEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
           L Q      +AL++GAEGKG+R  T+E    + ++ M G +++LNVS A+ V LY
Sbjct: 202 LHQADLTGPLALVMGAEGKGMRRLTREHCDQLINIPMVGDVESLNVSVASGVCLY 256


>gi|153840466|ref|ZP_01993133.1| RNA methyltransferase, TrmH family, group 3 [Vibrio
           parahaemolyticus AQ3810]
 gi|149745870|gb|EDM57000.1| RNA methyltransferase, TrmH family, group 3 [Vibrio
           parahaemolyticus AQ3810]
 gi|328472293|gb|EGF43163.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Vibrio
           parahaemolyticus 10329]
          Length = 247

 Score =  109 bits (272), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 79/241 (32%), Positives = 119/241 (49%), Gaps = 20/241 (8%)

Query: 48  NLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLP--HPFPVKTVPPQTI---- 101
           N F+YG+H V A L     +  +    K    R D D  +P  +   V  V  Q +    
Sbjct: 3   NEFIYGIHAVKAVLEREPERFIEAYVLK---GRQD-DRLMPILNDLQVCGVSIQQMTRKT 58

Query: 102 --DKIVGKEAVHQGLALETAP---LLSPTLD---AVRNSQLLMVLDHVNDPHNIGAILRS 153
             DK  G  A HQG+     P   L    +D   A   + LL+VLD V DPHN+GA LR+
Sbjct: 59  LDDKAHG--ANHQGIIARVKPAKQLNENDIDDILAQHETPLLLVLDGVTDPHNLGACLRN 116

Query: 154 AVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLS 213
           A A     II  K  S   +A ++K A GA E +P IR++NL   ++ +   G   +G +
Sbjct: 117 ADAAGVAAIIVPKDRSAPMNATVSKVACGAAEVVPLIRVTNLARTMRTLQEQGIWFVGTA 176

Query: 214 SDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVAL 273
            ++   + Q      +A+++GAEG G+R  T+ET   +  + M G + +LNVS A+ + L
Sbjct: 177 GEATHDIYQAKLTGPLAIVMGAEGDGMRRLTRETCDDLIKIPMAGSVSSLNVSVASGICL 236

Query: 274 Y 274
           +
Sbjct: 237 F 237


>gi|87124232|ref|ZP_01080081.1| tRNA/rRNA methyltransferase (SpoU):RNA methyltransferase TrmH
           [Synechococcus sp. RS9917]
 gi|86167804|gb|EAQ69062.1| tRNA/rRNA methyltransferase (SpoU):RNA methyltransferase TrmH
           [Synechococcus sp. RS9917]
          Length = 504

 Score =  109 bits (272), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 63/181 (34%), Positives = 100/181 (55%), Gaps = 8/181 (4%)

Query: 101 IDKIVGKEAVHQGLALETA-------PLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRS 153
           + +I G  AVHQG+AL+TA       P L     ++    LL+ LD + DPHN+GAI+RS
Sbjct: 236 LGQITGG-AVHQGIALQTAAAETLDLPTLIEGCASLGEPPLLLALDGLTDPHNLGAIVRS 294

Query: 154 AVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLS 213
           A A    G++  +R S   +  +AK A+GALEH+P  R+ NL  +L+ +   G++ +GL+
Sbjct: 295 AEALGAHGVVLPQRRSAGLTGSVAKVAAGALEHLPVARVVNLNRSLESLKDAGYRVVGLA 354

Query: 214 SDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVAL 273
            +    L +      + ++ G+EG GL   T+     +  + + GI  +LN S A A+ L
Sbjct: 355 EEGDLTLAEADLEGPLVVVTGSEGDGLSLLTRRHCDQLIRIPLRGITPSLNASVATALCL 414

Query: 274 Y 274
           Y
Sbjct: 415 Y 415


>gi|254801702|sp|B8ZUB0|Y324_MYCLB RecName: Full=Uncharacterized tRNA/rRNA methyltransferase MLBr00324
 gi|254801703|sp|Q9CCW4|Y324_MYCLE RecName: Full=Uncharacterized tRNA/rRNA methyltransferase ML0324
          Length = 309

 Score =  109 bits (272), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 67/186 (36%), Positives = 103/186 (55%), Gaps = 11/186 (5%)

Query: 96  VPPQTIDKIVGKEAVHQGLALETAP--------LLSPTLDAVRNSQLLMVLDHVNDPHNI 147
           VP   +D+I     +HQG+AL+  P        LL+   D+     LL+ LD+++DP N+
Sbjct: 118 VPRTYLDRITNNH-LHQGIALQVPPYHYVHSDDLLAAATDS--PPALLVALDNISDPRNL 174

Query: 148 GAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGF 207
           GAI+RS  AFS  GI+  +R S S +AV  ++++GA   IP  R +NLT AL+     G 
Sbjct: 175 GAIVRSVAAFSGHGILIPQRRSASVTAVAWRTSAGAAARIPVARATNLTRALKVWADQGL 234

Query: 208 QTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSN 267
           + IGL  D    L+     D +A+++G+EGKGL    + +   +  + M G +++LN S 
Sbjct: 235 RVIGLDHDGDTALDDLDGTDPLAVVVGSEGKGLSRLVRHSCDEVVSIPMAGQVESLNASV 294

Query: 268 AAAVAL 273
           A  V L
Sbjct: 295 AVGVVL 300


>gi|75910610|ref|YP_324906.1| RNA methyltransferase TrmH [Anabaena variabilis ATCC 29413]
 gi|75704335|gb|ABA24011.1| RNA methyltransferase TrmH, group 3 [Anabaena variabilis ATCC
           29413]
          Length = 327

 Score =  109 bits (272), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 75/243 (30%), Positives = 125/243 (51%), Gaps = 22/243 (9%)

Query: 47  ENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANL--------PHPFPVKTVPP 98
           E+  +YG H V +AL N  R + ++  T     RL +D            +   +  V P
Sbjct: 72  ESDIIYGRHPVLSALEN-QRGLNRIWVTP----RLRYDPRFHNLILQAKENGAVIDEVEP 126

Query: 99  QTIDKIVGKEAVHQGLALETAPL-------LSPTLDAVRNSQLLMVLDHVNDPHNIGAIL 151
           + +D+I   +A HQG+A + AP        L     +V +  +++V D + DPHN+GAI+
Sbjct: 127 KRLDQIT-DQANHQGIAAQIAPYSYIEFYELIAQAKSVTDP-VIIVADGITDPHNLGAII 184

Query: 152 RSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIG 211
           R+A A    G++  +R +   ++ + K A+GALE+ P  R+ NL+ AL+ +   GF   G
Sbjct: 185 RTAEAIGAQGLVIPQRRASGITSTVVKVAAGALENFPVARVVNLSRALEDLKEAGFWIYG 244

Query: 212 LSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAV 271
            ++   +PL        I L++G+EG+GL   TQ +   +  + + G   +LN S AA +
Sbjct: 245 TAAGGSEPLHTVSFRGPIVLVIGSEGEGLSMLTQRSCDVLVSIPLMGKTPSLNASVAAGM 304

Query: 272 ALY 274
           ALY
Sbjct: 305 ALY 307


>gi|15642593|ref|NP_232226.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Vibrio cholerae O1
           biovar El Tor str. N16961]
 gi|153824008|ref|ZP_01976675.1| RNA methyltransferase, TrmH family [Vibrio cholerae B33]
 gi|227082715|ref|YP_002811266.1| RNA methyltransferase, TrmH family [Vibrio cholerae M66-2]
 gi|229507350|ref|ZP_04396855.1| 23S rRNA (guanosine-2'-O-) -methyltransferase RlmB [Vibrio cholerae
           BX 330286]
 gi|229509727|ref|ZP_04399208.1| 23S rRNA (guanosine-2'-O-) -methyltransferase RlmB [Vibrio cholerae
           B33]
 gi|229516851|ref|ZP_04406297.1| 23S rRNA (guanosine-2'-O-) -methyltransferase RlmB [Vibrio cholerae
           RC9]
 gi|229606856|ref|YP_002877504.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Vibrio cholerae
           MJ-1236]
 gi|254292176|ref|ZP_04962946.1| RNA methyltransferase, TrmH family [Vibrio cholerae AM-19226]
 gi|254851138|ref|ZP_05240488.1| 23S rRNA (guanosine-2'-O-)-methyltransferase rlmB [Vibrio cholerae
           MO10]
 gi|255744433|ref|ZP_05418385.1| 23S rRNA (guanosine-2'-O-) -methyltransferase RlmB [Vibrio cholera
           CIRS 101]
 gi|262158453|ref|ZP_06029568.1| 23S rRNA (guanosine-2'-O-) -methyltransferase RlmB [Vibrio cholerae
           INDRE 91/1]
 gi|298500578|ref|ZP_07010382.1| RNA methyltransferase, TrmH family, group 3 [Vibrio cholerae MAK
           757]
 gi|52783330|sp|Q9KNY2|RLMB_VIBCH RecName: Full=23S rRNA (guanosine-2'-O-)-methyltransferase RlmB;
           AltName: Full=23S rRNA Gm2251 2'-O-methyltransferase
 gi|9657186|gb|AAF95739.1| RNA methyltransferase, TrmH family [Vibrio cholerae O1 biovar El
           Tor str. N16961]
 gi|126518472|gb|EAZ75695.1| RNA methyltransferase, TrmH family [Vibrio cholerae B33]
 gi|150421905|gb|EDN13882.1| RNA methyltransferase, TrmH family [Vibrio cholerae AM-19226]
 gi|227010603|gb|ACP06815.1| RNA methyltransferase, TrmH family [Vibrio cholerae M66-2]
 gi|229345914|gb|EEO10886.1| 23S rRNA (guanosine-2'-O-) -methyltransferase RlmB [Vibrio cholerae
           RC9]
 gi|229353201|gb|EEO18140.1| 23S rRNA (guanosine-2'-O-) -methyltransferase RlmB [Vibrio cholerae
           B33]
 gi|229354855|gb|EEO19776.1| 23S rRNA (guanosine-2'-O-) -methyltransferase RlmB [Vibrio cholerae
           BX 330286]
 gi|229369511|gb|ACQ59934.1| 23S rRNA (guanosine-2'-O-) -methyltransferase RlmB [Vibrio cholerae
           MJ-1236]
 gi|254846843|gb|EET25257.1| 23S rRNA (guanosine-2'-O-)-methyltransferase rlmB [Vibrio cholerae
           MO10]
 gi|255737958|gb|EET93351.1| 23S rRNA (guanosine-2'-O-) -methyltransferase RlmB [Vibrio cholera
           CIRS 101]
 gi|262029614|gb|EEY48263.1| 23S rRNA (guanosine-2'-O-) -methyltransferase RlmB [Vibrio cholerae
           INDRE 91/1]
 gi|297540747|gb|EFH76804.1| RNA methyltransferase, TrmH family, group 3 [Vibrio cholerae MAK
           757]
          Length = 247

 Score =  109 bits (272), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 77/244 (31%), Positives = 120/244 (49%), Gaps = 26/244 (10%)

Query: 48  NLFLYGVHTVSAALN-NPSRKIF----------QLLATKNALARLDWDANLPHPFPVKTV 96
           N  +YG+H V+A L  +P+R +           +LL   N L RL           ++ +
Sbjct: 3   NELIYGIHAVNAVLQRDPARFVEAYVLKGRQDDRLLPVLNELMRLG--------VSIQEM 54

Query: 97  PPQTIDKIVGKEAVHQGLALETAP---LLSPTLD---AVRNSQLLMVLDHVNDPHNIGAI 150
             + +D    + A HQGL     P   L    LD   A     LL+VLD V DPHN+GA 
Sbjct: 55  SRKALDD-KAEGANHQGLIARVKPARQLNENDLDDILAQHEQPLLLVLDGVTDPHNLGAC 113

Query: 151 LRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTI 210
           LR+A A     +I  K  S   +A ++K A GA E +P +R++NL   ++ +   G   +
Sbjct: 114 LRNADAAGVAAVIVPKDKSAPLTATVSKVACGAAETVPLVRVTNLARTMRALQEKGVWFV 173

Query: 211 GLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAA 270
           G + ++   + Q      +A+++GAEG G+R  T+ET   +  + M G + +LNVS A  
Sbjct: 174 GTAGEATHDIYQSKLTGSLAIVMGAEGDGMRRLTRETCDDLIKIPMAGSVSSLNVSVACG 233

Query: 271 VALY 274
           V L+
Sbjct: 234 VCLF 237


>gi|21230973|ref|NP_636890.1| tRNA/rRNA methyltransferase [Xanthomonas campestris pv. campestris
           str. ATCC 33913]
 gi|66769023|ref|YP_243785.1| tRNA/rRNA methyltransferase [Xanthomonas campestris pv. campestris
           str. 8004]
 gi|188992138|ref|YP_001904148.1| tRNA/rRNA methyltransferase [Xanthomonas campestris pv. campestris
           str. B100]
 gi|52783316|sp|Q8PAG5|RLMB_XANCP RecName: Full=23S rRNA (guanosine-2'-O-)-methyltransferase RlmB;
           AltName: Full=23S rRNA Gm2251 2'-O-methyltransferase
 gi|21112593|gb|AAM40814.1| tRNA/rRNA methyltransferase [Xanthomonas campestris pv. campestris
           str. ATCC 33913]
 gi|66574355|gb|AAY49765.1| tRNA/rRNA methyltransferase [Xanthomonas campestris pv. campestris
           str. 8004]
 gi|167733898|emb|CAP52104.1| tRNA/rRNA methyltransferase [Xanthomonas campestris pv. campestris]
          Length = 249

 Score =  109 bits (272), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 74/239 (30%), Positives = 126/239 (52%), Gaps = 13/239 (5%)

Query: 47  ENLFLYGVHTVSAALNNPSRKIFQLL---ATKN-ALARLDWDANLPHPFPVKTVPPQTID 102
           +N ++ GV+ V++++ N +  + ++L    +KN  L  ++  A       V+ V  Q +D
Sbjct: 4   QNQWIVGVNAVASSVENDADNVREVLIEAGSKNPRLTEIEEQAR-RKGIDVRRVNTQALD 62

Query: 103 KIVGKEAVHQGLALETAPL-------LSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAV 155
             VG +  HQG+A   A         L   ++A +   L+++LD V DPHN+GA LRSA 
Sbjct: 63  G-VGGQVRHQGVAARYAAARLWAENELEGLVEAAQGRALVLILDGVQDPHNLGACLRSAA 121

Query: 156 AFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSD 215
           A     ++  K  S + +A + K+++GA + IP + ++NL   L+ +   G    GL+ +
Sbjct: 122 AAGVTAVVIPKDKSATVNATVRKTSAGAADRIPVVAVTNLARCLRDLQKQGVWLYGLAGE 181

Query: 216 SKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
           ++  L        + L+LG EG GLR  T+E    +  + MPG I++LNVS A  V L+
Sbjct: 182 AEASLYSVDLRGNVGLVLGGEGDGLRRLTREHCDGLVKIPMPGDIESLNVSVATGVTLF 240


>gi|84498462|ref|ZP_00997232.1| putative tRNA/rRNA methyltransferase [Janibacter sp. HTCC2649]
 gi|84381205|gb|EAP97089.1| putative tRNA/rRNA methyltransferase [Janibacter sp. HTCC2649]
          Length = 316

 Score =  109 bits (272), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 66/193 (34%), Positives = 100/193 (51%), Gaps = 13/193 (6%)

Query: 91  FPVKTVPPQTIDKIVGKEAVHQGLALETAP--------LLSPTLDAVRNSQLLMVLDHVN 142
            P+   P   +D+I    AVHQGLAL+  P        L+ P L  +    L++ LD + 
Sbjct: 119 LPILETPRGELDRIT-DGAVHQGLALQVPPYEYAHPNDLIDPELPGI---PLIVALDGIT 174

Query: 143 DPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKM 202
           DP N+GAI+RS  AF   G++   R S   +A   K+++GA   IP  + +NLT  L+  
Sbjct: 175 DPRNLGAIVRSVAAFGGHGVVVPARRSVGMTASAWKTSAGAAARIPVAQCTNLTRTLEDY 234

Query: 203 HSWGFQTIGLSSDSKKPL-EQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIK 261
              GF  IGL  +    L + E+ N+ I +++G+EGKGL    +ET   +  + M   ++
Sbjct: 235 RKAGFFVIGLDMEGDVELPDLELANEPIVIVVGSEGKGLSRLVRETCDQIVSVPMSSAVE 294

Query: 262 ALNVSNAAAVALY 274
           +LN   A  V LY
Sbjct: 295 SLNAGIATGVTLY 307


>gi|227894574|ref|ZP_04012379.1| tRNA-rRNA methyltransferase [Lactobacillus ultunensis DSM 16047]
 gi|227863733|gb|EEJ71154.1| tRNA-rRNA methyltransferase [Lactobacillus ultunensis DSM 16047]
          Length = 252

 Score =  109 bits (272), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 67/193 (34%), Positives = 104/193 (53%), Gaps = 9/193 (4%)

Query: 93  VKTVPPQTIDKIVGKEAVHQGLAL-----ETAPL--LSPTLDAVRNSQLLMVLDHVNDPH 145
           ++TVP   +D++V +   HQGL L     E A L  L    D       L++LD + DPH
Sbjct: 54  IQTVPKNKLDRLV-EGGNHQGLVLAISSFEYADLDQLLDKFDQEEKEPFLLMLDSIEDPH 112

Query: 146 NIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSW 205
           N+G+ILRSA A   DGII  KR++   ++V+AK+++GA++++P  R++NL    +++   
Sbjct: 113 NLGSILRSADATGVDGIIIPKRHATGLTSVVAKTSTGAIDYVPVARVNNLVQTTKELKKR 172

Query: 206 GFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNV 265
           G+   G         E   K  K  L++G EGKG+ P  ++       L M G +++LN 
Sbjct: 173 GYWVFGTDMAGVDYREWNAKG-KAVLVIGNEGKGIAPLLKKQMDQTITLPMVGHVQSLNA 231

Query: 266 SNAAAVALYITQN 278
           S A  V LY   N
Sbjct: 232 SVATGVLLYQAYN 244


>gi|285018766|ref|YP_003376477.1| tRNA/rrna methyltransferase [Xanthomonas albilineans GPE PC73]
 gi|283473984|emb|CBA16485.1| probable trna/rrna methyltransferase protein [Xanthomonas
           albilineans]
          Length = 248

 Score =  109 bits (272), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 76/239 (31%), Positives = 127/239 (53%), Gaps = 13/239 (5%)

Query: 47  ENLFLYGVHTVSAALNNPSRKIFQLL---ATKN-ALARLDWDANLPHPFPVKTVPPQTID 102
           +N ++ GV+ V++++ N +  + ++L    +KN  L  ++ +A       V+ V  Q +D
Sbjct: 4   QNQWIVGVNAVASSIENDADNVREVLVEAGSKNPRLQEIEENAR-RKGIEVRRVNTQALD 62

Query: 103 KIVGKEAVHQGLALETAPL-------LSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAV 155
             VG    HQG+A   A         L   + A +   LL+VLD V DPHN+GA LRSA 
Sbjct: 63  G-VGGSVRHQGVAARYAAARTWAESELEGLVAAAQGRALLLVLDGVQDPHNLGACLRSAA 121

Query: 156 AFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSD 215
           A     ++  K  S   +A + K+++GA + +P + ++NL   L+++   G    GL+ +
Sbjct: 122 AAGVTAVVIPKDKSAPVNATVRKTSAGAADRLPIVAVTNLARCLRELQKQGVWIYGLAGE 181

Query: 216 SKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
           ++  L  +     +AL+LG E  GLR  T+E    +  + MPG I++LNVS AA V L+
Sbjct: 182 AETSLYAQDLRGNVALVLGGESDGLRRLTREHCDGLVRIPMPGEIESLNVSVAAGVTLF 240


>gi|33240198|ref|NP_875140.1| rRNA methylase [Prochlorococcus marinus subsp. marinus str.
           CCMP1375]
 gi|33237725|gb|AAP99792.1| rRNA methylase [Prochlorococcus marinus subsp. marinus str.
           CCMP1375]
          Length = 418

 Score =  109 bits (272), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 85/296 (28%), Positives = 137/296 (46%), Gaps = 59/296 (19%)

Query: 15  LKDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPENLFLY---------GVHTVSAALNN-- 63
           ++   +    RN+++      F+Q ++   +P+  F++         G H+  A L +  
Sbjct: 113 VQSRRFTSFSRNNQN-----DFSQSTQEIEKPKQNFVFESESNDIFWGRHSTQAILESGR 167

Query: 64  ------------PSRKIFQLLATKNALARL----DWDANLPHPFPVKTVPPQTIDKIVGK 107
                        S + FQLL    AL  L     W A L H               V  
Sbjct: 168 AIHRIWCTSEIRSSPRFFQLLKDAKALGVLVEEVSW-ARLGH---------------VTT 211

Query: 108 EAVHQGLALETAPLLSPTLD---------AVRNSQLLMVLDHVNDPHNIGAILRSAVAFS 158
             VHQG+AL+TA   S T D         ++  S +L+ LD + DP N+GAI+RSA A  
Sbjct: 212 GGVHQGIALQTAA--SETFDLKTLIEGCQSIDESPVLIALDGLTDPQNLGAIVRSAEALG 269

Query: 159 CDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKK 218
             G+I  +R S   +  +AK A+GALEH+P  R+ NL  +L+++   G+  IGL+ +  K
Sbjct: 270 AHGLILPQRRSAGLTGSVAKVAAGALEHLPVARVVNLNRSLEELKKSGYTIIGLAGEGDK 329

Query: 219 PLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
            + +   +  + L +G+E KGL   T+     +  + + G+  +LN S A +V LY
Sbjct: 330 TINEITFDGPLVLAIGSEEKGLSLLTRRHCDFLVKIPLRGVTTSLNASVATSVVLY 385


>gi|119947021|ref|YP_944701.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Psychromonas
           ingrahamii 37]
 gi|119865625|gb|ABM05102.1| RNA methyltransferase, TrmH family, group 3 [Psychromonas
           ingrahamii 37]
          Length = 246

 Score =  109 bits (272), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 81/242 (33%), Positives = 125/242 (51%), Gaps = 25/242 (10%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLATK--------NALARL-DWDANLPHPFPVKTVPPQT 100
            LYG+H+V A L     +  ++ A K        N +A+L +W         V+ +  + 
Sbjct: 6   LLYGIHSVDALLEKQPERFIEVYALKGREDERLNNIIAKLNEWG------ISVQLMNRKA 59

Query: 101 ID-KIVGKEAVHQGLA--LETAPLLSPT-LDAVRNSQ----LLMVLDHVNDPHNIGAILR 152
           +D K  G++  HQG+   ++TA +L+   LD++  S      L++LD V DPHN+GA LR
Sbjct: 60  MDDKSEGEQ--HQGIIARVKTAKVLNDNDLDSLLESLTAPPFLLILDGVTDPHNLGACLR 117

Query: 153 SAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGL 212
           SA A     +I  K  S S + V+ K A GA E +P I ++NL  A++ +   G    G 
Sbjct: 118 SADAAGVHAVIIPKDNSASLTPVVRKVACGAAESVPLIHVTNLARAMRSLQDKGVWIYGT 177

Query: 213 SSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVA 272
           + ++ + L        +AL +GAEGKGLR  T+E    +  L M G + +LNVS A  V 
Sbjct: 178 AGEATQSLYDCKLEGGMALAMGAEGKGLRRLTREHCDQLIKLPMAGAVSSLNVSVATGVC 237

Query: 273 LY 274
           L+
Sbjct: 238 LF 239


>gi|254430454|ref|ZP_05044157.1| methyltransferase of 23S rRNA [Cyanobium sp. PCC 7001]
 gi|197624907|gb|EDY37466.1| methyltransferase of 23S rRNA [Cyanobium sp. PCC 7001]
          Length = 378

 Score =  109 bits (272), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 64/173 (36%), Positives = 93/173 (53%), Gaps = 7/173 (4%)

Query: 109 AVHQGLALETA-------PLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDG 161
           AVHQG+ L+TA       P L      +    LLM LD + DPHN+GAI RSA A    G
Sbjct: 36  AVHQGIVLQTAAAETLDLPSLIEGCRGIGEPPLLMALDGITDPHNLGAIARSAEALGAHG 95

Query: 162 IITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLE 221
           ++  +R S   +  +AK A+GALEH+P  R+ NL  AL  +   G++ IGL+S+    LE
Sbjct: 96  LVLPQRRSAGLTGSVAKVAAGALEHLPVARVVNLNRALDSLKQEGYRVIGLASEGSVSLE 155

Query: 222 QEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
           Q      + ++ G+E  GL   T++    +  + + G   +LN S A A+ LY
Sbjct: 156 QADLEGPLVIVTGSEADGLAMLTRKHCDQLVSIPLRGATPSLNASVATALLLY 208


>gi|15827088|ref|NP_301351.1| methyltransferase [Mycobacterium leprae TN]
 gi|221229566|ref|YP_002502982.1| putative methyltransferase [Mycobacterium leprae Br4923]
 gi|13092636|emb|CAC29832.1| putative methyltransferase [Mycobacterium leprae]
 gi|219932673|emb|CAR70417.1| putative methyltransferase [Mycobacterium leprae Br4923]
          Length = 278

 Score =  109 bits (272), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 67/186 (36%), Positives = 103/186 (55%), Gaps = 11/186 (5%)

Query: 96  VPPQTIDKIVGKEAVHQGLALETAP--------LLSPTLDAVRNSQLLMVLDHVNDPHNI 147
           VP   +D+I     +HQG+AL+  P        LL+   D+     LL+ LD+++DP N+
Sbjct: 87  VPRTYLDRITNNH-LHQGIALQVPPYHYVHSDDLLAAATDS--PPALLVALDNISDPRNL 143

Query: 148 GAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGF 207
           GAI+RS  AFS  GI+  +R S S +AV  ++++GA   IP  R +NLT AL+     G 
Sbjct: 144 GAIVRSVAAFSGHGILIPQRRSASVTAVAWRTSAGAAARIPVARATNLTRALKVWADQGL 203

Query: 208 QTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSN 267
           + IGL  D    L+     D +A+++G+EGKGL    + +   +  + M G +++LN S 
Sbjct: 204 RVIGLDHDGDTALDDLDGTDPLAVVVGSEGKGLSRLVRHSCDEVVSIPMAGQVESLNASV 263

Query: 268 AAAVAL 273
           A  V L
Sbjct: 264 AVGVVL 269


>gi|85713280|ref|ZP_01044303.1| RRNA methylase, SpoU family protein [Idiomarina baltica OS145]
 gi|85692898|gb|EAQ30873.1| RRNA methylase, SpoU family protein [Idiomarina baltica OS145]
          Length = 248

 Score =  109 bits (272), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 70/246 (28%), Positives = 127/246 (51%), Gaps = 15/246 (6%)

Query: 47  ENLFLYGVHTVSAALNNPSRKIFQLLATKN----ALARLDWDANLPHPFPVKTVPPQTID 102
           + + ++G+H V + L     ++ +L  ++     ++A +   A      P + +P Q +D
Sbjct: 3   QKVTVFGLHAVRSVLTQHPDRLIELFVSRERQDASVAEVIGQAEAIGIRP-QWIPRQALD 61

Query: 103 KIVGKEAVHQGLALETAPL-------LSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAV 155
           K   +   HQG+      L        S  ++  + + L +VLD+V DPHN+GA +R+A 
Sbjct: 62  K-RAEFGNHQGVVATIKALPPLNENDFSTLIEKAQGAPLFLVLDNVTDPHNLGACMRTAD 120

Query: 156 AFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSD 215
           A     ++  K  S   +  + K A GA+++IP + ++NL  AL+ +       +G + +
Sbjct: 121 AAGATAVVVPKDKSAQITPTVRKVACGAVDNIPLVVVTNLARALRTLQDLNVWVVGTAGE 180

Query: 216 SKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY- 274
           + K L Q      +AL++GAEGKG+R  T+ET   +A + + G + +LNVS A+ V L+ 
Sbjct: 181 ADKSLYQIDFKGPLALVMGAEGKGMRRLTRETCDELASIPLDGSVSSLNVSVASGVCLFE 240

Query: 275 -ITQNH 279
            + Q H
Sbjct: 241 AVRQRH 246


>gi|301154986|emb|CBW14449.1| 23S rRNA (Gm2251)-methyltransferase [Haemophilus parainfluenzae
           T3T1]
          Length = 256

 Score =  109 bits (272), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 81/249 (32%), Positives = 125/249 (50%), Gaps = 17/249 (6%)

Query: 39  KSRHTSQPENLFLYGVHTVSAAL-NNPSRKIFQLLATKNALARLDWDANLPHPF--PVKT 95
           K+     P +  +YG+H V++ L N+P R I   +       RL    N  +     V+ 
Sbjct: 3   KNNKQENPMSENIYGIHAVNSILANSPERLIEVFVLKGREDKRLQPLLNELYALGIAVQF 62

Query: 96  VPPQTIDKIVGKEAVHQGL---ALETAPLLSPTLDAV---RNSQLLMVLDHVNDPHNIGA 149
           V  QT+DK    E VHQG+     E   L    LD +   + + LL+VLD V DPHN+GA
Sbjct: 63  VNRQTLDKKSNGE-VHQGVIARVQEAKELNEHDLDELLTRKQNPLLLVLDGVTDPHNLGA 121

Query: 150 ILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHS----W 205
            LR+A A     +I  K  S   +++  K A GA E +P IR++NL   L+ +      W
Sbjct: 122 CLRTADAAGVSAVIVPKDKSAQLTSIARKVACGAAETVPLIRVTNLARTLRDLQQNHNIW 181

Query: 206 GFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNV 265
               +G + ++ + + Q      +AL++GAEG+G+R  T+E    +  + M G + +LNV
Sbjct: 182 ---VVGTAGEATETIYQSKLTGSLALVMGAEGEGMRRLTREHCDQLISIPMAGSVSSLNV 238

Query: 266 SNAAAVALY 274
           S A  V L+
Sbjct: 239 SVATGVCLF 247


>gi|253999430|ref|YP_003051493.1| TrmH family RNA methyltransferase [Methylovorus sp. SIP3-4]
 gi|253986109|gb|ACT50966.1| RNA methyltransferase, TrmH family, group 3 [Methylovorus sp.
           SIP3-4]
          Length = 249

 Score =  109 bits (272), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 75/235 (31%), Positives = 117/235 (49%), Gaps = 10/235 (4%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLATKNAL-ARLDWDANLPHPFPVK--TVPPQTIDKIVG 106
            L+G H V + L   +  + ++L  K+ + AR+    NL     V+   V    +D + G
Sbjct: 6   ILFGFHAVLSRLRQHAASVQEILIDKDRVDARMKDLINLAEGASVRLMQVERSRLDGMAG 65

Query: 107 KEAVHQGLALETA--PLLSPTLDAVRNSQL-----LMVLDHVNDPHNIGAILRSAVAFSC 159
               HQG+       P+    +  +  S L      +VLD V DPHN+GA LR A A   
Sbjct: 66  ANGRHQGVIARVVDTPIPYKDIHDILESDLTEPPFFLVLDGVEDPHNLGACLRVADAMGV 125

Query: 160 DGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKP 219
             +I  K  +   +A + K A GA E IP+I ++NL   L+++   G   +G ++D+   
Sbjct: 126 HAVIAPKDRAAGLNATVRKVACGAAETIPFIAVTNLARTLRELQEAGVFVVGAAADAPGN 185

Query: 220 LEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
           L        +AL+LGAEG GLR  T ET  ++  + M G +++LNVS A+ + LY
Sbjct: 186 LFTTKLAGPLALVLGAEGAGLRRLTAETCDTLVSIPMFGSVESLNVSVASGICLY 240


>gi|72382102|ref|YP_291457.1| RNA methyltransferase TrmH [Prochlorococcus marinus str. NATL2A]
 gi|72001952|gb|AAZ57754.1| RNA methyltransferase TrmH, group 3 [Prochlorococcus marinus str.
           NATL2A]
          Length = 416

 Score =  109 bits (272), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 61/175 (34%), Positives = 97/175 (55%), Gaps = 11/175 (6%)

Query: 109 AVHQGLALETAPLLSPTLD---------AVRNSQLLMVLDHVNDPHNIGAILRSAVAFSC 159
           AVHQG+ L+ A   S TLD         A  +S LL+ LD + DP N+GAI+RSA A   
Sbjct: 213 AVHQGIVLQIAA--SKTLDLKNLIDACKAFGDSSLLLALDGLTDPQNLGAIIRSAEALGA 270

Query: 160 DGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKP 219
            G+I  +R S   +  +AK A+GALEH+P  R+ NL  +L+K+   G+  +GL+ +    
Sbjct: 271 QGLILPQRRSAGLTGSVAKVAAGALEHLPVARVVNLNRSLEKLKDEGYTVVGLAEEGSST 330

Query: 220 LEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
           L +      + +++G+E KG+   T+     +  + + G+  +LN S A ++ LY
Sbjct: 331 LSEIKFQGPLVVVVGSEDKGISLITRRLCDQLVRIPLKGVTTSLNASVATSIFLY 385


>gi|121604792|ref|YP_982121.1| RNA methyltransferase [Polaromonas naphthalenivorans CJ2]
 gi|120593761|gb|ABM37200.1| 23S rRNA Gm-2251 2'-O-methyltransferase [Polaromonas
           naphthalenivorans CJ2]
          Length = 253

 Score =  109 bits (272), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 57/141 (40%), Positives = 83/141 (58%)

Query: 134 LLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRIS 193
           LL+VLD V DPHN+GA LR A       +I  K ++   +A +AK ASGA E +PY  ++
Sbjct: 102 LLLVLDGVTDPHNLGACLRVADGAGAQAVIAPKDHAAGINATVAKVASGAAETVPYFMVT 161

Query: 194 NLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAH 253
           NL   L ++       IG S D++K +        +ALILGAEG+G+R  T++T   +  
Sbjct: 162 NLARTLNELKERNIWCIGTSDDAEKTIYDVDLTGPVALILGAEGEGMRQLTRKTCDELVS 221

Query: 254 LHMPGIIKALNVSNAAAVALY 274
           + M G +++LNVS A+ V LY
Sbjct: 222 IPMQGAVESLNVSVASGVCLY 242


>gi|270284654|ref|ZP_05966454.2| RNA methyltransferase, TrmH family, group 3 [Bifidobacterium
           gallicum DSM 20093]
 gi|270276599|gb|EFA22453.1| RNA methyltransferase, TrmH family, group 3 [Bifidobacterium
           gallicum DSM 20093]
          Length = 348

 Score =  109 bits (272), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 55/142 (38%), Positives = 87/142 (61%), Gaps = 1/142 (0%)

Query: 134 LLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRIS 193
           L + LD V DP N+GA++RSA AF  +G+I  +R S S +A   K ++GA  H+P  R+ 
Sbjct: 189 LFIALDGVTDPQNLGAVIRSAAAFGANGVILPERRSASVTAAAWKVSAGAAAHMPIARVV 248

Query: 194 NLTDALQKMHSWGFQTIGL-SSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMA 252
           NLT A++ +   G+  +GL  S SK+  +   + D + ++LG+EGKGL   T+E    +A
Sbjct: 249 NLTKAIEGLKERGYYAVGLDGSGSKEVGQTGFETDPLIVVLGSEGKGLSRLTREACDCIA 308

Query: 253 HLHMPGIIKALNVSNAAAVALY 274
            + M  ++++LN S AA + LY
Sbjct: 309 GIPMTSMVESLNASVAAGITLY 330


>gi|332289064|ref|YP_004419916.1| 23S rRNA [Gallibacterium anatis UMN179]
 gi|330431960|gb|AEC17019.1| 23S rRNA [Gallibacterium anatis UMN179]
          Length = 245

 Score =  108 bits (271), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 74/234 (31%), Positives = 116/234 (49%), Gaps = 11/234 (4%)

Query: 51  LYGVHTVSAALNNPSRKIFQLLATKNAL-ARLDWDANLPHPF--PVKTVPPQTIDKIVGK 107
           +YG+H VSA L+    +  ++   K     RL    N  H     V+ +  Q +DK    
Sbjct: 5   IYGIHAVSAVLSTTPERFIEVFVLKGREDKRLQPLLNELHQLGISVQFLTRQALDKKANG 64

Query: 108 EAVHQGLALETAPLLSPTLDAV------RNSQLLMVLDHVNDPHNIGAILRSAVAFSCDG 161
           E  HQG+  +  P    T + +      +   LL+VLD V DPHN+GA LR+A A   D 
Sbjct: 65  ET-HQGIIAKVQPPKEQTENDLYALLQQKKHPLLLVLDGVTDPHNLGACLRTADAAGVDA 123

Query: 162 IITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKM-HSWGFQTIGLSSDSKKPL 220
           +I  +  S   ++V  K A GA E +P IR++NL   L+ +   +    +G + ++   +
Sbjct: 124 VIIPRDKSAQLTSVARKVACGAAEVVPLIRVTNLARTLKTLQQDYNIWVVGTAGEANSSI 183

Query: 221 EQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
            Q      +AL++GAEG G+R  T+E    +  + M G + +LNVS A  V L+
Sbjct: 184 YQNKLTGALALVMGAEGDGMRRLTREHCDQLVSIPMQGSVSSLNVSVATGVCLF 237


>gi|260772094|ref|ZP_05881011.1| 23S rRNA (guanosine-2'-O-) -methyltransferase RlmB [Vibrio
           metschnikovii CIP 69.14]
 gi|260612961|gb|EEX38163.1| 23S rRNA (guanosine-2'-O-) -methyltransferase RlmB [Vibrio
           metschnikovii CIP 69.14]
          Length = 246

 Score =  108 bits (271), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 73/244 (29%), Positives = 120/244 (49%), Gaps = 26/244 (10%)

Query: 48  NLFLYGVHTVSAALNNPSRKIFQ-----------LLATKNALARLDWDANLPHPFPVKTV 96
           N  +YG+H+V+A +     +I +           LL   N L RL           ++ +
Sbjct: 3   NELIYGIHSVNAVMQREPARIIEVYVLKGRQDDRLLPVLNELQRLG--------LSIQEM 54

Query: 97  PPQTIDKIVGKEAVHQGLALETAP---LLSPTLDAVRNSQ---LLMVLDHVNDPHNIGAI 150
             + +D    + A HQGL  +  P   L    LDA+ +     LL+VLD V DPHN+GA 
Sbjct: 55  GRKALDD-KAQGANHQGLIAKVKPAKALNEHDLDAILSQHEQPLLLVLDGVTDPHNLGAC 113

Query: 151 LRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTI 210
           LR+A A     +I  K  S   +A ++K A GA E +P +R++NL   ++ +   G   +
Sbjct: 114 LRNADAAGVAAVIVPKDRSAPMTATVSKVACGAAETVPLVRVTNLARTMRALQEQGVWFV 173

Query: 211 GLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAA 270
           G + ++   L        +A+++GAEG G+R  T++T   +  + M G + +LNVS A  
Sbjct: 174 GTAGEATHDLYHSKLTGPLAIVMGAEGDGMRRLTRDTCDDLIKIPMAGSVSSLNVSVATG 233

Query: 271 VALY 274
           + L+
Sbjct: 234 ICLF 237


>gi|332365775|gb|EGJ43532.1| tRNA (guanosine-2'-O-)-methyltransferase [Streptococcus sanguinis
           SK355]
          Length = 233

 Score =  108 bits (271), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 63/184 (34%), Positives = 102/184 (55%), Gaps = 8/184 (4%)

Query: 97  PPQTIDKIVGKEAVHQGLALETAPLLSPTLDAV------RNSQLLMVLDHVNDPHNIGAI 150
           P +T+ ++    AVHQG  L  A       + +       ++ LL++LD + DPHN+G+I
Sbjct: 45  PKKTLQEMT-DGAVHQGFVLRVAEFAYTDFEVLLKKAEQEDNPLLLILDGLTDPHNLGSI 103

Query: 151 LRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTI 210
           LR+A A +  G+I  K  +   + V+AK+++GA+EHIP  R++NL+  L K+   GF   
Sbjct: 104 LRTADATNVTGVIIPKHRAVGVTPVVAKTSTGAIEHIPIARVTNLSQTLDKLKEAGFWIF 163

Query: 211 GLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAA 270
           G       P  +     K+ALI+G EGKG+    ++    M  + M G +++LN S AAA
Sbjct: 164 GTDMQG-TPSHKWNTAGKLALIIGNEGKGISSNIKKQVDEMISIPMNGHVQSLNASVAAA 222

Query: 271 VALY 274
           + +Y
Sbjct: 223 ILMY 226


>gi|256844498|ref|ZP_05549984.1| RNA methyltransferase [Lactobacillus crispatus 125-2-CHN]
 gi|293381069|ref|ZP_06627090.1| RNA methyltransferase, TrmH family, group 3 [Lactobacillus
           crispatus 214-1]
 gi|312977948|ref|ZP_07789694.1| RNA methyltransferase, TrmH family, group 3 [Lactobacillus
           crispatus CTV-05]
 gi|256613576|gb|EEU18779.1| RNA methyltransferase [Lactobacillus crispatus 125-2-CHN]
 gi|290922369|gb|EFD99350.1| RNA methyltransferase, TrmH family, group 3 [Lactobacillus
           crispatus 214-1]
 gi|310895255|gb|EFQ44323.1| RNA methyltransferase, TrmH family, group 3 [Lactobacillus
           crispatus CTV-05]
          Length = 251

 Score =  108 bits (271), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 72/196 (36%), Positives = 107/196 (54%), Gaps = 15/196 (7%)

Query: 93  VKTVPPQTIDKIVGKEAVHQGLAL-----ETAPL--LSPTLDAVRNSQLLMVLDHVNDPH 145
           V+ VP   +D++V     HQGL L     E A L  L    DA      L++LD + DPH
Sbjct: 54  VQDVPKNKLDRLVAG-GNHQGLVLAISSFEYADLNQLLDKYDAEGKEPFLLMLDSIEDPH 112

Query: 146 NIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNL---TDALQKM 202
           N+G+ILRSA A   DGII  KR++   ++V+AK+++GA++++P  R++NL   T  L+K 
Sbjct: 113 NLGSILRSADATGVDGIIIPKRHATGLTSVVAKTSTGAIDYVPVARVNNLVQTTKELKKR 172

Query: 203 HSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKA 262
             W F T    +D ++   Q     K  L++G EGKG+ P  ++       L M G +++
Sbjct: 173 GYWVFGTDMAGTDYREWNAQ----GKTVLVIGNEGKGIAPLLKKQMDQTITLPMVGHVQS 228

Query: 263 LNVSNAAAVALYITQN 278
           LN S A  V LY   N
Sbjct: 229 LNASVATGVLLYQAYN 244


>gi|124025638|ref|YP_001014754.1| RNA methyltransferase TrmH, group 3 [Prochlorococcus marinus str.
           NATL1A]
 gi|123960706|gb|ABM75489.1| RNA methyltransferase TrmH, group 3 [Prochlorococcus marinus str.
           NATL1A]
          Length = 442

 Score =  108 bits (271), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 70/217 (32%), Positives = 111/217 (51%), Gaps = 23/217 (10%)

Query: 67  KIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTL 126
           K FQLL  + A   L           V+ V    + ++    AVHQG+ L+ A   S TL
Sbjct: 209 KFFQLLKDQKASGVL-----------VEEVSWSRLGQLTNG-AVHQGIVLQIAA--SKTL 254

Query: 127 D---------AVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLA 177
           D         A  +S LL+ LD + DP N+GAI+RSA A    G+I  +R S   +  +A
Sbjct: 255 DLKNLIDACKAFGDSSLLLALDGLTDPQNLGAIIRSAEALGAQGLILPQRRSAGLTGSVA 314

Query: 178 KSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEG 237
           K A+GALEH+P  R+ NL  +L+K+   G+  +GL+ +    L +      + +++G+E 
Sbjct: 315 KVAAGALEHLPVARVVNLNRSLEKLKDEGYTVVGLAEEGSSTLSEIKFQGPLVVVVGSED 374

Query: 238 KGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
           KG+   T+     +  + + G+  +LN S A ++ LY
Sbjct: 375 KGISLITRRLCDQLVRIPLKGVTTSLNASVATSIFLY 411


>gi|325917513|ref|ZP_08179718.1| 23S rRNA Gm-2251 2'-O-methyltransferase [Xanthomonas vesicatoria
           ATCC 35937]
 gi|325536271|gb|EGD08062.1| 23S rRNA Gm-2251 2'-O-methyltransferase [Xanthomonas vesicatoria
           ATCC 35937]
          Length = 249

 Score =  108 bits (271), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 75/239 (31%), Positives = 125/239 (52%), Gaps = 13/239 (5%)

Query: 47  ENLFLYGVHTVSAALNNPSRKIFQLL---ATKN-ALARLDWDANLPHPFPVKTVPPQTID 102
           +N ++ GV+ V++++ N +  + ++L    +KN  L  ++  A       V+ V  Q +D
Sbjct: 4   QNQWIVGVNAVASSVENDADNVREVLIEAGSKNPRLTEIEEQAR-RKGIDVRRVNTQALD 62

Query: 103 KIVGKEAVHQGLALETAPL-------LSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAV 155
             VG +  HQG+A   A         L   +DA +   L++VLD V DPHN+GA LRSA 
Sbjct: 63  G-VGGQVRHQGVAARYAAARLWAENELEGLVDAAQGRALVLVLDGVQDPHNLGACLRSAA 121

Query: 156 AFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSD 215
           A     ++  K  S + +A + K+++GA + IP + ++NL   L+ +   G    GL+ +
Sbjct: 122 AAGVTAVVIPKDKSATVNATVRKTSAGAADRIPVVAVTNLARCLRDLQKQGVWLYGLAGE 181

Query: 216 SKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
           ++  L        + L+LG E  GLR  T+E    +  + MPG I++LNVS A  V L+
Sbjct: 182 AEASLYSVDLRGNVGLVLGGESDGLRRLTREHCDGLVKIPMPGDIESLNVSVATGVTLF 240


>gi|227879319|ref|ZP_03997185.1| TrmH family tRNA/rRNA methyltransferase [Lactobacillus crispatus
           JV-V01]
 gi|256849114|ref|ZP_05554547.1| tRNA-rRNA methyltransferase [Lactobacillus crispatus MV-1A-US]
 gi|262047595|ref|ZP_06020550.1| TrmH family RNA methyltransferase [Lactobacillus crispatus
           MV-3A-US]
 gi|227861088|gb|EEJ68741.1| TrmH family tRNA/rRNA methyltransferase [Lactobacillus crispatus
           JV-V01]
 gi|256713890|gb|EEU28878.1| tRNA-rRNA methyltransferase [Lactobacillus crispatus MV-1A-US]
 gi|260572171|gb|EEX28736.1| TrmH family RNA methyltransferase [Lactobacillus crispatus
           MV-3A-US]
          Length = 251

 Score =  108 bits (271), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 72/196 (36%), Positives = 107/196 (54%), Gaps = 15/196 (7%)

Query: 93  VKTVPPQTIDKIVGKEAVHQGLAL-----ETAPL--LSPTLDAVRNSQLLMVLDHVNDPH 145
           V+ VP   +D++V     HQGL L     E A L  L    DA      L++LD + DPH
Sbjct: 54  VQDVPKNKLDRLVAG-GNHQGLVLAISSFEYADLDQLLDKYDAEGKEPFLLMLDSIEDPH 112

Query: 146 NIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNL---TDALQKM 202
           N+G+ILRSA A   DGII  KR++   ++V+AK+++GA++++P  R++NL   T  L+K 
Sbjct: 113 NLGSILRSADATGVDGIIIPKRHATGLTSVVAKTSTGAIDYVPVARVNNLVQTTKELKKR 172

Query: 203 HSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKA 262
             W F T    +D ++   Q     K  L++G EGKG+ P  ++       L M G +++
Sbjct: 173 GYWVFGTDMAGTDYREWNAQ----GKTVLVIGNEGKGIAPLLKKQMDQTITLPMVGHVQS 228

Query: 263 LNVSNAAAVALYITQN 278
           LN S A  V LY   N
Sbjct: 229 LNASVATGVLLYQAYN 244


>gi|261867104|ref|YP_003255026.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Aggregatibacter
           actinomycetemcomitans D11S-1]
 gi|261412436|gb|ACX81807.1| RNA methyltransferase, TrmH family, group 3 [Aggregatibacter
           actinomycetemcomitans D11S-1]
          Length = 245

 Score =  108 bits (271), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 81/245 (33%), Positives = 128/245 (52%), Gaps = 33/245 (13%)

Query: 51  LYGVHTVSAALNNPSRKIFQLLATK-----------NALARLDWDANLPHPFPVKTVPPQ 99
           +YG+H V A + +   ++ ++ A K           N + RL           V+ +  Q
Sbjct: 5   IYGIHAVKAFVTHYPERLIEVWALKGRDDQRLQPLINEIQRLG--------ISVQFLNRQ 56

Query: 100 TIDKIVGKEAVHQGLA--LETAPLLSP-TLDAV---RNSQLLMVLDHVNDPHNIGAILRS 153
           T+DK    E VHQG+   + + P L+   LD +   +N+ LL+VLD V DPHN+GA LR+
Sbjct: 57  TLDKKAEGE-VHQGIIARVHSLPELNEHDLDRLLEQQNTPLLLVLDGVTDPHNLGACLRT 115

Query: 154 AVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDA---LQKMHS-WGFQT 209
           A A   + +I  K  S   ++   K A GA E++P IR++NL      LQK H+ W    
Sbjct: 116 ADAAGVNAVIVPKDKSAQLNSTARKVACGAAENVPLIRVTNLARTLRELQKRHNVW---V 172

Query: 210 IGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAA 269
           +G + ++ + L Q      +AL++GAEG+G+R  T+E    +  + M G + +LNVS A 
Sbjct: 173 VGTAGETTETLYQTKLTGALALVMGAEGEGMRRLTREHCDQLISIPMMGSVSSLNVSVAT 232

Query: 270 AVALY 274
            V L+
Sbjct: 233 GVCLF 237


>gi|118619334|ref|YP_907666.1| tRNA/rRNA methyltransferase [Mycobacterium ulcerans Agy99]
 gi|254803872|sp|A0PV26|Y4155_MYCUA RecName: Full=Uncharacterized tRNA/rRNA methyltransferase MUL_4155
 gi|118571444|gb|ABL06195.1| tRNA/rRNA methyltransferase [Mycobacterium ulcerans Agy99]
          Length = 310

 Score =  108 bits (270), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 64/191 (33%), Positives = 105/191 (54%), Gaps = 11/191 (5%)

Query: 91  FPVKTVPPQTIDKIVGKEAVHQGLALETAP--------LLSPTLDAVRNSQLLMVLDHVN 142
            P+  VP   +D++     +HQG+AL+  P        LL+  LD      LL+ LD+++
Sbjct: 114 IPILEVPRTDLDRMTANH-LHQGIALQVPPYNYAHPDDLLAAALDT--PPALLVALDNIS 170

Query: 143 DPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKM 202
           DP N+GAI+RS  AF   G++  +R S S +AV  ++++GA   +P  R +NLT AL+  
Sbjct: 171 DPRNLGAIVRSVAAFGGHGVLIPQRRSASVTAVAWRTSAGAAARMPVARATNLTRALKDW 230

Query: 203 HSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKA 262
              G + +GL +     ++    +D I +++G+EGKGL    ++T   +  + M G  ++
Sbjct: 231 ADRGVRVVGLDAGGDTAIDDLDGSDPIVVVVGSEGKGLSRLVRQTCDEVVSVPMAGPTES 290

Query: 263 LNVSNAAAVAL 273
           LN S AA V L
Sbjct: 291 LNASVAAGVVL 301


>gi|183985047|ref|YP_001853338.1| tRNA/rRNA methyltransferase [Mycobacterium marinum M]
 gi|254806447|sp|B2HJ20|Y5079_MYCMM RecName: Full=Uncharacterized tRNA/rRNA methyltransferase MMAR_5079
 gi|183178373|gb|ACC43483.1| tRNA/rRNA methyltransferase [Mycobacterium marinum M]
          Length = 310

 Score =  108 bits (270), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 64/191 (33%), Positives = 105/191 (54%), Gaps = 11/191 (5%)

Query: 91  FPVKTVPPQTIDKIVGKEAVHQGLALETAP--------LLSPTLDAVRNSQLLMVLDHVN 142
            P+  VP   +D++     +HQG+AL+  P        LL+  LD      LL+ LD+++
Sbjct: 114 IPILEVPRTDLDRMTANH-LHQGIALQVPPYNYAHPDDLLAAALDT--PPALLVALDNIS 170

Query: 143 DPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKM 202
           DP N+GAI+RS  AF   G++  +R S S +AV  ++++GA   +P  R +NLT AL+  
Sbjct: 171 DPRNLGAIVRSVAAFGGHGVLIPQRRSASVTAVAWRTSAGAAARMPVARATNLTRALKDW 230

Query: 203 HSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKA 262
              G + +GL +     ++    +D I +++G+EGKGL    ++T   +  + M G  ++
Sbjct: 231 ADRGVRVVGLDAGGDTAIDDLDGSDPIVVVVGSEGKGLSRLVRQTCDEVVSVPMAGPTES 290

Query: 263 LNVSNAAAVAL 273
           LN S AA V L
Sbjct: 291 LNASVAAGVVL 301


>gi|258620525|ref|ZP_05715563.1| RNA methyltransferase [Vibrio mimicus VM573]
 gi|258625738|ref|ZP_05720617.1| RNA methyltransferase [Vibrio mimicus VM603]
 gi|261211153|ref|ZP_05925442.1| 23S rRNA (guanosine-2'-O-) -methyltransferase RlmB [Vibrio sp.
           RC341]
 gi|262166619|ref|ZP_06034356.1| 23S rRNA (guanosine-2'-O-) -methyltransferase RlmB [Vibrio mimicus
           VM223]
 gi|262170465|ref|ZP_06038143.1| 23S rRNA (guanosine-2'-O-) -methyltransferase RlmB [Vibrio mimicus
           MB-451]
 gi|262401885|ref|ZP_06078450.1| 23S rRNA (guanosine-2'-O-) -methyltransferase RlmB [Vibrio sp.
           RC586]
 gi|258581976|gb|EEW06846.1| RNA methyltransferase [Vibrio mimicus VM603]
 gi|258587404|gb|EEW12115.1| RNA methyltransferase [Vibrio mimicus VM573]
 gi|260839654|gb|EEX66265.1| 23S rRNA (guanosine-2'-O-) -methyltransferase RlmB [Vibrio sp.
           RC341]
 gi|261891541|gb|EEY37527.1| 23S rRNA (guanosine-2'-O-) -methyltransferase RlmB [Vibrio mimicus
           MB-451]
 gi|262026335|gb|EEY45003.1| 23S rRNA (guanosine-2'-O-) -methyltransferase RlmB [Vibrio mimicus
           VM223]
 gi|262351857|gb|EEZ00988.1| 23S rRNA (guanosine-2'-O-) -methyltransferase RlmB [Vibrio sp.
           RC586]
          Length = 246

 Score =  108 bits (270), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 76/244 (31%), Positives = 120/244 (49%), Gaps = 26/244 (10%)

Query: 48  NLFLYGVHTVSAALN-NPSRKIF----------QLLATKNALARLDWDANLPHPFPVKTV 96
           N  +YG+H V+A L  +P+R +           +LL   N L RL           ++ +
Sbjct: 3   NELIYGIHAVNAVLQRDPARFVEAYVLKGRQDDRLLPVLNELMRLG--------VSIQEM 54

Query: 97  PPQTIDKIVGKEAVHQGLALETAP---LLSPTLD---AVRNSQLLMVLDHVNDPHNIGAI 150
             + +D    + A HQGL     P   L    LD   A     LL+VLD V DPHN+GA 
Sbjct: 55  SRKALDD-KAEGANHQGLIARVKPARQLNENDLDDILAQHEQPLLLVLDGVTDPHNLGAC 113

Query: 151 LRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTI 210
           LR+A A     +I  K  S   +A ++K A GA E +P +R++NL   ++ +   G   +
Sbjct: 114 LRNADAAGVAAVIVPKDKSAPMTATVSKVACGAAETVPLVRVTNLARTMRALQEKGVWFV 173

Query: 211 GLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAA 270
           G + ++   + Q      +A+++GAEG G+R  T+ET   +  + M G + +LNVS A  
Sbjct: 174 GTAGEATHDIYQSKLTGPLAIVMGAEGDGMRRLTRETCDGLIKIPMAGSVSSLNVSVACG 233

Query: 271 VALY 274
           + L+
Sbjct: 234 ICLF 237


>gi|242238241|ref|YP_002986422.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Dickeya dadantii
           Ech703]
 gi|242130298|gb|ACS84600.1| RNA methyltransferase, TrmH family, group 3 [Dickeya dadantii
           Ech703]
          Length = 244

 Score =  108 bits (270), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 75/234 (32%), Positives = 112/234 (47%), Gaps = 10/234 (4%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLATKNALAR--LDWDANLPHP-FPVKTVPPQTIDKIVG 106
            +YG+H V A L    ++  ++   K    R  L   A L      VK    Q +D+   
Sbjct: 4   IIYGIHAVKALLERDPQRFLEVFTLKGREDRRLLPLIAELEATGIAVKVANRQWLDE-KA 62

Query: 107 KEAVHQGLALETAPLLS------PTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCD 160
           + AVHQG+               P L   R++  L+VLD V DPHN+GA LRSA A    
Sbjct: 63  EGAVHQGIIARVREGRQYQENDLPGLLETRDTPFLLVLDGVTDPHNLGACLRSADAAGVH 122

Query: 161 GIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPL 220
            +I  +  S   +A   K A GA E +P IR++NL   L+ +       +G + ++   L
Sbjct: 123 AVIVPRDRSAQLNATAKKVACGAAESVPLIRVTNLARTLRFLQERNVWIVGTAGEADHTL 182

Query: 221 EQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
            Q      +AL++GAEG+G+R  T+E    +  + M G + +LNVS A  V L+
Sbjct: 183 YQSKLTGPLALVMGAEGEGMRRLTREHCDELISIPMAGSVSSLNVSVATGVCLF 236


>gi|149192027|ref|ZP_01870254.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Vibrio shilonii AK1]
 gi|148834128|gb|EDL51138.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Vibrio shilonii AK1]
          Length = 245

 Score =  108 bits (270), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 73/244 (29%), Positives = 124/244 (50%), Gaps = 26/244 (10%)

Query: 48  NLFLYGVHTVSAALN-NPSRKIF----------QLLATKNALARLDWDANLPHPFPVKTV 96
           N F+YG+H V A L  +P R I           +L+   N L ++           ++ +
Sbjct: 3   NEFIYGIHAVKAVLERDPVRFIEAYVLKGRQDERLMPVLNELTQIG--------VSIQQM 54

Query: 97  PPQTIDKIVGKEAVHQGLALETAP---LLSPTLDAVRNSQ---LLMVLDHVNDPHNIGAI 150
             +T+D    + A HQG+  +  P   L    LD++ +     LL++LD V DPHN+GA 
Sbjct: 55  NRKTLDD-KARGANHQGIIAKVKPAKQLNENDLDSILSQHAQPLLLILDGVTDPHNLGAC 113

Query: 151 LRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTI 210
           LR+A A     +I  K  S   +A ++K A GA E +P +R++NL   ++ +   G    
Sbjct: 114 LRNADAAGVAAVIVPKDRSAPLTATVSKVACGAAETVPLVRVTNLARTMRSLQEQGIWIA 173

Query: 211 GLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAA 270
           G + ++   + Q   +  +A+++GAEG G+R  T+ET   +  + M G + +LNVS A+ 
Sbjct: 174 GTAGEATHDIYQAKLDGPLAIVMGAEGDGMRRLTRETCDDLIKIPMAGSVSSLNVSVASG 233

Query: 271 VALY 274
           + L+
Sbjct: 234 ICLF 237


>gi|150010995|gb|ABR57153.1| SpoU rRNA methylase family protein [Staphylococcus xylosus]
          Length = 249

 Score =  108 bits (270), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 67/238 (28%), Positives = 126/238 (52%), Gaps = 13/238 (5%)

Query: 47  ENLFLYGVHTVSAAL---NNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDK 103
           E + + G H V  A+   +  ++ + Q    K  +  +   AN      V++VP   ID 
Sbjct: 2   EEIVIVGRHAVKEAIVSGHTINKILIQDTIKKGQINEILKKAN-SRKIIVQSVPKSKIDG 60

Query: 104 IVGKEAVHQGLALETAPLLSPTLDAVRNSQ-------LLMVLDHVNDPHNIGAILRSAVA 156
           +   ++ HQG+A   AP      DA    Q        +++LD + DPHN+G+ILR+A A
Sbjct: 61  L--SDSPHQGIAAYIAPYEYADFDAFLEKQKAQDKLSTVLILDGLEDPHNLGSILRTADA 118

Query: 157 FSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDS 216
              DG+I  KR S + +  +AK+++GA+EHIP +R++NL + ++ +   G+  +G  +++
Sbjct: 119 SGVDGVIIPKRRSVALTQTVAKASTGAIEHIPVMRVTNLANTIETLKDNGYWVVGTEANN 178

Query: 217 KKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
                +      +A+++G+EG+G+    ++      ++ M G + +LN S AA++ +Y
Sbjct: 179 STDYREMDVAMPLAIVIGSEGQGMSRLVKDKCDFYINIPMVGHVNSLNASVAASLMMY 236


>gi|91775978|ref|YP_545734.1| RNA methyltransferase TrmH, group 3 [Methylobacillus flagellatus
           KT]
 gi|91709965|gb|ABE49893.1| 23S rRNA Gm-2251 2'-O-methyltransferase [Methylobacillus
           flagellatus KT]
          Length = 251

 Score =  108 bits (270), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 72/235 (30%), Positives = 117/235 (49%), Gaps = 10/235 (4%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLATKNAL-ARLDWDANLPHPFPVKT--VPPQTIDKIVG 106
            L+G H V + L   +  + ++L  ++ + AR+     +     V+   V    +D + G
Sbjct: 6   ILFGFHAVLSRLRQHAASVQEVLVDQDRVDARMKDLLQMAEGANVRVMHVERARLDGMAG 65

Query: 107 KEAVHQGLALETAPLLSPTLDA-------VRNSQLLMVLDHVNDPHNIGAILRSAVAFSC 159
             A HQG+         P  D        ++     +VLD V DPHN+GA LR A A   
Sbjct: 66  GNARHQGVIARVVDTPIPYKDIHDILESDLKEPPFFLVLDGVEDPHNLGACLRVADAMGV 125

Query: 160 DGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKP 219
             +I  K  +   +A + K A GA E +P+I ++NL   L+++   G   +G ++++   
Sbjct: 126 HAVIAPKDRAAGLNATVRKVACGAAETVPFIAVTNLARTLRELKDAGVFIVGAAAEADAD 185

Query: 220 LEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
           L     +  +AL+LGAEG GLR  TQET  S+  + M G +++LNVS A+ + LY
Sbjct: 186 LPSTNLSGPLALVLGAEGSGLRRLTQETCDSLISIPMFGSVESLNVSVASGICLY 240


>gi|325577249|ref|ZP_08147733.1| 23S rRNA (guanosine-2'-O-)-methyltransferase RlmB [Haemophilus
           parainfluenzae ATCC 33392]
 gi|325160831|gb|EGC72952.1| 23S rRNA (guanosine-2'-O-)-methyltransferase RlmB [Haemophilus
           parainfluenzae ATCC 33392]
          Length = 246

 Score =  108 bits (270), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 79/237 (33%), Positives = 121/237 (51%), Gaps = 17/237 (7%)

Query: 51  LYGVHTVSAAL-NNPSRKIFQLLATKNALARLDWDANLPHPF--PVKTVPPQTIDKIVGK 107
           +YG+H V++ L N+P R I   +       RL    N  +     V+ V  QT+DK    
Sbjct: 5   IYGIHAVNSILANSPERLIEVFVLKGREDKRLQPLLNELYALGIAVQFVTRQTLDKKSNG 64

Query: 108 EAVHQGL---ALETAPLLSPTLDAV---RNSQLLMVLDHVNDPHNIGAILRSAVAFSCDG 161
           E VHQG+     E   L    LD +   + + LL+VLD V DPHN+GA LR+A A     
Sbjct: 65  E-VHQGVIARVQEAKELNEHDLDELLTRKQNPLLLVLDGVTDPHNLGACLRTADAAGVSA 123

Query: 162 IITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHS----WGFQTIGLSSDSK 217
           +I  K  S   +++  K A GA E +P IR++NL   L+ +      W    +G + ++ 
Sbjct: 124 VIVPKDKSAQLTSIARKVACGAAETVPLIRVTNLARTLRDLQQNHNIW---VVGTAGEAT 180

Query: 218 KPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
           + + Q      +AL++GAEG+G+R  T+E    +  + M G + +LNVS A  V L+
Sbjct: 181 ETIYQTKLTGSLALVMGAEGEGMRRLTREHCDQLISIPMAGSVSSLNVSVATGVCLF 237


>gi|121728986|ref|ZP_01681989.1| RNA methyltransferase, TrmH family [Vibrio cholerae V52]
 gi|147673348|ref|YP_001218092.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Vibrio cholerae O395]
 gi|153214903|ref|ZP_01949701.1| RNA methyltransferase, TrmH family [Vibrio cholerae 1587]
 gi|153803651|ref|ZP_01958237.1| RNA methyltransferase, TrmH family [Vibrio cholerae MZO-3]
 gi|229513521|ref|ZP_04402985.1| 23S rRNA (guanosine-2'-O-) -methyltransferase RlmB [Vibrio cholerae
           TMA 21]
 gi|229521664|ref|ZP_04411082.1| 23S rRNA (guanosine-2'-O-) -methyltransferase RlmB [Vibrio cholerae
           TM 11079-80]
 gi|229524579|ref|ZP_04413984.1| 23S rRNA (guanosine-2'-O-) -methyltransferase RlmB [Vibrio cholerae
           bv. albensis VL426]
 gi|229527472|ref|ZP_04416864.1| 23S rRNA (guanosine-2'-O-) -methyltransferase RlmB [Vibrio cholerae
           12129(1)]
 gi|262170151|ref|ZP_06037840.1| 23S rRNA (guanosine-2'-O-) -methyltransferase RlmB [Vibrio cholerae
           RC27]
 gi|121628709|gb|EAX61177.1| RNA methyltransferase, TrmH family [Vibrio cholerae V52]
 gi|124115062|gb|EAY33882.1| RNA methyltransferase, TrmH family [Vibrio cholerae 1587]
 gi|124120810|gb|EAY39553.1| RNA methyltransferase, TrmH family [Vibrio cholerae MZO-3]
 gi|146315231|gb|ABQ19770.1| RNA methyltransferase, TrmH family [Vibrio cholerae O395]
 gi|227014487|gb|ACP10697.1| RNA methyltransferase, TrmH family [Vibrio cholerae O395]
 gi|229335104|gb|EEO00589.1| 23S rRNA (guanosine-2'-O-) -methyltransferase RlmB [Vibrio cholerae
           12129(1)]
 gi|229338160|gb|EEO03177.1| 23S rRNA (guanosine-2'-O-) -methyltransferase RlmB [Vibrio cholerae
           bv. albensis VL426]
 gi|229341258|gb|EEO06262.1| 23S rRNA (guanosine-2'-O-) -methyltransferase RlmB [Vibrio cholerae
           TM 11079-80]
 gi|229349398|gb|EEO14354.1| 23S rRNA (guanosine-2'-O-) -methyltransferase RlmB [Vibrio cholerae
           TMA 21]
 gi|262021559|gb|EEY40271.1| 23S rRNA (guanosine-2'-O-) -methyltransferase RlmB [Vibrio cholerae
           RC27]
 gi|327485080|gb|AEA79487.1| 23S rRNA (guanosine-2'-O-) -methyltransferase rlmB [Vibrio cholerae
           LMA3894-4]
          Length = 247

 Score =  108 bits (270), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 77/244 (31%), Positives = 120/244 (49%), Gaps = 26/244 (10%)

Query: 48  NLFLYGVHTVSAALN-NPSRKIF----------QLLATKNALARLDWDANLPHPFPVKTV 96
           N  +YG+H V+A L  +P+R +           +LL   N L RL           ++ +
Sbjct: 3   NELIYGIHAVNAVLQRDPARFVEAYVLKGRQDDRLLPVLNELMRLG--------VSIQEM 54

Query: 97  PPQTIDKIVGKEAVHQGLALETAP---LLSPTLD---AVRNSQLLMVLDHVNDPHNIGAI 150
             + +D    + A HQGL     P   L    LD   A     LL+VLD V DPHN+GA 
Sbjct: 55  SRKALDD-KAEGANHQGLIARVKPARQLNENDLDDILAQHEQPLLLVLDGVTDPHNLGAC 113

Query: 151 LRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTI 210
           LR+A A     +I  K  S   +A ++K A GA E +P +R++NL   ++ +   G   +
Sbjct: 114 LRNADAAGVAAVIVPKDKSAPLTATVSKVACGAAETVPLVRVTNLARTMRALQEKGVWFV 173

Query: 211 GLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAA 270
           G + ++   + Q      +A+++GAEG G+R  T+ET   +  + M G + +LNVS A  
Sbjct: 174 GTAGEATHDIYQSKLTGPLAIVMGAEGDGMRRLTRETCDDLIKIPMAGSVSSLNVSVACG 233

Query: 271 VALY 274
           V L+
Sbjct: 234 VCLF 237


>gi|218441056|ref|YP_002379385.1| RNA methyltransferase, TrmH family, group 3 [Cyanothece sp. PCC
           7424]
 gi|218173784|gb|ACK72517.1| RNA methyltransferase, TrmH family, group 3 [Cyanothece sp. PCC
           7424]
          Length = 310

 Score =  108 bits (270), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 69/239 (28%), Positives = 123/239 (51%), Gaps = 19/239 (7%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKI----- 104
            +YG H V AAL    R+I ++      + +L +D+               ID++     
Sbjct: 51  LIYGRHPVIAALEG-DRQINKIWV----MPKLRYDSRFHSLLTQAKANGTVIDEVDPHRL 105

Query: 105 --VGKEAVHQGLALETAPLLSPTLD-------AVRNSQLLMVLDHVNDPHNIGAILRSAV 155
             + K A HQG+  + +P     L+       A  ++ ++++ D + DPHN+GA++R+  
Sbjct: 106 SQITKGANHQGIVAQISPYAYVELEELIEQAKARSSAPVILIADGITDPHNLGAMIRTTE 165

Query: 156 AFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSD 215
           A    G++  +R +   ++ + K A+GALEH+P  R+ NL+ AL+++   GF   G  +D
Sbjct: 166 AMGAQGLVIPQRRAAGITSTVMKVAAGALEHLPVARVVNLSRALEQLKEAGFWLYGTMAD 225

Query: 216 SKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
           S K L        + L++G+EG+GL   TQ++  ++  + + G   +LN S A A+ALY
Sbjct: 226 SGKLLHTIDFKGAVGLVVGSEGEGLSLLTQKSCDALVSIPLAGKTPSLNASVATAIALY 284


>gi|78212686|ref|YP_381465.1| RNA methyltransferase TrmH, group 3 [Synechococcus sp. CC9605]
 gi|78197145|gb|ABB34910.1| RNA methyltransferase TrmH, group 3 [Synechococcus sp. CC9605]
          Length = 542

 Score =  108 bits (270), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 84/289 (29%), Positives = 141/289 (48%), Gaps = 30/289 (10%)

Query: 13  FSLKDSHYAKLRRNHRDYKKMQSFNQKSR-HTSQPENL---------------FLYGVHT 56
           F  ++  Y   RR+  D ++  S   +SR   ++P+                  ++G H 
Sbjct: 169 FRDRNDRYGDRRRSG-DERRQPSQRSRSRFDEARPQRPDAAPEAAAATPPADDLIWGRHA 227

Query: 57  VSAAL--NNPSRKIFQLLATKNA--LARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQ 112
             AAL    P  +I+     ++A    +L  DA       V+ V    + +I G  +VHQ
Sbjct: 228 TQAALEAGRPIHRIWCTAEMRSASKFLQLLRDAKASGVL-VEEVTWARLGQITGG-SVHQ 285

Query: 113 GLALETAPLLSPTLDAV-------RNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITT 165
           G+AL+TA   +  LD++           LL+ LD V DPHN+GA++RSA A    G++  
Sbjct: 286 GIALQTAAAETLDLDSLIEGCSDLGEPPLLVALDGVTDPHNLGAVVRSAEAMGAHGVVIP 345

Query: 166 KRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIK 225
           +R S   +   AK A+GALEH+P  R+ NL  +L+K+   G++ +GL+++    L     
Sbjct: 346 QRRSAGLTGSAAKVAAGALEHLPVARVVNLNRSLEKLKDAGYRVVGLAAEGDVTLTDVDL 405

Query: 226 NDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
           +  + L+ G+E +GL   T+     +  + + GI  +LN S A A+ +Y
Sbjct: 406 SGPMVLVTGSEDQGLSLMTRRHCDQLVRIPLRGITPSLNASVATALCVY 454


>gi|77163754|ref|YP_342279.1| RNA methyltransferase TrmH, group 3 [Nitrosococcus oceani ATCC
           19707]
 gi|76882068|gb|ABA56749.1| 23S rRNA Gm-2251 2'-O-methyltransferase [Nitrosococcus oceani ATCC
           19707]
          Length = 274

 Score =  108 bits (270), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 82/244 (33%), Positives = 122/244 (50%), Gaps = 22/244 (9%)

Query: 52  YGVHTVSAALNNPSRKIFQLLATK-------NALARLDWDANLPHPFPVKTVPPQTIDKI 104
           YG+H V AAL  P+ ++  L   +         LA+L +   L      + V  + +D +
Sbjct: 31  YGLHAVRAALEQPALQVMALWLDQARIDRSLQKLAKLAFQRGLK----AQLVKREELDDL 86

Query: 105 VGKEAVHQGL--------ALETAPLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVA 156
           V   A HQG+        AL    LL+  L+ +    LL++LD V DPHN+GA LR+A A
Sbjct: 87  V-PGARHQGVVARCSVQPALTEEGLLT-FLENLEAPPLLLLLDGVQDPHNLGACLRTAEA 144

Query: 157 FSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIG-LSSD 215
               G++T K  +   +AV  K ASGA E IP +R++NL   ++ +   G   +G +   
Sbjct: 145 AGVHGVVTPKDRAAGLTAVARKVASGAAERIPLVRVTNLARVMRALRERGLWLVGTVVGG 204

Query: 216 SKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYI 275
           S   L +      + L+LGAE +GLR  TQE    +  + M G + +LNVS AA V L+ 
Sbjct: 205 SHNSLYETDLQGPLGLVLGAEDRGLRRLTQEHCDCLVQIPMQGAVGSLNVSVAAGVCLFE 264

Query: 276 TQNH 279
            Q  
Sbjct: 265 AQRQ 268


>gi|238750079|ref|ZP_04611582.1| 23S rRNA (guanosine-2'-O-)-methyltransferase rlmB [Yersinia rohdei
           ATCC 43380]
 gi|238711623|gb|EEQ03838.1| 23S rRNA (guanosine-2'-O-)-methyltransferase rlmB [Yersinia rohdei
           ATCC 43380]
          Length = 246

 Score =  108 bits (270), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 73/239 (30%), Positives = 116/239 (48%), Gaps = 20/239 (8%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLATKN--------ALARLDWDANLPHPFPVKTVPPQTI 101
            +YG+H+V A L+N  ++  ++   K          +A L+          V+    Q +
Sbjct: 4   IIYGIHSVKALLDNDPQRFLEVFILKGRDDRRLQPLIAELE-----AAGLVVQVASRQWL 58

Query: 102 DKIVGKEAVHQGLALETAPLLS------PTLDAVRNSQLLMVLDHVNDPHNIGAILRSAV 155
           D  V +  VHQG+               P L A   +  L+VLD V DPHN+GA LRSA 
Sbjct: 59  DSQV-EGGVHQGIVARVREGRQYQENDLPALLASVETPFLLVLDGVTDPHNLGACLRSAD 117

Query: 156 AFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSD 215
           A     +I  +  S   +A+  K ASGA E++P I+++NL   L+ +       +G + +
Sbjct: 118 AAGVHAVIVPRDRSAQLNAIAKKVASGAAENVPLIKVTNLARTLRVLQENNVWIVGTAGE 177

Query: 216 SKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
           +   L Q      +AL++GAEG+G+R  T+E    +  + M G + +LNVS A  V L+
Sbjct: 178 ADHTLYQSKMTGPMALVMGAEGEGMRRLTREHCDELISIPMAGSVSSLNVSVATGVCLF 236


>gi|284006633|emb|CBA71894.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Arsenophonus
           nasoniae]
          Length = 244

 Score =  108 bits (270), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 79/240 (32%), Positives = 120/240 (50%), Gaps = 23/240 (9%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLP--HPFP-----VKTVPPQTID 102
            +YG+H V A L     ++ Q+   K    R D    LP  H        ++    Q +D
Sbjct: 4   IIYGIHAVRALLERDPLRLKQVYILKG---RED-KRLLPIIHQLEKLGIIIQLANRQWMD 59

Query: 103 KIVGKEAVHQGLALETAP---LLSPTLDAVRN---SQLLMVLDHVNDPHNIGAILRSAVA 156
           +   + AVHQG+  E  P        LD + +   S  L++LD + DPHN+GA LRSA A
Sbjct: 60  RQT-ENAVHQGIIAEVKPGRQYQESDLDIIISQVPSPFLLILDGITDPHNLGACLRSAEA 118

Query: 157 FSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKM--HSWGFQTIGLSS 214
              D +I  K  S   +A   K A GA E +P IR++NL   L+++  H W    +G + 
Sbjct: 119 AGIDAVIVPKDKSAQLNATAKKVACGAAESVPLIRVTNLARTLRQLQQHIW---IVGTAG 175

Query: 215 DSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
           ++   L +      IAL++GAEG+G+R  T+E    +  + M G++ +LNVS A  V L+
Sbjct: 176 EANHTLYESKLTGAIALVMGAEGEGMRRLTREHCDELISIPMAGVVSSLNVSVATGVCLF 235


>gi|269961411|ref|ZP_06175775.1| RNA methyltransferase [Vibrio harveyi 1DA3]
 gi|269833788|gb|EEZ87883.1| RNA methyltransferase [Vibrio harveyi 1DA3]
          Length = 247

 Score =  108 bits (270), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 79/241 (32%), Positives = 122/241 (50%), Gaps = 20/241 (8%)

Query: 48  NLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLP--HPFPVKTVPPQTI---- 101
           N F+YG+H V A L     +  +    K    R D D  +P  +   V  V  Q +    
Sbjct: 3   NEFIYGIHAVKAVLEREPERFIEAYVLK---GRQD-DRLMPILNDLQVCGVSIQQMTRKT 58

Query: 102 --DKIVGKEAVHQGLA--LETAPLLSPT-LDAV---RNSQLLMVLDHVNDPHNIGAILRS 153
             DK  G  A HQG+   ++ A  L+   +D +     S LL+VLD V DPHN+GA LR+
Sbjct: 59  LDDKAHG--ANHQGIIARVKAAKQLNENDIDGILAQHESPLLLVLDGVTDPHNLGACLRN 116

Query: 154 AVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLS 213
           A A     II  K  S   +A ++K A GA E +P IR++NL   ++ +   G   +G +
Sbjct: 117 ADAAGVAAIIVPKDRSAPMNATVSKVACGAAEVVPLIRVTNLARTMRTLQEQGIWFVGTA 176

Query: 214 SDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVAL 273
            ++   + Q      +A+++GAEG G+R  T+ET   +  + M G + +LNVS A+ + L
Sbjct: 177 GEATHDIYQAKLTGPLAIVMGAEGDGMRRLTRETCDDLIKIPMAGSVSSLNVSVASGICL 236

Query: 274 Y 274
           +
Sbjct: 237 F 237


>gi|156932411|ref|YP_001436327.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Cronobacter sakazakii
           ATCC BAA-894]
 gi|156530665|gb|ABU75491.1| hypothetical protein ESA_00190 [Cronobacter sakazakii ATCC BAA-894]
          Length = 243

 Score =  108 bits (270), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 77/238 (32%), Positives = 114/238 (47%), Gaps = 18/238 (7%)

Query: 50  FLYGVHTVSAALNN-PSR--KIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVG 106
            +YG+H V A L   P R  ++F L   ++   RL     L H    + VP Q  ++   
Sbjct: 4   MIYGIHAVQALLERAPERFQEVFILKGREDK--RL---LPLIHALEAQGVPVQVANRQWL 58

Query: 107 KE----AVHQGLALETAPLLS------PTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVA 156
            E    AVHQG+     P         P L A      L++LD V DPHN+GA LRSA A
Sbjct: 59  DEKADGAVHQGIVARVKPGRQYGENDLPDLLAAHAQPFLLILDGVTDPHNLGACLRSADA 118

Query: 157 FSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDS 216
                +I  K  S   +A   K A GA E +P IR++NL   ++ +       +G + ++
Sbjct: 119 AGVHAVIVPKDRSAQLNATAKKVACGAAESVPLIRVTNLARTMRLLQEENVWIVGTAGEA 178

Query: 217 KKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
              L Q      +AL++GAEG+G+R  T+E    +  + M G + +LNVS A  + L+
Sbjct: 179 DHTLYQSKMTGPLALVMGAEGEGMRRLTREHCDELISIPMAGSVSSLNVSVATGICLF 236


>gi|238755910|ref|ZP_04617238.1| 23S rRNA (guanosine-2'-O-)-methyltransferase rlmB [Yersinia ruckeri
           ATCC 29473]
 gi|238705869|gb|EEP98258.1| 23S rRNA (guanosine-2'-O-)-methyltransferase rlmB [Yersinia ruckeri
           ATCC 29473]
          Length = 248

 Score =  108 bits (270), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 74/239 (30%), Positives = 113/239 (47%), Gaps = 20/239 (8%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLATKN--------ALARLDWDANLPHPFPVKTVPPQTI 101
            +YG+H V A L    ++  ++   K          +A L+          V+    Q +
Sbjct: 4   IIYGIHAVKALLERDPQRFLEVFILKGRDDRRLQPVVAELEATG-----LVVQVASRQWL 58

Query: 102 DKIVGKEAVHQGLALETAPLLS------PTLDAVRNSQLLMVLDHVNDPHNIGAILRSAV 155
           D  V +  VHQG+               P L A   S  L+VLD V DPHN+GA LRSA 
Sbjct: 59  DSQV-EGGVHQGIVARVREGRQYQENDLPGLLASVESPFLLVLDGVTDPHNLGACLRSAD 117

Query: 156 AFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSD 215
           A     +I  +  S   +A+  K ASGA E++P IR++NL   L+ +       +G + +
Sbjct: 118 AAGVHAVIVPRDRSAQLNAIAKKVASGAAENVPLIRVTNLARTLRVLQENNVWIVGTAGE 177

Query: 216 SKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
           +   L Q      +AL++GAEG+G+R  T+E    +  + M G + +LNVS A  V L+
Sbjct: 178 ADHTLYQSKMTGPMALVMGAEGEGMRRLTREHCDELISIPMAGTVSSLNVSVATGVCLF 236


>gi|154508505|ref|ZP_02044147.1| hypothetical protein ACTODO_01006 [Actinomyces odontolyticus ATCC
           17982]
 gi|153798139|gb|EDN80559.1| hypothetical protein ACTODO_01006 [Actinomyces odontolyticus ATCC
           17982]
          Length = 325

 Score =  108 bits (270), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 79/272 (29%), Positives = 135/272 (49%), Gaps = 19/272 (6%)

Query: 18  SHYAKLRRNHRDYKK--MQSFNQKSRHTSQPENLFLYGVHTVSAALNN--PSRKIFQLLA 73
           +H  K++R  R+ ++  +     KS    +P +  + G + V+ A     P  ++F L  
Sbjct: 49  AHKRKVKREAREAQEAAIARARAKSSIRVKPGHELIAGRNPVAEAARASVPIERVFVLDN 108

Query: 74  TKNALARLDWDANLPHPF--PVKTVPPQTIDKIVGKEAVHQGLALET--------APLLS 123
            K+   R++    L      PV  V  + +D +    AVHQG+A+E         + L++
Sbjct: 109 VKDD--RVEEVVRLASAMGAPVYEVTRRDLD-VATDGAVHQGVAIEVRGYEYADASDLIA 165

Query: 124 PTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGA 183
            +L  +    LL+ LD V DPHN+GA+LRSA AF  DG+I  +R S   +    K ++GA
Sbjct: 166 GSLQQL-GHPLLVALDQVTDPHNLGAVLRSAGAFGADGVIIPERRSAGVNTTAWKVSAGA 224

Query: 184 LEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQ-EIKNDKIALILGAEGKGLRP 242
              +P  R++NL  AL++    G+  +GL      PL    + +  + ++ GAEG GL  
Sbjct: 225 AARVPVARVTNLVRALEEAKQAGYFVVGLDGGGDAPLRGLSLADGPLVVVTGAEGAGLSR 284

Query: 243 KTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
             +ET   +  + +   +++LN + A  +ALY
Sbjct: 285 LVRETCDQIVSIPIASTVESLNAAVATGIALY 316


>gi|317969745|ref|ZP_07971135.1| tRNA/rRNA methyltransferase (SpoU):RNA methyltransferase TrmH
           [Synechococcus sp. CB0205]
          Length = 406

 Score =  108 bits (270), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 61/173 (35%), Positives = 96/173 (55%), Gaps = 7/173 (4%)

Query: 109 AVHQGLALETAPL----LSPTLDAVRN---SQLLMVLDHVNDPHNIGAILRSAVAFSCDG 161
           AVHQG+ ++ A      L   +D  R+     LLM LD + DPHN+GAI+RSA A    G
Sbjct: 134 AVHQGIVMQAAAADTLDLGTLIDGCRDLGEPPLLMALDGITDPHNLGAIVRSAEALGAHG 193

Query: 162 IITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLE 221
           ++  +R S   +  +AK A+GALEH+P  R+ NL  AL  + + G++ IGL+ +    L 
Sbjct: 194 LVLPQRRSAGLTGSVAKVAAGALEHLPVARVVNLNRALDSLKNEGYRVIGLAGEGSVALS 253

Query: 222 QEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
           +   +  + ++ G+EG GL   T++    +  + + G   +LN S A A+ LY
Sbjct: 254 EADLDGPLVVVTGSEGDGLSMLTRKHCDQLVRIPIRGATPSLNASVATAMVLY 306


>gi|117927294|ref|YP_871845.1| RNA methyltransferase [Acidothermus cellulolyticus 11B]
 gi|117647757|gb|ABK51859.1| RNA methyltransferase, TrmH family, group 3 [Acidothermus
           cellulolyticus 11B]
          Length = 250

 Score =  108 bits (270), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 59/198 (29%), Positives = 104/198 (52%), Gaps = 11/198 (5%)

Query: 93  VKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAV------RNSQLLMVLDHVNDPHN 146
           ++ V  + +D++ G    HQG+ +   P        +      R   LL+ +D V DP N
Sbjct: 54  IRVVARRELDRLTGTG--HQGVVVVVPPFTYADEREIVDRAFERAPHLLLAVDGVTDPRN 111

Query: 147 IGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWG 206
           +GAI+RSA AF   G++  KR +   +  + K+++GAL  +P  R++N+   L  +    
Sbjct: 112 LGAIVRSAAAFGASGVLLPKRRAAGVTPAVWKASAGALARMPLARVTNMARVLVALAERN 171

Query: 207 FQTIGLSSDSKKPLEQ---EIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKAL 263
              +GLS+D    ++Q   +     +AL++GAEG+GL    +E  T +A + M G +++L
Sbjct: 172 VTVVGLSADGDTTIQQAADDAGGGPVALVVGAEGRGLSRLVREKCTVVASIPMTGTVESL 231

Query: 264 NVSNAAAVALYITQNHFA 281
           NVS A  +AL++     +
Sbjct: 232 NVSVATGIALFVLSQRLS 249


>gi|88810597|ref|ZP_01125854.1| RNA methyltransferase, TrmH family, group 3 [Nitrococcus mobilis
           Nb-231]
 gi|88792227|gb|EAR23337.1| RNA methyltransferase, TrmH family, group 3 [Nitrococcus mobilis
           Nb-231]
          Length = 256

 Score =  108 bits (270), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 73/239 (30%), Positives = 122/239 (51%), Gaps = 13/239 (5%)

Query: 47  ENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPH----PFPVKTVPPQTID 102
           +N  ++G+H+V AA+      + ++   + A +   W A          PV  V  + +D
Sbjct: 3   QNRIIHGLHSVRAAVRYDPTHVVEVWLDRQARSG-RWQALRRQLEALACPVHLVDRRQLD 61

Query: 103 KIVGKEAVHQGLALETA---PLLSPTLDAVRNS----QLLMVLDHVNDPHNIGAILRSAV 155
           ++   + VHQG+A+  A   P     L+A+ +      LL+VLD V DPHN+GA LR+A 
Sbjct: 62  RLTSGQ-VHQGVAIRYAGQPPRAEHELEALLSELGPDPLLLVLDQVQDPHNLGACLRTAA 120

Query: 156 AFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSD 215
                 +IT +  +   +  + K+A+GA++HIP  +++NL   L+K+   G   IG +  
Sbjct: 121 GAGVQAVITPRDRAVGLTPTVYKAATGAVQHIPLFQVTNLARTLRKLREAGMWLIGAAEQ 180

Query: 216 SKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
           +   L +   +  + L++GAE  GLR  T+     +  + M G I +LNVS A  V LY
Sbjct: 181 ADVTLYEVDLSGPLVLVMGAEEAGLRRLTRACCDRLIRIPMLGAIDSLNVSVATGVVLY 239


>gi|227834034|ref|YP_002835741.1| putative rRNA methylase [Corynebacterium aurimucosum ATCC 700975]
 gi|262183480|ref|ZP_06042901.1| putative rRNA methylase [Corynebacterium aurimucosum ATCC 700975]
 gi|227455050|gb|ACP33803.1| putative rRNA methylase [Corynebacterium aurimucosum ATCC 700975]
          Length = 316

 Score =  108 bits (270), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 74/279 (26%), Positives = 140/279 (50%), Gaps = 26/279 (9%)

Query: 7   KKSEKIFSLKDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNN--P 64
           K  ++++  K  H AKL R  R+           RH  +   + + G + V   L+   P
Sbjct: 40  KAEDRVYHAK--HKAKLERERRN---------SGRHDKETAEMVV-GRNPVIECLHAKVP 87

Query: 65  SRKIFQLLATKNALARLDWDANLPHP--FPVKTVPPQTIDKIVGKEAVHQGLALETAPL- 121
           +  ++ +  T+N  ARL     + +    P+  V    +D++ G   +HQG+ L+  P  
Sbjct: 88  ATSLYIVQGTRND-ARLSEAVAMCNTRNIPILEVQRHEMDRMTGN-GMHQGIGLQIPPYK 145

Query: 122 ---LSPTLDAVRNSQ---LLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAV 175
              +   +D  R++Q   + ++LD++ DP N+GA++RS  AF   G+I  +R S S +AV
Sbjct: 146 YADVHDLMDRARDAQEPGMFVILDNITDPRNLGAVIRSVAAFGGHGVIIPERRSASVTAV 205

Query: 176 LAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQ-EIKNDKIALILG 234
             ++++G    +P  R++N+T  +Q     G+Q +GL +  +  L+      D + +++G
Sbjct: 206 AWRTSAGTAARLPVARVTNVTRTVQDFQKAGYQVVGLDAGGEHTLDTYNGGTDPVVIVIG 265

Query: 235 AEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVAL 273
           +EGKG+    +E   ++  + M   +++LN S AA   L
Sbjct: 266 SEGKGISRLVRENCDAIMSIPMTDWVESLNASVAAGAVL 304


>gi|254435674|ref|ZP_05049181.1| RNA methyltransferase, TrmH family, group 3 [Nitrosococcus oceani
           AFC27]
 gi|207088785|gb|EDZ66057.1| RNA methyltransferase, TrmH family, group 3 [Nitrosococcus oceani
           AFC27]
          Length = 259

 Score =  108 bits (270), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 81/243 (33%), Positives = 120/243 (49%), Gaps = 20/243 (8%)

Query: 52  YGVHTVSAALNNPSRKIFQLLATKNALARLDWDAN------LPHPFPVKTVPPQTIDKIV 105
           YG+H V AAL  P+ ++  L   +   AR+D                 + V  + +D +V
Sbjct: 16  YGLHAVRAALEQPALQVMALWLDQ---ARIDRSLQKLAKLAFQRGLKAQLVKREELDDLV 72

Query: 106 GKEAVHQGL--------ALETAPLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAF 157
              A HQG+        AL    LL+  L+ +    LL++LD V DPHN+GA LR+A A 
Sbjct: 73  -PGARHQGVVARCSVQPALTEEGLLT-FLENLEAPPLLLLLDGVQDPHNLGACLRTAEAA 130

Query: 158 SCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIG-LSSDS 216
              G++T K  +   +AV  K ASGA E IP +R++NL   ++ +   G   +G +   S
Sbjct: 131 GVHGVVTPKDRAAGLTAVARKVASGAAERIPLVRVTNLARVMRALRERGLWLVGTVVGGS 190

Query: 217 KKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYIT 276
              L +      + L+LGAE +GLR  TQE    +  + M G + +LNVS AA V L+  
Sbjct: 191 HNSLYETDLQGPLGLVLGAEDRGLRRLTQEHCDCLVQIPMQGAVGSLNVSVAAGVCLFEA 250

Query: 277 QNH 279
           Q  
Sbjct: 251 QRQ 253


>gi|195978847|ref|YP_002124091.1| tRNA/rRNA methyltransferase [Streptococcus equi subsp.
           zooepidemicus MGCS10565]
 gi|195975552|gb|ACG63078.1| tRNA/rRNA methyltransferase [Streptococcus equi subsp.
           zooepidemicus MGCS10565]
          Length = 248

 Score =  108 bits (270), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 61/172 (35%), Positives = 99/172 (57%), Gaps = 7/172 (4%)

Query: 109 AVHQGLALETAPLLSPTLDAV------RNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGI 162
           AVHQG  L  +      LD +        + LL++LD + DPHN G+ILR+A A    G+
Sbjct: 71  AVHQGFVLRVSAFAYTELDELLELAQQEANPLLLILDGLTDPHNFGSILRTADATGVCGV 130

Query: 163 ITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQ 222
           I  K  +   + V+AK+++GA+EH+P  R++NL+ AL ++ + GF   G +  +  P  +
Sbjct: 131 IIPKHRAVGVTPVVAKTSTGAVEHVPIARVTNLSQALDQLKANGFWVFG-TDVTGTPSYK 189

Query: 223 EIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
              + K+ALI+G EGKG+    ++    M  + M G +++LN S AAA+ +Y
Sbjct: 190 WNTSGKLALIIGNEGKGISANIKKQVDEMITIPMMGHVQSLNASVAAAILMY 241


>gi|71891873|ref|YP_277602.1| tRNA/rRNA methyltransferase [Candidatus Blochmannia pennsylvanicus
           str. BPEN]
 gi|71795979|gb|AAZ40730.1| probable tRNA/rRNA methyltransferase [Candidatus Blochmannia
           pennsylvanicus str. BPEN]
          Length = 247

 Score =  108 bits (270), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 67/235 (28%), Positives = 120/235 (51%), Gaps = 11/235 (4%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLA---TKNALARLDWDANLPHPFPVKTVPPQTIDKIVG 106
            +YG+H V + L+N S +I  +     +K+   +L  D        ++    + +D I  
Sbjct: 4   LVYGIHAVKSVLDNYSHRIVSVCIIQKSKDLRLKLLIDQIKQRRISIRECSRRQLD-IQT 62

Query: 107 KEAVHQGLALETAP-------LLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSC 159
           + A+HQG+ ++  P        L   L   + + LL++LD V DPHN+GA LRSA A   
Sbjct: 63  QGALHQGIIVKIVPNDCMQENDLPNFLMQCKTTPLLVILDGVTDPHNLGACLRSADAAGA 122

Query: 160 DGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKP 219
             +I  +  S   +  + K ASG++++IP+++++NL   LQ +  +    IG    S++ 
Sbjct: 123 HIVIAPRNRSACLNGTVRKVASGSVDNIPFMQVTNLIRTLQLLQKYNIWIIGTVMQSQRL 182

Query: 220 LEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
           +        +A ++G+EG G+R  TQ+    +  + M G+  +LNVS A  + L+
Sbjct: 183 IFNSKLTRPLAFVMGSEGNGIRYLTQKKCDELVTIPMLGVATSLNVSVATGICLF 237


>gi|146319556|ref|YP_001199268.1| tRNA/rRNA methyltransferase [Streptococcus suis 05ZYH33]
 gi|146321750|ref|YP_001201461.1| tRNA/rRNA methyltransferase [Streptococcus suis 98HAH33]
 gi|253752559|ref|YP_003025700.1| SpoU rRNA methylase family protein [Streptococcus suis SC84]
 gi|253754385|ref|YP_003027526.1| SpoU rRNA methylase family protein [Streptococcus suis P1/7]
 gi|253756319|ref|YP_003029459.1| SpoU rRNA methylase family protein [Streptococcus suis BM407]
 gi|145690362|gb|ABP90868.1| tRNA/rRNA methyltransferase [Streptococcus suis 05ZYH33]
 gi|145692556|gb|ABP93061.1| tRNA/rRNA methyltransferase [Streptococcus suis 98HAH33]
 gi|251816848|emb|CAZ52495.1| SpoU rRNA methylase family protein [Streptococcus suis SC84]
 gi|251818783|emb|CAZ56623.1| SpoU rRNA methylase family protein [Streptococcus suis BM407]
 gi|251820631|emb|CAR47391.1| SpoU rRNA methylase family protein [Streptococcus suis P1/7]
 gi|292559171|gb|ADE32172.1| tRNA/rRNA methyltransferase [Streptococcus suis GZ1]
 gi|319758973|gb|ADV70915.1| tRNA/rRNA methyltransferase [Streptococcus suis JS14]
          Length = 242

 Score =  108 bits (270), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 77/242 (31%), Positives = 121/242 (50%), Gaps = 23/242 (9%)

Query: 47  ENLFLYGVHTVSAALN-NPSRKIF--QLLATKN-----ALARLDWDANLPHPFPVKTVPP 98
           +N  +YGVH V  +L  N   K++    L  KN     ALA             +   P 
Sbjct: 3   QNDIVYGVHAVVESLEANTGNKLYIQDDLRGKNVEKIKALAA-------EKKVSISWTPK 55

Query: 99  QTIDKIVGKEAVHQGLALETAPLLSPTLDAV------RNSQLLMVLDHVNDPHNIGAILR 152
           +T+  +  + AVHQG  L  +      L  +       ++ L+++LD + DPHN G+ILR
Sbjct: 56  KTLSDMT-EGAVHQGFVLRVSEFAYADLSVILEKAEQEDNPLILILDGLTDPHNFGSILR 114

Query: 153 SAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGL 212
           +A A    GII  K  +   + V+AK+++GA+ H+P  R++NL+  L K+   GF   G 
Sbjct: 115 TADATQVAGIIIPKHRAVGVTPVVAKTSTGAVAHVPIARVTNLSQTLDKLKEAGFWVFGT 174

Query: 213 SSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVA 272
             +   P  +     K+ALI+G EGKG+    ++    M  + M G +++LN S AAAV 
Sbjct: 175 DMNG-TPSHKWNTAGKLALIIGNEGKGISSNIKKQVDEMITIPMKGHVQSLNASVAAAVL 233

Query: 273 LY 274
           +Y
Sbjct: 234 MY 235


>gi|327438252|dbj|BAK14617.1| rRNA methylase [Solibacillus silvestris StLB046]
          Length = 287

 Score =  108 bits (270), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 62/189 (32%), Positives = 100/189 (52%), Gaps = 10/189 (5%)

Query: 93  VKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLD-------AVRNSQLLMVLDHVNDPH 145
           V+ VP Q +DK+      HQG+    A      LD       A       ++LD + DPH
Sbjct: 91  VQFVPKQKVDKLAEN---HQGIVASVAAYDYAELDDLFAAAKAKSEDPFFLILDELEDPH 147

Query: 146 NIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSW 205
           N+G+I+R+A A    GII  KR +   +AV+AK+++GA+EH+P +R++NL   + ++   
Sbjct: 148 NLGSIMRTADAIGAHGIIIPKRRAVGLTAVVAKASTGAIEHVPVVRVTNLAQTVDELKDR 207

Query: 206 GFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNV 265
           G    G  +       +      +ALI+G+EGKG+    ++    + HL M G + +LN 
Sbjct: 208 GVWIAGTDAKGSADYRKMDATLPLALIIGSEGKGMSRLLKDKCDFLYHLPMVGHVTSLNA 267

Query: 266 SNAAAVALY 274
           S AAA+ +Y
Sbjct: 268 SVAAALLMY 276


>gi|297581438|ref|ZP_06943361.1| RNA methyltransferase [Vibrio cholerae RC385]
 gi|297534276|gb|EFH73114.1| RNA methyltransferase [Vibrio cholerae RC385]
          Length = 247

 Score =  108 bits (270), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 77/244 (31%), Positives = 120/244 (49%), Gaps = 26/244 (10%)

Query: 48  NLFLYGVHTVSAALN-NPSRKIF----------QLLATKNALARLDWDANLPHPFPVKTV 96
           N  +YG+H V+A L  +P+R +           +LL   N L RL           ++ +
Sbjct: 3   NELIYGIHAVNAVLQRDPARFVEAYVLKGRQDDRLLPVLNELMRLG--------VSIQEM 54

Query: 97  PPQTIDKIVGKEAVHQGLALETAP---LLSPTLD---AVRNSQLLMVLDHVNDPHNIGAI 150
             + +D    + A HQGL     P   L    LD   A     LL+VLD V DPHN+GA 
Sbjct: 55  SRKALDD-KAEGANHQGLIARVKPARQLNENDLDDILAQYEQPLLLVLDGVTDPHNLGAC 113

Query: 151 LRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTI 210
           LR+A A     +I  K  S   +A ++K A GA E +P +R++NL   ++ +   G   +
Sbjct: 114 LRNADAAGVAAVIVPKDKSAPLTATVSKVACGAAETVPLVRVTNLARTMRALQEKGVWFV 173

Query: 211 GLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAA 270
           G + ++   + Q      +A+++GAEG G+R  T+ET   +  + M G + +LNVS A  
Sbjct: 174 GTAGEATHDIYQSKLTGPLAIVMGAEGDGMRRLTRETCDDLIKIPMAGSVSSLNVSVACG 233

Query: 271 VALY 274
           V L+
Sbjct: 234 VCLF 237


>gi|295692213|ref|YP_003600823.1| RNA methyltransferase, trmh family, group 3 [Lactobacillus
           crispatus ST1]
 gi|295030319|emb|CBL49798.1| RNA methyltransferase, TrmH family, group 3 [Lactobacillus
           crispatus ST1]
          Length = 251

 Score =  108 bits (270), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 71/196 (36%), Positives = 107/196 (54%), Gaps = 15/196 (7%)

Query: 93  VKTVPPQTIDKIVGKEAVHQGLAL-----ETAPL--LSPTLDAVRNSQLLMVLDHVNDPH 145
           V+ VP   +D++V     HQGL L     E A L  L    DA      L++LD + DPH
Sbjct: 54  VQDVPKNKLDRLVAG-GNHQGLVLAISSFEYADLNQLLDKYDAEGKEPFLLMLDSIEDPH 112

Query: 146 NIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNL---TDALQKM 202
           N+G+ILRSA A   DGI+  KR++   ++V+AK+++GA++++P  R++NL   T  L+K 
Sbjct: 113 NLGSILRSADATGVDGIVIPKRHATGLTSVVAKTSTGAIDYVPVARVNNLVQTTKELKKR 172

Query: 203 HSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKA 262
             W F T    +D ++   Q     K  L++G EGKG+ P  ++       L M G +++
Sbjct: 173 GYWVFGTDMAGTDYREWNAQ----GKTVLVIGNEGKGIAPLLKKQMDQTITLPMVGHVQS 228

Query: 263 LNVSNAAAVALYITQN 278
           LN S A  V LY   N
Sbjct: 229 LNASVATGVLLYQAYN 244


>gi|39938738|ref|NP_950504.1| cation transport ATPase [Onion yellows phytoplasma OY-M]
 gi|39721847|dbj|BAD04337.1| cation transport ATPase [Onion yellows phytoplasma OY-M]
          Length = 1056

 Score =  108 bits (270), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 73/235 (31%), Positives = 120/235 (51%), Gaps = 5/235 (2%)

Query: 45   QPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKI 104
            Q  N+ +YG + +  A+    RKI+QL   +     L       H    + V  + +  +
Sbjct: 818  QIINMIIYGKNPIKEAIK-AQRKIYQLYLDEKIKDHLFIMFLQKHNIAYQLVDKKFLYDL 876

Query: 105  VGKEAVHQGLALETAPLLSPTLDAVRNS---QLLMVLDHVNDPHNIGAILRSAVAFSCDG 161
              K+  HQG+A          LD   +S   Q  ++LD +NDPHN+GAILR+  A + DG
Sbjct: 877  T-KQKTHQGVAANVCDYTFYDLDTYLDSAKFQKFLILDAINDPHNLGAILRTVEACALDG 935

Query: 162  IITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLE 221
            +I +K++    ++ +AK + GALE+     ++NL   + K+       +G  S+S +   
Sbjct: 936  VIMSKKHQVPLNSTVAKISCGALEYTKVFLVTNLHQTILKLKKNQVLIVGTDSNSSQSFH 995

Query: 222  QEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYIT 276
            Q  KN  +A+I+G EG G+R   ++    +  + M G I +LNVS AAA+ +Y T
Sbjct: 996  QIPKNSSLAIIVGNEGIGIRHLLKQQCDLLVKIPMYGKINSLNVSVAAALMIYST 1050


>gi|320539669|ref|ZP_08039333.1| putative 23S rRNA (Gm2251)-methyltransferase [Serratia symbiotica
           str. Tucson]
 gi|320030281|gb|EFW12296.1| putative 23S rRNA (Gm2251)-methyltransferase [Serratia symbiotica
           str. Tucson]
          Length = 255

 Score =  108 bits (269), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 73/240 (30%), Positives = 116/240 (48%), Gaps = 22/240 (9%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLATKNA--------LARLDWDANLPHPFPVKTVPPQTI 101
            +YG+H V A L    ++  ++   K          +  L+          V+    Q +
Sbjct: 4   IIYGIHAVKALLERDPQRFLEVFIPKGRGDRRLQPLITELETTG-----LAVQVASRQWL 58

Query: 102 DKIVGKEAVHQGLALETAPLLSPT-------LDAVRNSQLLMVLDHVNDPHNIGAILRSA 154
           D+ V + AVHQG+         P        L++V ++  L+VLD V DPHN+GA LRSA
Sbjct: 59  DEKV-EGAVHQGIIARVREGRKPQENDLPALLESV-DTPFLLVLDGVTDPHNLGACLRSA 116

Query: 155 VAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSS 214
            A     +I  +  S   +A   K A GA E++P IR++NL   L+ +       +G S 
Sbjct: 117 DAAGVHAVIVPRDRSAQLNATAKKVACGASENVPLIRVTNLVRTLRLLQEMNVWVVGTSG 176

Query: 215 DSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
           ++   L Q      +AL++GAEGKG+R  T+E    +  + M G++ +LNVS A  + L+
Sbjct: 177 EADHTLYQSKMTGPMALVMGAEGKGMRRLTREHCDELISIPMAGMVSSLNVSVATGICLF 236


>gi|149019402|ref|ZP_01834764.1| TrmH family RNA methyltransferase group 3 [Streptococcus pneumoniae
           SP23-BS72]
 gi|147931272|gb|EDK82251.1| TrmH family RNA methyltransferase group 3 [Streptococcus pneumoniae
           SP23-BS72]
          Length = 169

 Score =  108 bits (269), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 56/141 (39%), Positives = 87/141 (61%), Gaps = 1/141 (0%)

Query: 134 LLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRIS 193
           LL++LD + DPHN+G+ILR+A A +  G+I  K  +   + V+AK+A+GA+EH+P  R++
Sbjct: 23  LLLILDGLTDPHNLGSILRTADATNVSGVIIPKHRAVGVTPVVAKTATGAIEHVPIARVT 82

Query: 194 NLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAH 253
           NL+  L K+   GF T G   +   P  +     KIALI+G EGKG+    ++    M  
Sbjct: 83  NLSQTLDKLKDEGFWTFGTDMNG-TPCHKWNTKGKIALIIGNEGKGISSNIKKQVDEMIT 141

Query: 254 LHMPGIIKALNVSNAAAVALY 274
           + M G +++LN S AAA+ +Y
Sbjct: 142 IPMNGHVQSLNASVAAAILMY 162


>gi|260599471|ref|YP_003212042.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Cronobacter
           turicensis z3032]
 gi|260218648|emb|CBA33967.1| 23S rRNA (guanosine-2'-O-)-methyltransferase rlmB [Cronobacter
           turicensis z3032]
          Length = 243

 Score =  108 bits (269), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 77/238 (32%), Positives = 115/238 (48%), Gaps = 18/238 (7%)

Query: 50  FLYGVHTVSAALNN-PSR--KIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVG 106
            +YG+H V A L + P R  ++F L   ++   RL     L H    + VP Q  ++   
Sbjct: 4   MIYGIHAVQALLESAPERFQEVFILKGREDK--RL---LPLIHALEAQGVPVQVANRQWL 58

Query: 107 KE----AVHQGLALETAPLLS------PTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVA 156
            E    AVHQG+     P         P L A      L++LD V DPHN+GA LRSA A
Sbjct: 59  DEKADGAVHQGIVARVKPGRQYGENDLPDLLAAHAQPFLLILDGVTDPHNLGACLRSADA 118

Query: 157 FSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDS 216
                +I  K  S   +A   K A GA E +P IR++NL   ++ +       +G + ++
Sbjct: 119 AGVHAVIVPKDRSAQLNATAKKVACGAAESVPLIRVTNLARTMRLLQEENVWIVGTAGEA 178

Query: 217 KKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
              L Q      +AL++GAEG+G+R  T+E    +  + M G + +LNVS A  + L+
Sbjct: 179 DHTLFQSKMTGPLALVMGAEGEGMRRLTREHCDELISIPMAGSVSSLNVSVATGICLF 236


>gi|84393177|ref|ZP_00991941.1| RNA methyltransferase, TrmH family [Vibrio splendidus 12B01]
 gi|84376229|gb|EAP93113.1| RNA methyltransferase, TrmH family [Vibrio splendidus 12B01]
          Length = 246

 Score =  108 bits (269), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 73/236 (30%), Positives = 121/236 (51%), Gaps = 10/236 (4%)

Query: 48  NLFLYGVHTVSAALN-NPSRKI--FQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKI 104
           N F+YG+H V A L  +P+R I  + L   ++       +        ++ +  + +D+ 
Sbjct: 3   NEFIYGIHAVKAVLEKDPARFIEAYVLKGRQDDRLLPLLNQLQQFGVSIQQMGRKPLDE- 61

Query: 105 VGKEAVHQGLALETAP---LLSPTLD---AVRNSQLLMVLDHVNDPHNIGAILRSAVAFS 158
             + A HQGL  +  P   L    LD   A     LL+VLD V DPHN+GA LR+A A  
Sbjct: 62  KAQGANHQGLIAKVKPAKQLNETHLDDILAQHEQPLLLVLDGVTDPHNLGACLRNADAAG 121

Query: 159 CDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKK 218
              +I  K  S   +A ++K A GA E +P +R++NL   ++ +   G   +G + ++  
Sbjct: 122 VAAVIVPKDRSSPLTATVSKVACGAAETVPLVRVTNLARTMRALQEQGVWFVGTAGEATH 181

Query: 219 PLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
            + Q      +A+++GAEG G+R  T+ET   +  + M G + +LNVS A+ + L+
Sbjct: 182 DIYQAKLTGPLAVVMGAEGDGMRRLTRETCDDLIKIPMSGSVSSLNVSVASGICLF 237


>gi|86148225|ref|ZP_01066522.1| RNA methyltransferase, TrmH family protein [Vibrio sp. MED222]
 gi|218708332|ref|YP_002415953.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Vibrio splendidus
           LGP32]
 gi|85833995|gb|EAQ52156.1| RNA methyltransferase, TrmH family protein [Vibrio sp. MED222]
 gi|218321351|emb|CAV17301.1| 23S rRNA (guanosine-2'-O-)-methyltransferase rlmB [Vibrio
           splendidus LGP32]
          Length = 246

 Score =  108 bits (269), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 73/236 (30%), Positives = 121/236 (51%), Gaps = 10/236 (4%)

Query: 48  NLFLYGVHTVSAALN-NPSRKI--FQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKI 104
           N F+YG+H V A L  +P+R I  + L   ++       +        ++ +  + +D+ 
Sbjct: 3   NEFIYGIHAVKAVLEKDPARFIEAYVLKGRQDDRLLPLLNQLQQFGVSIQQMGRKPLDE- 61

Query: 105 VGKEAVHQGLALETAP---LLSPTLD---AVRNSQLLMVLDHVNDPHNIGAILRSAVAFS 158
             + A HQGL  +  P   L    LD   A     LL+VLD V DPHN+GA LR+A A  
Sbjct: 62  KAQGANHQGLIAKVKPAKQLNETHLDDILAQHEQPLLLVLDGVTDPHNLGACLRNADAAG 121

Query: 159 CDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKK 218
              +I  K  S   +A ++K A GA E +P +R++NL   ++ +   G   +G + ++  
Sbjct: 122 VAAVIVPKDRSSPLTATVSKVACGAAETVPLVRVTNLARTMRALQEQGVWFVGTAGEATH 181

Query: 219 PLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
            + Q      +A+++GAEG G+R  T+ET   +  + M G + +LNVS A+ + L+
Sbjct: 182 DIYQAKLTGPLAVVMGAEGDGMRRLTRETCDDLIKIPMAGSVSSLNVSVASGICLF 237


>gi|108804991|ref|YP_644928.1| RNA methyltransferase TrmH, group 3 [Rubrobacter xylanophilus DSM
           9941]
 gi|108766234|gb|ABG05116.1| RNA methyltransferase TrmH, group 3 [Rubrobacter xylanophilus DSM
           9941]
          Length = 237

 Score =  108 bits (269), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 72/229 (31%), Positives = 118/229 (51%), Gaps = 10/229 (4%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLL-ATKN-ALARLDWDANLPHPFPVKTVPPQTIDKIVGK 107
            +YGV  V   L +  R + ++L +T N  + RL  DA +     V+ VP   + ++ G 
Sbjct: 4   VVYGVRPVIEVLRSRRRAVHEVLDSTGNREVERLAADAGVG----VRRVPRGRVARLAGG 59

Query: 108 EAVHQGLALETAPLLSPTLDAVRNSQ--LLMVLDHVNDPHNIGAILRSAVAFSCDGIITT 165
            A HQG+A    P     L+ V   +  L+ VLD V DP N+GA+LR+A   +  G++  
Sbjct: 60  GA-HQGVAARVGPYPYAALEDVLGGENPLVAVLDGVTDPRNLGAVLRAADGAAASGVVVP 118

Query: 166 KRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIK 225
           K  +   +    K+++GA EH+   R++NL  A+ +M   G          +   E ++ 
Sbjct: 119 KDRAAGVTPAAVKASAGASEHVRLARVTNLRRAVDRMKEEGLWVYAAEPGGENYAEADLS 178

Query: 226 NDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
              +AL+LG+EG+G+R   +E    +  + M G + +LNVS AAA+ LY
Sbjct: 179 G-PVALVLGSEGRGVRRLVREGCDGVLSIPMLGAVSSLNVSVAAAILLY 226


>gi|328462975|gb|EGF34783.1| putative tRNA/rRNA methyltransferase [Lactobacillus helveticus MTCC
           5463]
          Length = 250

 Score =  108 bits (269), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 65/193 (33%), Positives = 103/193 (53%), Gaps = 9/193 (4%)

Query: 93  VKTVPPQTIDKIVGKEAVHQGLALETAPL----LSPTLDAVRNSQ---LLMVLDHVNDPH 145
           ++ VP   +D++V     HQGL L  +      LS  LD   +      L++LD + DPH
Sbjct: 54  IQNVPKNKLDRLV-DGGNHQGLVLAISSFEYADLSKLLDQFDDEGKEPFLLILDSIEDPH 112

Query: 146 NIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSW 205
           N+G+ILRSA A   DGII  KR++   ++V+AK+++GA++++P  R++NL    +++   
Sbjct: 113 NLGSILRSADATGVDGIIIPKRHATGLTSVVAKTSTGAIDYVPVARVNNLVQTTKELKKR 172

Query: 206 GFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNV 265
           G+   G         E   K  K  L++G EGKG+ P  ++       L M G +++LN 
Sbjct: 173 GYWIFGTDMAGTDYREWNAKG-KTVLVIGNEGKGIAPLLKKQMDQTITLPMIGHVQSLNA 231

Query: 266 SNAAAVALYITQN 278
           S A  V LY   N
Sbjct: 232 SVATGVLLYQAYN 244


>gi|295425603|ref|ZP_06818290.1| RNA methyltransferase [Lactobacillus amylolyticus DSM 11664]
 gi|295064619|gb|EFG55540.1| RNA methyltransferase [Lactobacillus amylolyticus DSM 11664]
          Length = 251

 Score =  108 bits (269), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 70/192 (36%), Positives = 105/192 (54%), Gaps = 15/192 (7%)

Query: 93  VKTVPPQTIDKIVGKEAVHQGLAL-----ETAPL--LSPTLDAVRNSQLLMVLDHVNDPH 145
           V+T P   +D++V     HQGL L     E A L  L    D V     L++LD + DPH
Sbjct: 55  VQTAPKNKLDRLVAG-GNHQGLVLAVSSFEYADLDQLLDEFDQVGKEPFLLMLDSIEDPH 113

Query: 146 NIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNL---TDALQKM 202
           N+G+ILRSA A   D II  KR++   ++V+AK+++GA++++P  R++NL   T  L+K 
Sbjct: 114 NLGSILRSADATGVDAIIIPKRHASGLTSVVAKTSTGAIDYVPVARVNNLVQTTKNLKKR 173

Query: 203 HSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKA 262
             W F T    +D +    Q   N K  L++G EGKG+ P  ++       L M G +++
Sbjct: 174 GYWIFGTDMKGTDYR----QWNANGKTVLVIGNEGKGIAPLLKKQMDQTLTLPMVGHVQS 229

Query: 263 LNVSNAAAVALY 274
           LN S A  + LY
Sbjct: 230 LNASVATGILLY 241


>gi|209921669|ref|YP_002295753.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Escherichia coli
           SE11]
 gi|209914928|dbj|BAG80002.1| putative RNA methyltransferase [Escherichia coli SE11]
          Length = 243

 Score =  108 bits (269), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 73/234 (31%), Positives = 113/234 (48%), Gaps = 10/234 (4%)

Query: 50  FLYGVHTVSAALNN-PSR--KIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVG 106
            +YG+H V A L   P R  ++F L   ++    L   A       ++    Q +D+   
Sbjct: 4   MIYGIHAVQALLERAPERFQEVFILKGREDKRLLLLIHALESQGVVIQLANRQYLDE-KS 62

Query: 107 KEAVHQGLALETAPLLS------PTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCD 160
             AVHQG+     P         P L A  +   L++LD V DPHN+GA LRSA A    
Sbjct: 63  DGAVHQGIIARVKPGRQYQENDLPDLIASLDQPFLLILDGVTDPHNLGACLRSADAAGVH 122

Query: 161 GIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPL 220
            +I  K  S   +A   K A GA E +P IR++NL   ++ +       +G + ++   L
Sbjct: 123 AVIVPKDRSAQLNATAKKVACGAAESVPLIRVTNLARTMRMLQEENIWIVGTAGEADHTL 182

Query: 221 EQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
            Q     ++AL++GAEG+G+R  T+E    +  + M G + +LNVS A  + L+
Sbjct: 183 YQSKMTGRLALVMGAEGEGMRRLTREHCDELISIPMAGSVSSLNVSVATGICLF 236


>gi|319891496|ref|YP_004148371.1| TrmH family tRNA/rRNA methyltransferase YacO [Staphylococcus
           pseudintermedius HKU10-03]
 gi|317161192|gb|ADV04735.1| TrmH family tRNA/rRNA methyltransferase YacO [Staphylococcus
           pseudintermedius HKU10-03]
 gi|323465333|gb|ADX77486.1| RNA methyltransferase, TrmH family, group 3 [Staphylococcus
           pseudintermedius ED99]
          Length = 249

 Score =  108 bits (269), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 61/189 (32%), Positives = 106/189 (56%), Gaps = 9/189 (4%)

Query: 93  VKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQ-------LLMVLDHVNDPH 145
           V+TVP   +D++    A HQG+A   AP     L+     Q        +++LD + DPH
Sbjct: 50  VQTVPKSKLDQLA--NAPHQGVAAFVAPYEYADLNQFLAEQAQKEGLSTVLILDGLEDPH 107

Query: 146 NIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSW 205
           N+G+ILR+A A   DGII  KR S S +  +AK+++GA++H+P IR++NL+  +  +   
Sbjct: 108 NLGSILRTADATGVDGIIIPKRRSVSLTQTVAKASTGAIQHVPVIRVTNLSQTMDVLKDK 167

Query: 206 GFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNV 265
           G+   G  + +     Q   +  +A+++G+EG+G+  + +E       + M G + +LN 
Sbjct: 168 GYWIAGAEASNATDYRQMQADMPLAIVIGSEGQGMSRRVKEKCDFYIKIPMVGHVNSLNA 227

Query: 266 SNAAAVALY 274
           S AA++ +Y
Sbjct: 228 SVAASLMMY 236


>gi|33151509|ref|NP_872862.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Haemophilus ducreyi
           35000HP]
 gi|52783301|sp|Q7VP36|RLMB_HAEDU RecName: Full=23S rRNA (guanosine-2'-O-)-methyltransferase RlmB;
           AltName: Full=23S rRNA Gm2251 2'-O-methyltransferase
 gi|33147729|gb|AAP95251.1| putative tRNA/rRNA methyltransferase [Haemophilus ducreyi 35000HP]
          Length = 246

 Score =  108 bits (269), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 76/237 (32%), Positives = 121/237 (51%), Gaps = 17/237 (7%)

Query: 51  LYGVHTVSAALNNPSRKIFQLLATKNAL-ARLD--WDANLPHPFPVKTVPPQTIDKIVGK 107
           +YG+H V+A L N   ++ ++   K     RL+   D        V+ V  QT+D     
Sbjct: 5   IYGIHAVNAFLANAPERLIEVFVLKGREDKRLNPLLDELQRLSISVQQVNRQTLDNKAQG 64

Query: 108 EAVHQGLALETAP---LLSPTLDAV---RNSQLLMVLDHVNDPHNIGAILRSAVAFSCDG 161
           E VHQG+     P   L    L+ +   +++ LL++LD V DPHN+GA LR+A A   D 
Sbjct: 65  E-VHQGIIARIIPQKELNEYDLNELLQHKSNPLLLILDGVTDPHNLGACLRTADAAGVDA 123

Query: 162 IITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHS----WGFQTIGLSSDSK 217
           +I  K  S + +A+  K A GA E +P IR++NL   ++++      W    +G + ++ 
Sbjct: 124 VIVPKDKSATLTAIARKVACGAAEAMPLIRVTNLARTMRELQDKHQIW---IVGTAGEAT 180

Query: 218 KPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
             +        IAL++GAEG G+R  T+E    +  + M G + +LNVS A  V L+
Sbjct: 181 TDIYTSQLTGAIALVMGAEGDGMRRLTREHCDQLVSIPMAGSVSSLNVSVATGVCLF 237


>gi|16331014|ref|NP_441742.1| hypothetical protein slr0955 [Synechocystis sp. PCC 6803]
 gi|3915411|sp|P74328|Y955_SYNY3 RecName: Full=Uncharacterized tRNA/rRNA methyltransferase slr0955
 gi|1653509|dbj|BAA18422.1| slr0955 [Synechocystis sp. PCC 6803]
          Length = 384

 Score =  108 bits (269), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 72/239 (30%), Positives = 125/239 (52%), Gaps = 19/239 (7%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKI----- 104
            LYG H V AAL+   R++ ++  T +    + +   +       TV    +D++     
Sbjct: 125 LLYGHHAVLAALDG-DRQLNRIWITSHLRHDIRYRTKIQTAKANGTV----VDEVDNFRL 179

Query: 105 --VGKEAVHQGLALETAPL----LSPTLDAVRN---SQLLMVLDHVNDPHNIGAILRSAV 155
             +   A HQG+A + AP     L   +D  ++   + +L+++D + DPHN+GAI+R+A 
Sbjct: 180 NQITHNANHQGIAAQVAPYHYWELGDLIDKAKSQSTAPVLIIIDSITDPHNLGAIIRTAE 239

Query: 156 AFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSD 215
           AF   G++  +R     ++ + K A+GALEH P  R+ NL+ AL+ +   GF   G  + 
Sbjct: 240 AFGAQGMVLPQRRVAGITSTVMKVAAGALEHFPVARVVNLSRALETLKESGFWIYGTVAG 299

Query: 216 SKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
            +  L Q    + + L++G+EG+GL   TQ+    +  + + G   +LN S AAA++LY
Sbjct: 300 KQTALHQADLREPMGLVIGSEGEGLSLLTQKHCDHLITIPLAGKTPSLNASVAAAISLY 358


>gi|193216018|ref|YP_001997217.1| RNA methyltransferase, TrmH family, group 3 [Chloroherpeton
           thalassium ATCC 35110]
 gi|193089495|gb|ACF14770.1| RNA methyltransferase, TrmH family, group 3 [Chloroherpeton
           thalassium ATCC 35110]
          Length = 243

 Score =  108 bits (269), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 58/169 (34%), Positives = 99/169 (58%), Gaps = 5/169 (2%)

Query: 111 HQGLALETAPLLSPTLDAV----RNS-QLLMVLDHVNDPHNIGAILRSAVAFSCDGIITT 165
           HQG+      +    LD +    RNS QL+++LD + DPHN+GAI+R+A A + D +I  
Sbjct: 67  HQGVCALVGKVKYFELDEILARPRNSKQLIVILDGLEDPHNVGAIIRTAEAAAVDAVIIP 126

Query: 166 KRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIK 225
                  +A +AK+++GAL HI   ++ NL+  ++++   GF   GL  D +K   +   
Sbjct: 127 HDSGCPINATVAKTSAGALSHIRLCKVVNLSQTIERLKKHGFWVYGLDMDGEKNYYEIDF 186

Query: 226 NDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
           ND  A+++G+EGKG+R   ++   ++  L + G +++LN S +AA+ LY
Sbjct: 187 NDHCAIVVGSEGKGIRQLVRKNCDALIRLPIAGNVESLNASVSAAIPLY 235


>gi|72160617|ref|YP_288274.1| RNA methyltransferase TrmH, group 3 [Thermobifida fusca YX]
 gi|71914349|gb|AAZ54251.1| RNA methyltransferase TrmH, group 3 [Thermobifida fusca YX]
          Length = 324

 Score =  108 bits (269), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 63/175 (36%), Positives = 97/175 (55%), Gaps = 9/175 (5%)

Query: 108 EAVHQGLALETAPLLSPTLDAV-------RNSQLLMVLDHVNDPHNIGAILRSAVAFSCD 160
           +A HQGL L+  P    T D +         + L++ LD V DPHN+GAI RSA AF   
Sbjct: 141 KAAHQGLILQVEPYEYATADDLLAEARKGETTPLIVALDGVTDPHNLGAIARSAAAFGAH 200

Query: 161 GIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPL 220
           G++  +R +   +    K+++G L  IP  ++ NLT  L++    GF   GL +D   PL
Sbjct: 201 GLLVPERRAAGVTTAAWKASAGTLARIPVAQVVNLTRTLKQFQEAGFFVSGLDADGDTPL 260

Query: 221 EQ-EIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
           +Q E+  +   +++G+EGKGL    +ET   +  + + G +++LN S AA VALY
Sbjct: 261 DQWELATEPSVVVVGSEGKGLSRLVRETCDVVVSIPIHG-VESLNASVAAGVALY 314


>gi|169830056|ref|YP_001700214.1| trmH family tRNA/rRNA methyltransferase yacO [Lysinibacillus
           sphaericus C3-41]
 gi|168994544|gb|ACA42084.1| Putative trmH family tRNA/rRNA methyltransferase yacO
           [Lysinibacillus sphaericus C3-41]
          Length = 250

 Score =  108 bits (269), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 66/192 (34%), Positives = 109/192 (56%), Gaps = 15/192 (7%)

Query: 93  VKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAV-------RNSQLLMVLDHVNDPH 145
           V+ VP + +D++    A HQG+    A      L+ +       +     ++LD + DPH
Sbjct: 53  VQFVPKKKVDQL--SSANHQGIVASVAAYKYAELEDLFAAAAKKQEDPFFLILDELEDPH 110

Query: 146 NIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSW 205
           N+G+I+R+A A    GII  KR S S +AV+AKS++GA+EH+P +R++NL   + ++   
Sbjct: 111 NLGSIMRTADAIGAHGIIIPKRRSVSLTAVVAKSSTGAIEHVPVVRVNNLAQTVDELKER 170

Query: 206 GFQTIGLSSDSKKPLEQEIKNDK---IALILGAEGKGLRPKTQETATSMAHLHMPGIIKA 262
           G    G  +D+K  ++   K D    +A+I+G+EGKG+    +E    + HL M G + +
Sbjct: 171 GIWIAG--TDAKGSVDYR-KMDATLPLAIIIGSEGKGMGRLLKEKCDFLYHLPMVGHVTS 227

Query: 263 LNVSNAAAVALY 274
           LN S AAA+ +Y
Sbjct: 228 LNASVAAALLMY 239


>gi|296100947|ref|YP_003611093.1| 23S rRNA 2'-O-methyltransferase [Enterobacter cloacae subsp.
           cloacae ATCC 13047]
 gi|295055406|gb|ADF60144.1| 23S rRNA 2'-O-methyltransferase [Enterobacter cloacae subsp.
           cloacae ATCC 13047]
          Length = 244

 Score =  108 bits (269), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 75/238 (31%), Positives = 116/238 (48%), Gaps = 18/238 (7%)

Query: 50  FLYGVHTVSAALNN-PSR--KIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVG 106
            +YG+H V A L   P R  ++F L   ++   RL     L H    + V  Q  ++   
Sbjct: 4   MIYGIHAVQALLERAPERFQEVFILKGREDK--RL---MPLIHALEAQGVVIQLANRQFL 58

Query: 107 KE----AVHQGLALETAPLLS------PTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVA 156
            E    AVHQG+     P         P L A  ++   ++LD V DPHN+GA LRSA A
Sbjct: 59  DEKSEGAVHQGIIARVKPGRQYQENDLPDLIAALDNPFFLILDGVTDPHNLGACLRSADA 118

Query: 157 FSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDS 216
                +I  K  S   +A   K A GA E++P IR++NL   ++ +       +G + ++
Sbjct: 119 AGVHAVIVPKDRSAQLNATAKKVACGAAENVPLIRVTNLARTMRMLQEENIWIVGTAGEA 178

Query: 217 KKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
              L Q     ++AL++GAEG+G+R  T+E    +  + M G + +LNVS A  + L+
Sbjct: 179 DHTLYQSKMTGRLALVMGAEGEGMRRLTREHCDELISIPMAGSVSSLNVSVATGICLF 236


>gi|260436245|ref|ZP_05790215.1| putative RNA methyltransferase TrmH family, group 3 [Synechococcus
           sp. WH 8109]
 gi|260414119|gb|EEX07415.1| putative RNA methyltransferase TrmH family, group 3 [Synechococcus
           sp. WH 8109]
          Length = 515

 Score =  107 bits (268), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 75/236 (31%), Positives = 123/236 (52%), Gaps = 13/236 (5%)

Query: 50  FLYGVHTVSAAL--NNPSRKIFQLLATKNA--LARLDWDANLPHPFPVKTVPPQTIDKIV 105
            ++G H   AAL    P  +I+     ++A    +L  DA       V+ V    + +I 
Sbjct: 188 LIWGRHATQAALEAGRPIHRIWCTAEMRSASKFLQLLRDAKASGVL-VEEVTWARLGQIT 246

Query: 106 GKEAVHQGLALETAPLLSPTLDAV-------RNSQLLMVLDHVNDPHNIGAILRSAVAFS 158
           G  +VHQG+AL+TA   +  LD++           LL+ LD V DPHN+GA++RSA A  
Sbjct: 247 GG-SVHQGIALQTAAAETLDLDSLIEGCSDLGEPPLLVALDGVTDPHNLGAVVRSAEAMG 305

Query: 159 CDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKK 218
             G++  +R S   +   AK A+GALEH+P  R+ NL  +L+K+   G++ +GL+++   
Sbjct: 306 AHGVVIPQRRSAGLTGSAAKVAAGALEHLPVARVVNLNRSLEKLKDAGYRVVGLAAEGDV 365

Query: 219 PLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
            L     +  + L+ G+E +GL   T+     +  + + GI  +LN S A A+ +Y
Sbjct: 366 TLTDVDLSGPMVLVTGSEDQGLSLMTRRHCDQLVRIPLRGITPSLNASVATALCVY 421


>gi|118465233|ref|YP_879854.1| RNA methyltransferase, TrmH family protein, group 3 [Mycobacterium
           avium 104]
 gi|254773532|ref|ZP_05215048.1| RNA methyltransferase, TrmH family protein, group 3 [Mycobacterium
           avium subsp. avium ATCC 25291]
 gi|254806514|sp|A0QAB6|Y574_MYCA1 RecName: Full=Uncharacterized tRNA/rRNA methyltransferase MAV_0574
 gi|118166520|gb|ABK67417.1| RNA methyltransferase, TrmH family protein, group 3 [Mycobacterium
           avium 104]
          Length = 309

 Score =  107 bits (268), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 83/264 (31%), Positives = 135/264 (51%), Gaps = 15/264 (5%)

Query: 21  AKLRRNHRDYKKMQSFNQK-SRHTSQPENLFLYGVHTVSAALNN--PSRKIFQLLATKNA 77
           A LR NH   K+ QS  ++ ++ T + E +   G + V   L    P+  ++  L T+ A
Sbjct: 41  AHLRPNHPAAKRAQSPPRRPAKRTEETETVL--GRNPVLECLRAGVPATALYVALGTE-A 97

Query: 78  LARLDWDAN--LPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLL----SPTLDAVRN 131
             RL    +        +  VP   +D++ G   +HQG+AL+  P +       L+A   
Sbjct: 98  DERLTESVSRAADSGISILEVPRADLDRMTGNH-LHQGIALQVPPYIYAHPDDLLEAAAG 156

Query: 132 S--QLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPY 189
           S   LL+ LD+++DP N+GAI+RS  AF   G++  +R S S +AV  ++++GA   IP 
Sbjct: 157 SPPALLVALDNISDPRNLGAIVRSVAAFGGHGVLIPQRRSASVTAVAWRTSAGAAARIPV 216

Query: 190 IRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETAT 249
            R +NLT  LQ     G + IGL +     L+    +D + +++G+EGKGL    ++   
Sbjct: 217 ARATNLTRTLQDWADRGLRVIGLDAGGDTTLDDLDGSDPLVVVVGSEGKGLSRLVRQNCD 276

Query: 250 SMAHLHMPGIIKALNVSNAAAVAL 273
            +  + M G  ++LN S AA V L
Sbjct: 277 EVVSIPMAGSAESLNASVAAGVVL 300


>gi|229817008|ref|ZP_04447290.1| hypothetical protein BIFANG_02263 [Bifidobacterium angulatum DSM
           20098]
 gi|229785753|gb|EEP21867.1| hypothetical protein BIFANG_02263 [Bifidobacterium angulatum DSM
           20098]
          Length = 333

 Score =  107 bits (268), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 54/150 (36%), Positives = 88/150 (58%), Gaps = 1/150 (0%)

Query: 134 LLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRIS 193
           L + LD V DP N+GA++RSA AF  +G+I  +R S S +A   K ++GA  H+P  R+ 
Sbjct: 180 LFIALDGVTDPQNLGAVIRSAAAFGANGVILPERRSASVTAAAWKVSAGAAAHLPVCRVV 239

Query: 194 NLTDALQKMHSWGFQTIGLSSDSKKPL-EQEIKNDKIALILGAEGKGLRPKTQETATSMA 252
           NLT A++ + + G+  +GL     K + E   + D + ++LG+EGKGL    +E   ++A
Sbjct: 240 NLTKAIEALKARGYYVVGLDGGGDKLVGETGFETDPLVVVLGSEGKGLSRLVREACDAIA 299

Query: 253 HLHMPGIIKALNVSNAAAVALYITQNHFAK 282
            + +   +++LN S AA ++LY   N   K
Sbjct: 300 GIPISSQVESLNASVAAGISLYAVANERRK 329


>gi|223934291|ref|ZP_03626214.1| RNA methyltransferase, TrmH family, group 3 [Streptococcus suis
           89/1591]
 gi|330833534|ref|YP_004402359.1| TrmH family RNA methyltransferase [Streptococcus suis ST3]
 gi|223897038|gb|EEF63476.1| RNA methyltransferase, TrmH family, group 3 [Streptococcus suis
           89/1591]
 gi|329307757|gb|AEB82173.1| RNA methyltransferase, TrmH family, group 3 [Streptococcus suis
           ST3]
          Length = 242

 Score =  107 bits (268), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 77/241 (31%), Positives = 120/241 (49%), Gaps = 23/241 (9%)

Query: 48  NLFLYGVHTVSAALN-NPSRKIF--QLLATKN-----ALARLDWDANLPHPFPVKTVPPQ 99
           N  +YGVH V  +L  N   K++    L  KN     ALA             +   P +
Sbjct: 4   NDIVYGVHAVVESLEANTGNKLYIQDDLRGKNVEKIKALAA-------EKKVSISWTPKK 56

Query: 100 TIDKIVGKEAVHQGLALETAPLLSPTLDAV------RNSQLLMVLDHVNDPHNIGAILRS 153
           T+  +  + AVHQG  L  +      L  +       ++ L+++LD + DPHN G+ILR+
Sbjct: 57  TLSDMT-EGAVHQGFVLRVSEFAYADLSVILEKAEQEDNPLILILDGLTDPHNFGSILRT 115

Query: 154 AVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLS 213
           A A    GII  K  +   + V+AK+++GA+ H+P  R++NL+  L K+   GF   G  
Sbjct: 116 ADATQVAGIIIPKHRAVGVTPVVAKTSTGAVAHVPIARVTNLSQTLDKLKEAGFWVFGTD 175

Query: 214 SDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVAL 273
            +   P  +     K+ALI+G EGKG+    ++    M  + M G +++LN S AAAV +
Sbjct: 176 MNG-TPSHKWNTAGKLALIIGNEGKGISSNIKKQVDEMITIPMKGHVQSLNASVAAAVLM 234

Query: 274 Y 274
           Y
Sbjct: 235 Y 235


>gi|261492875|ref|ZP_05989421.1| RNA methyltransferase, TrmH family, group 3 [Mannheimia haemolytica
           serotype A2 str. BOVINE]
 gi|261496775|ref|ZP_05993150.1| RNA methyltransferase, TrmH family, group 3 [Mannheimia haemolytica
           serotype A2 str. OVINE]
 gi|261307614|gb|EEY08942.1| RNA methyltransferase, TrmH family, group 3 [Mannheimia haemolytica
           serotype A2 str. OVINE]
 gi|261311416|gb|EEY12573.1| RNA methyltransferase, TrmH family, group 3 [Mannheimia haemolytica
           serotype A2 str. BOVINE]
          Length = 247

 Score =  107 bits (268), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 79/245 (32%), Positives = 121/245 (49%), Gaps = 33/245 (13%)

Query: 51  LYGVHTVSAALNNPSRKIFQLLATK-----------NALARLDWDANLPHPFPVKTVPPQ 99
           +YG+H V A  +N   ++ ++L  K           N L RL           ++ V  Q
Sbjct: 5   IYGIHAVKAFWDNAPERLIEVLVLKGREDKRLMPLLNELQRLG--------VAIQQVNRQ 56

Query: 100 TIDKIVGKEAVHQGLALETAP---LLSPTLDAV---RNSQLLMVLDHVNDPHNIGAILRS 153
           T+D     E VHQG+     P   L    L+A+   + + LL++LD V DPHN+GA LR+
Sbjct: 57  TLDNKSQGE-VHQGIIARVVPQKELNEHDLEAILSQKKNPLLLILDGVTDPHNLGACLRT 115

Query: 154 AVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDA---LQKMHS-WGFQT 209
           A A   D +I  K  S   +    K A GA E +P IR++NL      LQ+ H+ W    
Sbjct: 116 ADAAGVDAVIVPKDKSAQLTPTARKVACGAAEVMPLIRVTNLARTMRDLQERHNVW---I 172

Query: 210 IGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAA 269
           +G + +++  + +      IAL++GAEG G+R  T+E    +  + M G + +LNVS A 
Sbjct: 173 VGTAGEAESGIYEAKLTGSIALVMGAEGDGMRRLTREHCDQLISIPMAGSVSSLNVSVAT 232

Query: 270 AVALY 274
            V L+
Sbjct: 233 GVCLF 237


>gi|318041276|ref|ZP_07973232.1| RNA methyltransferase TrmH, group 3 [Synechococcus sp. CB0101]
          Length = 556

 Score =  107 bits (268), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 61/173 (35%), Positives = 97/173 (56%), Gaps = 7/173 (4%)

Query: 109 AVHQGLALETAPL----LSPTLDAVRN---SQLLMVLDHVNDPHNIGAILRSAVAFSCDG 161
           AVHQG+ L+ A      L   +D  R+     LLM LD + DPHN+GAI+RSA A    G
Sbjct: 276 AVHQGIVLQAAAADTLDLGSLIDGCRSIGEPPLLMALDGITDPHNLGAIVRSAEALGAHG 335

Query: 162 IITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLE 221
           ++  +R S   +  +AK A+GALEH+P  R+ NL  +L+ +   G++ IGL+ ++   L 
Sbjct: 336 LVLPQRRSAGLTGSVAKVAAGALEHLPVARVVNLNRSLETLKEEGYRVIGLAGEAGVALS 395

Query: 222 QEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
           +   +  + ++ G+EG GL   T++    +  + + G   +LN S A A+ LY
Sbjct: 396 EADLDGPLVIVTGSEGSGLSMLTRKHCDQLVRIPLRGATPSLNASVATAMVLY 448


>gi|227522455|ref|ZP_03952504.1| TrmH family tRNA/rRNA methyltransferase [Lactobacillus hilgardii
           ATCC 8290]
 gi|227090407|gb|EEI25719.1| TrmH family tRNA/rRNA methyltransferase [Lactobacillus hilgardii
           ATCC 8290]
          Length = 255

 Score =  107 bits (268), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 73/245 (29%), Positives = 126/245 (51%), Gaps = 14/245 (5%)

Query: 41  RHTSQPENLFLYGVHTVSAAL--NNPSRKIFQLLATKNALARLDWDANLPHP--FPVKTV 96
           +H  + E  F+ G H V AAL  ++P  K+F     K     +     L       +  V
Sbjct: 2   KHDQENEE-FVMGRHPVVAALKSDSPVNKVFIQTGIKKDENIISEILKLARKKRLVISEV 60

Query: 97  PPQTIDKIVGKEAVHQGLALETAPLLSPTLDAV-RNSQ------LLMVLDHVNDPHNIGA 149
           P Q +D++   +  HQG+ L  A     T+D +  N++        ++LD++ DPHN+G+
Sbjct: 61  PKQKLDRLSASQN-HQGVVLSVAAFEYATVDDLFANAKKQGIKPFFVILDNIEDPHNLGS 119

Query: 150 ILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQT 209
           I+R+A A    GII  K  +   +AV+AK+++GA+E +P  R++NL   ++++   G   
Sbjct: 120 IIRTADAAGVSGIIIPKHRAVGLTAVVAKTSAGAIERVPVARVTNLAATIKELKGRGMWV 179

Query: 210 IGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAA 269
            G   +       + +   +A+I+G EGKG+ P  ++    M  + M G I++LN S AA
Sbjct: 180 FGTDIEGTDYRRWDARG-SVAIIIGNEGKGISPLIKKQVDEMLTIPMVGDIQSLNASVAA 238

Query: 270 AVALY 274
           +V +Y
Sbjct: 239 SVLIY 243


>gi|147676634|ref|YP_001210849.1| rRNA methylases [Pelotomaculum thermopropionicum SI]
 gi|146272731|dbj|BAF58480.1| rRNA methylases [Pelotomaculum thermopropionicum SI]
          Length = 261

 Score =  107 bits (268), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 79/249 (31%), Positives = 127/249 (51%), Gaps = 12/249 (4%)

Query: 35  SFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALA---RLDWDANLPHPF 91
           + N K +  ++ E++ + G + V  AL   +R I +LL  + AL    R  +D       
Sbjct: 5   NLNLKKKGRNRLEDI-IAGRNPVREALR-ANRPINKLLIAEGALTGSLREIYDLARERKI 62

Query: 92  PVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAV------RNSQLLMVLDHVNDPH 145
           PV+ V  Q + K+V  EA HQG+    A      +D +           L++LD V+DPH
Sbjct: 63  PVQRVERQHLSKLV-PEASHQGVVALAAVREYVDVDDILAGVAPGEDPFLILLDEVHDPH 121

Query: 146 NIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSW 205
           N+GAILR+A A    GII  +R S   S  +A+S++GA+E++P  R++N+   ++ +   
Sbjct: 122 NLGAILRTADAAGAHGIIIPRRRSAPLSRTVARSSAGAVEYVPVARVANIARTIELLKGK 181

Query: 206 GFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNV 265
           G    G   D ++       +  +AL++G EGKGL    +E    +  L M G + +LN 
Sbjct: 182 GLWVAGADPDGREVYWDARLDGPVALVIGGEGKGLGRLVKEKCDVLVRLPMSGRVNSLNA 241

Query: 266 SNAAAVALY 274
           S AAA+  Y
Sbjct: 242 SVAAALLSY 250


>gi|307546117|ref|YP_003898596.1| RNA methyltransferase, TrmH family, group 3 [Halomonas elongata DSM
           2581]
 gi|307218141|emb|CBV43411.1| RNA methyltransferase, TrmH family, group 3 [Halomonas elongata DSM
           2581]
          Length = 270

 Score =  107 bits (268), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 77/235 (32%), Positives = 112/235 (47%), Gaps = 12/235 (5%)

Query: 51  LYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTV--PPQTIDKIVGKE 108
           +YGVH V A +          +   +A  RL     L      K V  P  T+D++  + 
Sbjct: 19  VYGVHAVRALIERGEMPRELWVQDGDASERLAELVALARKGNAKVVNQPRDTLDRLA-QG 77

Query: 109 AVHQG-------LALETAPLLSPTLDA--VRNSQLLMVLDHVNDPHNIGAILRSAVAFSC 159
           AVHQG       LA E    L   L    V  + LL+VLD + D HN GA LRSA A   
Sbjct: 78  AVHQGVVAFCPPLAFEAEASLWHRLQGWSVEAAPLLLVLDGITDVHNFGACLRSADAAGA 137

Query: 160 DGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKP 219
            G++  K  +   +A + K A GA E +P  R++NL  +L +M   G    G + +++  
Sbjct: 138 HGVVVPKDRAAPLNATVRKVACGAAESVPVYRVTNLARSLARMKELGVWVTGTAGEAEAS 197

Query: 220 LEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
           +         AL++GAEGKG+R  T+E    +  L M G + +LNVS A  + L+
Sbjct: 198 VYDADFTGATALVMGAEGKGMRRLTREACDGLVKLPMAGQVASLNVSVATGICLF 252


>gi|308235518|ref|ZP_07666255.1| RNA methyltransferase, TrmH family, group 3 [Gardnerella vaginalis
           ATCC 14018]
          Length = 331

 Score =  107 bits (268), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 54/146 (36%), Positives = 86/146 (58%), Gaps = 1/146 (0%)

Query: 134 LLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRIS 193
           L + LD V DP N+GA++RSA AF  +G+I  +R S S +A   K ++GA  H+P  R+ 
Sbjct: 176 LFIALDGVTDPQNLGAVIRSAAAFGANGVILPERRSASVTAAAWKVSAGAAAHLPVARVV 235

Query: 194 NLTDALQKMHSWGFQTIGLSSDSKKPL-EQEIKNDKIALILGAEGKGLRPKTQETATSMA 252
           NL  A+Q +   G+  IGL     K + E   + D + ++LG+EGKG+   T+E   ++A
Sbjct: 236 NLNKAIQGLRERGWYAIGLDGGGDKLVGETGFETDPLVVVLGSEGKGMSRLTREACDAIA 295

Query: 253 HLHMPGIIKALNVSNAAAVALYITQN 278
            + +   +++LN S AA ++LY   N
Sbjct: 296 GIPISSAVESLNASVAAGISLYAVAN 321


>gi|254227152|ref|ZP_04920689.1| RNA methyltransferase, TrmH family [Vibrio cholerae V51]
 gi|125620326|gb|EAZ48723.1| RNA methyltransferase, TrmH family [Vibrio cholerae V51]
          Length = 247

 Score =  107 bits (268), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 75/244 (30%), Positives = 120/244 (49%), Gaps = 26/244 (10%)

Query: 48  NLFLYGVHTVSAALN-NPSRKIF----------QLLATKNALARLDWDANLPHPFPVKTV 96
           N  +YG+H V+A L  +P+R +           +LL   N L RL           ++ +
Sbjct: 3   NELIYGIHAVNAVLQRDPARFVEAYVLKGRQDDRLLPVLNELMRLG--------VSIQEM 54

Query: 97  PPQTIDKIVGKEAVHQGLALETAP---LLSPTLDAVRNSQ---LLMVLDHVNDPHNIGAI 150
             + +D    + A HQGL     P   L    LD +       LL+VLD V DPHN+GA 
Sbjct: 55  SRKALDD-KAEGANHQGLIARVKPARQLNENDLDDILAQHEHPLLLVLDGVTDPHNLGAC 113

Query: 151 LRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTI 210
           LR+A A     +I  K  S   +A ++K A GA E +P +R++NL   ++ +   G   +
Sbjct: 114 LRNADAAGVAAVIVPKDKSAPLTATVSKVACGAAETVPLVRVTNLARTMRALQEKGVWFV 173

Query: 211 GLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAA 270
           G + ++   + Q      +A+++GAEG G+R  T+ET   +  + M G + +LNVS A  
Sbjct: 174 GTAGEATHDIYQSKLTGPLAIVMGAEGDGMRRLTRETCDDLIKIPMAGSVSSLNVSVACG 233

Query: 271 VALY 274
           + L+
Sbjct: 234 ICLF 237


>gi|289551668|ref|YP_003472572.1| TrmH family tRNA/rRNA methyltransferase YacO [Staphylococcus
           lugdunensis HKU09-01]
 gi|315659128|ref|ZP_07911993.1| RNA methyltransferase [Staphylococcus lugdunensis M23590]
 gi|289181199|gb|ADC88444.1| TrmH family tRNA/rRNA methyltransferase YacO [Staphylococcus
           lugdunensis HKU09-01]
 gi|315495852|gb|EFU84182.1| RNA methyltransferase [Staphylococcus lugdunensis M23590]
          Length = 248

 Score =  107 bits (268), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 59/189 (31%), Positives = 106/189 (56%), Gaps = 9/189 (4%)

Query: 93  VKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQ-------LLMVLDHVNDPH 145
           V+TVP   +D +   +A HQG+A   AP      +     Q        +++LD + DPH
Sbjct: 50  VQTVPKSKLDHM--SDAPHQGVAALIAPYEYADFNHFIKMQQQKESLSTVIILDGLEDPH 107

Query: 146 NIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSW 205
           N+G+ILR+A A   DGII  KR S + + ++AK+++GA++HIP +R++NL+  +  + + 
Sbjct: 108 NLGSILRTADATGVDGIIIPKRRSVALTQIVAKASTGAIQHIPVMRVTNLSQTIDDLKAH 167

Query: 206 GFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNV 265
           GF  +G  +D+         +  +A+++G+EG+G+    ++       + M G + +LN 
Sbjct: 168 GFWIVGTEADNATDYRDMAADMSLAIVIGSEGQGMSRLVKDKCDFYIKIPMVGHVNSLNA 227

Query: 266 SNAAAVALY 274
           S AA + +Y
Sbjct: 228 SVAAGLMMY 236


>gi|298252979|ref|ZP_06976771.1| rRNA methylase [Gardnerella vaginalis 5-1]
 gi|297532374|gb|EFH71260.1| rRNA methylase [Gardnerella vaginalis 5-1]
          Length = 313

 Score =  107 bits (268), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 54/146 (36%), Positives = 86/146 (58%), Gaps = 1/146 (0%)

Query: 134 LLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRIS 193
           L + LD V DP N+GA++RSA AF  +G+I  +R S S +A   K ++GA  H+P  R+ 
Sbjct: 158 LFIALDGVTDPQNLGAVIRSAAAFGANGVILPERRSASVTAAAWKVSAGAAAHLPVARVV 217

Query: 194 NLTDALQKMHSWGFQTIGLSSDSKKPL-EQEIKNDKIALILGAEGKGLRPKTQETATSMA 252
           NL  A+Q +   G+  IGL     K + E   + D + ++LG+EGKG+   T+E   ++A
Sbjct: 218 NLNKAIQGLRERGWYAIGLDGGGDKLVGETGFETDPLVVVLGSEGKGMSRLTREACDAIA 277

Query: 253 HLHMPGIIKALNVSNAAAVALYITQN 278
            + +   +++LN S AA ++LY   N
Sbjct: 278 GIPISSAVESLNASVAAGISLYAVAN 303


>gi|332160030|ref|YP_004296607.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Yersinia
           enterocolitica subsp. palearctica 105.5R(r)]
 gi|318607412|emb|CBY28910.1| 23s rRNA (guanosine-2'-O-)-methyltransferase rlmB [Yersinia
           enterocolitica subsp. palearctica Y11]
 gi|325664260|gb|ADZ40904.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Yersinia
           enterocolitica subsp. palearctica 105.5R(r)]
 gi|330862086|emb|CBX72252.1| 23S rRNA (guanosine-2'-O-)-methyltransferase rlmB [Yersinia
           enterocolitica W22703]
          Length = 246

 Score =  107 bits (268), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 72/239 (30%), Positives = 116/239 (48%), Gaps = 20/239 (8%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLATKN--------ALARLDWDANLPHPFPVKTVPPQTI 101
            +YG+H+V A L+N  ++  ++   K          +A L+          ++    Q +
Sbjct: 4   IIYGIHSVKALLDNDPQRFLEVFILKGRDDRRLQPLIAELE-----AAGLVIQVASRQWL 58

Query: 102 DKIVGKEAVHQGLALETAPLLS------PTLDAVRNSQLLMVLDHVNDPHNIGAILRSAV 155
           D  V +  VHQG+               P L     + LL+VLD V DPHN+GA LRSA 
Sbjct: 59  DSQV-EGGVHQGIVARVREGRQYQENDLPALLESVETPLLLVLDGVTDPHNLGACLRSAD 117

Query: 156 AFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSD 215
           A     +I  +  S   +A+  K ASGA E++P I+++NL   L+ +       +G + +
Sbjct: 118 AAGVHAVIVPRDRSAQLNAIAKKVASGAAENVPLIKVTNLARTLRVLQEHNVWIVGTAGE 177

Query: 216 SKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
           +   L Q      +AL++GAEG+G+R  T+E    +  + M G + +LNVS A  V L+
Sbjct: 178 ADHTLYQSKMTGPMALVMGAEGEGMRRLTREHCDELISIPMAGSVSSLNVSVATGVCLF 236


>gi|54022403|ref|YP_116645.1| putative tRNA/rRNA methyltransferase [Nocardia farcinica IFM 10152]
 gi|54013911|dbj|BAD55281.1| putative tRNA/rRNA methyltransferase [Nocardia farcinica IFM 10152]
          Length = 324

 Score =  107 bits (268), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 62/185 (33%), Positives = 102/185 (55%), Gaps = 8/185 (4%)

Query: 96  VPPQTIDKIVGKEAVHQGLALETAPL-------LSPTLDAVRNSQLLMVLDHVNDPHNIG 148
           VP   +D++     +HQGLAL+  P        L+    +     LL+ LD+++DP N+G
Sbjct: 132 VPRTDLDRMS-SNGLHQGLALQVPPYRYAHPDDLAERARSSAEPALLVALDNISDPRNLG 190

Query: 149 AILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQ 208
           A++RS  AF   G++  +R S S +AV  ++++GA   +P  R +NLT  L+   + G Q
Sbjct: 191 AVIRSVAAFGGHGVLIPQRRSASVTAVAWRTSAGAAARLPVARATNLTRTLKDWANQGMQ 250

Query: 209 TIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNA 268
            +GL +     L++    D   +++G+EGKGL    +ET  S+  + M G +++LN S A
Sbjct: 251 IVGLDAGGDTSLDEFDGTDPTVIVVGSEGKGLSRLVRETCDSVLSIPMAGPVESLNASVA 310

Query: 269 AAVAL 273
           A V L
Sbjct: 311 AGVVL 315


>gi|82546579|ref|YP_410526.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Shigella boydii
           Sb227]
 gi|81247990|gb|ABB68698.1| conserved hypothetical protein [Shigella boydii Sb227]
          Length = 243

 Score =  107 bits (268), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 76/238 (31%), Positives = 115/238 (48%), Gaps = 18/238 (7%)

Query: 50  FLYGVHTVSAALNN-PSR--KIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVG 106
            +YG+H V A L   P R  ++F L   ++   RL     L H    + V  Q  ++   
Sbjct: 4   MIYGIHAVQALLERAPERFQEVFILKGREDK--RL---LPLIHALEAQGVVIQLANRQYL 58

Query: 107 KE----AVHQGLALETAPLLS------PTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVA 156
            E    AVHQG+     P         P L A  +   L++LD V DPHN+GA LRSA A
Sbjct: 59  DEKSDGAVHQGIIARVKPGRQYQENDLPDLIASLDQPFLLILDGVTDPHNLGACLRSADA 118

Query: 157 FSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDS 216
                +I  K  S   +A   K A GA E +P IR++NL   ++ +       +G + ++
Sbjct: 119 AGVHAVIVPKDRSAQLNATAKKVACGAAESVPLIRVTNLVRTMRMLQEENIWIVGTAGEA 178

Query: 217 KKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
              L Q     ++AL++GAEG+G+R  T+E    +  + M G + +LNVS A  + L+
Sbjct: 179 DHTLYQSKMTGRLALVMGAEGEGMRRLTREHCDELISIPMAGSVSSLNVSVATGICLF 236


>gi|297243268|ref|ZP_06927203.1| rRNA methylase [Gardnerella vaginalis AMD]
 gi|296888802|gb|EFH27539.1| rRNA methylase [Gardnerella vaginalis AMD]
          Length = 332

 Score =  107 bits (268), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 54/146 (36%), Positives = 86/146 (58%), Gaps = 1/146 (0%)

Query: 134 LLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRIS 193
           L + LD V DP N+GA++RSA AF  +G+I  +R S S +A   K ++GA  H+P  R+ 
Sbjct: 176 LFIALDGVTDPQNLGAVIRSAAAFGANGVILPERRSASVTAAAWKVSAGAAAHLPVARVV 235

Query: 194 NLTDALQKMHSWGFQTIGLSSDSKKPL-EQEIKNDKIALILGAEGKGLRPKTQETATSMA 252
           NL  A+Q +   G+  IGL     K + E   + D + ++LG+EGKG+   T+E   ++A
Sbjct: 236 NLNKAIQSLRERGWYAIGLDGGGDKLVGETGFETDPLVVVLGSEGKGMSRLTREACDAIA 295

Query: 253 HLHMPGIIKALNVSNAAAVALYITQN 278
            + +   +++LN S AA ++LY   N
Sbjct: 296 GIPISSAVESLNASVAAGISLYAVAN 321


>gi|290890983|ref|ZP_06554047.1| hypothetical protein AWRIB429_1437 [Oenococcus oeni AWRIB429]
 gi|290479382|gb|EFD88042.1| hypothetical protein AWRIB429_1437 [Oenococcus oeni AWRIB429]
          Length = 233

 Score =  107 bits (268), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 63/188 (33%), Positives = 106/188 (56%), Gaps = 9/188 (4%)

Query: 93  VKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNS-----QLLMVLDHVNDPHNI 147
           V+ V  Q +D++      HQG+A+  A      LD + N        L++LD + DPHN+
Sbjct: 38  VQEVDNQRLDELT-NHGNHQGIAISIAAYEYVPLDDILNGIKGHDPFLVILDEIEDPHNL 96

Query: 148 GAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGF 207
           G+ILR+A A   DGII  KR +   + V+AK+++GA+E++P  R+ N+ + + K+    F
Sbjct: 97  GSILRTADATGVDGIIIPKRRAVQLTQVVAKTSTGAIEYVPVARVVNINNTIDKLKKANF 156

Query: 208 QTIGLSSDSKKPLEQEIKNDK-IALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVS 266
              G  +D K     +   D  +A+++G EGKG+  +T++    M  + M G +++LN S
Sbjct: 157 WIFG--TDMKGADYNDWNADGPVAIVIGNEGKGISAQTKKKVDQMLTIPMVGHVQSLNAS 214

Query: 267 NAAAVALY 274
            AAA+ +Y
Sbjct: 215 VAAALLIY 222


>gi|91227443|ref|ZP_01261807.1| RNA methyltransferase, TrmH family protein [Vibrio alginolyticus
           12G01]
 gi|269964501|ref|ZP_06178742.1| RNA methyltransferase [Vibrio alginolyticus 40B]
 gi|91188593|gb|EAS74884.1| RNA methyltransferase, TrmH family protein [Vibrio alginolyticus
           12G01]
 gi|269830839|gb|EEZ85057.1| RNA methyltransferase [Vibrio alginolyticus 40B]
          Length = 247

 Score =  107 bits (268), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 76/240 (31%), Positives = 119/240 (49%), Gaps = 18/240 (7%)

Query: 48  NLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLP-------HPFPVKTVPPQT 100
           N F+YG+H V A L     +  +    K    R D D  +P           ++ +  +T
Sbjct: 3   NEFIYGIHAVKAVLEREPERFIEAYVLK---GRQD-DRLMPILNDLQVCGVSIQQMTRKT 58

Query: 101 IDKIVGKEAVHQGLALETAP---LLSPTLD---AVRNSQLLMVLDHVNDPHNIGAILRSA 154
           +D    + A HQG+     P   L    +D   A   S LL+VLD V DPHN+GA LR+A
Sbjct: 59  LDD-KARGANHQGIIARVKPAKQLNENDIDDILAQHESPLLLVLDGVTDPHNLGACLRNA 117

Query: 155 VAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSS 214
            A     II  K  S   +A ++K A GA E +P IR++NL   ++ +   G   +G + 
Sbjct: 118 DAAGAAAIIVPKDRSAPMNATVSKVACGAAEVVPLIRVTNLARTMRTLQEKGIWFVGTAG 177

Query: 215 DSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
           ++   + Q      +A+++GAEG G+R  T+ET   +  + M G + +LNVS A+ + L+
Sbjct: 178 EATHDIYQAKLTGPLAIVMGAEGDGMRRLTRETCDDLIKIPMAGSVSSLNVSVASGICLF 237


>gi|283783774|ref|YP_003374528.1| RNA methyltransferase, TrmH family, group 3 [Gardnerella vaginalis
           409-05]
 gi|283441096|gb|ADB13562.1| RNA methyltransferase, TrmH family, group 3 [Gardnerella vaginalis
           409-05]
          Length = 331

 Score =  107 bits (268), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 54/146 (36%), Positives = 86/146 (58%), Gaps = 1/146 (0%)

Query: 134 LLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRIS 193
           L + LD V DP N+GA++RSA AF  +G+I  +R S S +A   K ++GA  H+P  R+ 
Sbjct: 176 LFIALDGVTDPQNLGAVIRSAAAFGANGVILPERRSASVTAAAWKVSAGAAAHLPVARVV 235

Query: 194 NLTDALQKMHSWGFQTIGLSSDSKKPL-EQEIKNDKIALILGAEGKGLRPKTQETATSMA 252
           NL  A+Q +   G+  IGL     K + E   + D + ++LG+EGKG+   T+E   ++A
Sbjct: 236 NLNKAIQGLRERGWYAIGLDGGGDKLVGETGFETDPLVVVLGSEGKGMSRLTREACDAIA 295

Query: 253 HLHMPGIIKALNVSNAAAVALYITQN 278
            + +   +++LN S AA ++LY   N
Sbjct: 296 GIPISSAVESLNASVAAGISLYAVAN 321


>gi|227513728|ref|ZP_03943777.1| TrmH family tRNA/rRNA methyltransferase [Lactobacillus buchneri
           ATCC 11577]
 gi|227083047|gb|EEI18359.1| TrmH family tRNA/rRNA methyltransferase [Lactobacillus buchneri
           ATCC 11577]
          Length = 255

 Score =  107 bits (268), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 73/245 (29%), Positives = 126/245 (51%), Gaps = 14/245 (5%)

Query: 41  RHTSQPENLFLYGVHTVSAAL--NNPSRKIFQLLATKNALARLDWDANLPHP--FPVKTV 96
           +H  + E  F+ G H V AAL  ++P  K+F     K     +     L       +  V
Sbjct: 2   KHDQENEE-FVMGRHPVVAALKSDSPVNKVFIQTGIKKDENIISEILKLARKKRLVISEV 60

Query: 97  PPQTIDKIVGKEAVHQGLALETAPLLSPTLDAV-RNSQ------LLMVLDHVNDPHNIGA 149
           P Q +D++   +  HQG+ L  A     T+D +  N++        ++LD++ DPHN+G+
Sbjct: 61  PKQKLDRLSAGQN-HQGVVLSVAAFEYATVDDLFANAKKQGIKPFFVILDNIEDPHNLGS 119

Query: 150 ILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQT 209
           I+R+A A    GII  K  +   +AV+AK+++GA+E +P  R++NL   ++++   G   
Sbjct: 120 IIRTADAAGVSGIIIPKHRAVGLTAVVAKTSAGAIERVPVARVTNLAATIKELKGRGMWV 179

Query: 210 IGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAA 269
            G   +       + +   +A+I+G EGKG+ P  ++    M  + M G I++LN S AA
Sbjct: 180 FGTDIEGTDYRRWDARG-SVAIIIGNEGKGISPLIKKQVDEMLTIPMVGDIQSLNASVAA 238

Query: 270 AVALY 274
           +V +Y
Sbjct: 239 SVLIY 243


>gi|159029966|emb|CAO90345.1| unnamed protein product [Microcystis aeruginosa PCC 7806]
          Length = 288

 Score =  107 bits (267), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 59/181 (32%), Positives = 106/181 (58%), Gaps = 8/181 (4%)

Query: 101 IDKIVGKEAVHQGLALETAPL----LSPTLDAVRNSQ---LLMVLDHVNDPHNIGAILRS 153
           +D+I  K A HQG+A + +P     L+  ++  +      ++++ + + DPHN+GAI+R+
Sbjct: 97  LDQITNK-ANHQGIAAQMSPYDYIELADLIEKAKGKSRHPVIVIAEGITDPHNLGAIIRT 155

Query: 154 AVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLS 213
           A A  C G++  +R +   ++ + K A+GALE++P  R+ NL  AL+++ + GF   G +
Sbjct: 156 AEAMGCQGVVIPQRRAAGVTSTVMKVAAGALEYLPVARVVNLNRALEELKAAGFWLYGTA 215

Query: 214 SDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVAL 273
           + + K L        I L++G+EG+GL   TQ++   +  + + G   +LN S AAA+AL
Sbjct: 216 AKTGKSLHTINLTGAIGLVVGSEGEGLSLLTQKSCDELVSIPLAGKTPSLNASVAAAMAL 275

Query: 274 Y 274
           Y
Sbjct: 276 Y 276


>gi|297623842|ref|YP_003705276.1| RNA methyltransferase [Truepera radiovictrix DSM 17093]
 gi|297165022|gb|ADI14733.1| RNA methyltransferase, TrmH family, group 3 [Truepera radiovictrix
           DSM 17093]
          Length = 241

 Score =  107 bits (267), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 69/191 (36%), Positives = 107/191 (56%), Gaps = 12/191 (6%)

Query: 93  VKTVPPQTIDKIVGKEAVHQGLALETAPLLS------PTLDAVRNSQ--LLMVLDHVNDP 144
           ++ VP   +D+ + K   HQG+  E  P LS      P   A R  +  LL++LD + DP
Sbjct: 46  LERVPRTQLDQAL-KTTRHQGVVAEL-PELSYADPEAPFTRAARRGEKPLLVLLDGITDP 103

Query: 145 HNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHS 204
           HN GAI+RSA      G++T +R S   SAV+AK ++GA  H+P +++ NL   ++ + +
Sbjct: 104 HNYGAIIRSAEVLGAHGVVTEERRSAPLSAVVAKVSAGASSHLPLVQVKNLPRYMEALKA 163

Query: 205 WGFQTIGLSSDSKKPLEQEIKNDK-IALILGAEGKGLRPKTQETATSMAHLHMPGIIKAL 263
            G    G S D+   L Q++  D+  AL++GAEG G+R   +ET   +  + M G + +L
Sbjct: 164 RGVWLYGASGDAAA-LPQQLDWDRPAALVIGAEGAGMRRLVRETCDELVAIPMRGQVASL 222

Query: 264 NVSNAAAVALY 274
           N S AA + LY
Sbjct: 223 NASVAAGILLY 233


>gi|41406577|ref|NP_959413.1| hypothetical protein MAP0479 [Mycobacterium avium subsp.
           paratuberculosis K-10]
 gi|81414895|sp|Q743W2|Y479_MYCPA RecName: Full=Uncharacterized tRNA/rRNA methyltransferase MAP_0479
 gi|41394926|gb|AAS02796.1| hypothetical protein MAP_0479 [Mycobacterium avium subsp.
           paratuberculosis K-10]
          Length = 309

 Score =  107 bits (267), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 83/264 (31%), Positives = 135/264 (51%), Gaps = 15/264 (5%)

Query: 21  AKLRRNHRDYKKMQSFNQK-SRHTSQPENLFLYGVHTVSAALNN--PSRKIFQLLATKNA 77
           A LR NH   K+ QS  ++ ++ T + E +   G + V   L    P+  ++  L T+ A
Sbjct: 41  AHLRPNHPAAKRAQSPPRRPAKRTEETETVL--GRNPVLECLRAGVPATALYVALGTE-A 97

Query: 78  LARLDWDAN--LPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLL----SPTLDAVRN 131
             RL    +        +  VP   +D++ G   +HQG+AL+  P +       L+A   
Sbjct: 98  DERLTESVSRAADSGISILEVPRADLDRMTGNH-LHQGIALQVPPYIYAHPDDLLEAAAG 156

Query: 132 S--QLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPY 189
           S   LL+ LD+++DP N+GAI+RS  AF   G++  +R S S +AV  ++++GA   IP 
Sbjct: 157 SLPALLVALDNISDPRNLGAIVRSVAAFGGHGVLIPQRRSASVTAVAWRTSAGAAARIPV 216

Query: 190 IRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETAT 249
            R +NLT  LQ     G + IGL +     L+    +D + +++G+EGKGL    ++   
Sbjct: 217 ARATNLTRTLQDWADRGLRVIGLDAGGDTMLDDLDGSDPLVVVVGSEGKGLSRLVRQNCD 276

Query: 250 SMAHLHMPGIIKALNVSNAAAVAL 273
            +  + M G  ++LN S AA V L
Sbjct: 277 EVVSIPMAGSAESLNASVAAGVVL 300


>gi|331007603|ref|ZP_08330749.1| 23S rRNA (guanosine-2'-O-) -methyltransferase rlmB [gamma
           proteobacterium IMCC1989]
 gi|330418581|gb|EGG93101.1| 23S rRNA (guanosine-2'-O-) -methyltransferase rlmB [gamma
           proteobacterium IMCC1989]
          Length = 251

 Score =  107 bits (267), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 76/240 (31%), Positives = 125/240 (52%), Gaps = 18/240 (7%)

Query: 50  FLYGVHTVSAALNNPSRKI--FQLLATKNALARLDWDANLPHP--FPVKTVPPQTIDKIV 105
            +YG+H V A ++   ++I    LL  +N   RL    ++       V+TV  + +D +V
Sbjct: 7   IVYGLHAVQALVDGSPQRIQTLWLLKGRND-QRLQSIRSVAEKSRITVRTVAREKLDGMV 65

Query: 106 GKEAVHQGLALETAPL--------LSPTLDAVRNSQLL---MVLDHVNDPHNIGAILRSA 154
             E  HQG+      +        L   L  ++ S ++   +VLD V DPHN+GA LRSA
Sbjct: 66  --EGNHQGVIASVVNVTEVYDEDYLKSRLPKMKESGVIPFILVLDGVTDPHNLGACLRSA 123

Query: 155 VAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSS 214
            A     +I  K  S S +  + K A GA E +P +R++NL+  L+ + S G   +G + 
Sbjct: 124 EAAGVQFVIVPKDNSASLTPTVVKVACGAAEVLPLVRVTNLSRTLEWLQSQGVWLVGAAG 183

Query: 215 DSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
           ++++   Q      +A+++GAEGKGLR  T+E   S+  + M G + +LNVS A+ + L+
Sbjct: 184 EAEQDHYQMNLTGPLAIVMGAEGKGLRRLTRERCDSLIRIPMMGEVSSLNVSVASGICLF 243


>gi|262189979|ref|ZP_06048286.1| 23S rRNA (guanosine-2'-O-) -methyltransferase RlmB [Vibrio cholerae
           CT 5369-93]
 gi|262034136|gb|EEY52569.1| 23S rRNA (guanosine-2'-O-) -methyltransferase RlmB [Vibrio cholerae
           CT 5369-93]
          Length = 247

 Score =  107 bits (267), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 76/244 (31%), Positives = 120/244 (49%), Gaps = 26/244 (10%)

Query: 48  NLFLYGVHTVSAALN-NPSRKIF----------QLLATKNALARLDWDANLPHPFPVKTV 96
           N  +YG+H V+A L  +P+R +           +LL   N L RL           ++ +
Sbjct: 3   NELIYGIHAVNAVLQRDPARFVEAYVLKGRQDDRLLPVLNELMRLG--------VSIQEM 54

Query: 97  PPQTIDKIVGKEAVHQGLALETAP---LLSPTLD---AVRNSQLLMVLDHVNDPHNIGAI 150
             + +D    + A HQG+     P   L    LD   A     LL+VLD V DPHN+GA 
Sbjct: 55  SRKALDD-KAEGANHQGVIARVKPARQLNENDLDDILAQHEQPLLLVLDGVTDPHNLGAC 113

Query: 151 LRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTI 210
           LR+A A     +I  K  S   +A ++K A GA E +P +R++NL   ++ +   G   +
Sbjct: 114 LRNADAAGVAAVIVPKDKSAPLTATVSKVACGAAETVPLVRVTNLARTMRALQEKGVWFV 173

Query: 211 GLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAA 270
           G + ++   + Q      +A+++GAEG G+R  T+ET   +  + M G + +LNVS A  
Sbjct: 174 GTAGEATHDIYQSKLTGPLAIVMGAEGDGMRRLTRETCDDLIKIPMAGSVSSLNVSVACG 233

Query: 271 VALY 274
           V L+
Sbjct: 234 VCLF 237


>gi|330828261|ref|YP_004391213.1| TrmH family RNA methyltransferase [Aeromonas veronii B565]
 gi|328803397|gb|AEB48596.1| RNA methyltransferase, TrmH family, group 3 [Aeromonas veronii
           B565]
          Length = 249

 Score =  107 bits (267), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 78/245 (31%), Positives = 123/245 (50%), Gaps = 28/245 (11%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPF---------PVKTVPPQT 100
            +YG+H V+A L     +  ++ A K        D +   P           V++V  +T
Sbjct: 5   LIYGIHAVTALLERTPERFIEVWALKGR------DDDRLQPLLTELESLGLKVQSVNRKT 58

Query: 101 ID-KIVGKEAVHQGLA--LETAPLLSP-----TLD--AVRNSQ-LLMVLDHVNDPHNIGA 149
           +D K  G    HQG+   ++ AP L+       LD  A + SQ  L+VLD V DPHN+GA
Sbjct: 59  LDDKAEGNN--HQGIMARVKEAPKLAEHDLASLLDELAAQQSQPFLLVLDGVTDPHNLGA 116

Query: 150 ILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQT 209
            LRSA A     +I  +  +   + ++ K A GA E +P I+++NL   L+++   G   
Sbjct: 117 CLRSADAAGAHAVIVPRDKATGLTPIVRKVACGAAEVVPLIQVTNLARTLRELQERGVWI 176

Query: 210 IGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAA 269
           +G + ++   L Q      +AL++GAEGKG+R  T+E    +  + M G + +LNVS A 
Sbjct: 177 VGTAGEADHDLYQAKLTGPMALVMGAEGKGMRRLTREHCDELVSIPMAGAVSSLNVSVAT 236

Query: 270 AVALY 274
            V L+
Sbjct: 237 GVCLF 241


>gi|295694816|ref|YP_003588054.1| RNA methyltransferase, TrmH family, group 3 [Bacillus tusciae DSM
           2912]
 gi|295410418|gb|ADG04910.1| RNA methyltransferase, TrmH family, group 3 [Bacillus tusciae DSM
           2912]
          Length = 268

 Score =  107 bits (267), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 55/171 (32%), Positives = 90/171 (52%), Gaps = 7/171 (4%)

Query: 111 HQGLALETAPLLSPTLDAV-------RNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGII 163
           HQG+  + AP     LD         R   L ++LD + DPHN+G+ILR+A A + DG++
Sbjct: 89  HQGVMADVAPFAYADLDECLRAAKLHRRPGLFVLLDGIEDPHNLGSILRTAEACAVDGVV 148

Query: 164 TTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQE 223
             KR + + +  + K+++GA E +P IR+ NL   +  +   G++ +G  ++ +      
Sbjct: 149 VPKRRAAAVNETVVKASAGAAEFVPVIRVGNLGQTILALKRSGYRVVGADTEGECDYTDV 208

Query: 224 IKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
                 AL++G EGKGL    +E    + H+ M G + +LN   AA V LY
Sbjct: 209 DYRVPTALVIGGEGKGLGRLVRERCDEVVHIPMAGRVNSLNAGVAAGVLLY 259


>gi|152991818|ref|YP_001357539.1| RNA methyltransferase [Sulfurovum sp. NBC37-1]
 gi|151423679|dbj|BAF71182.1| RNA methyltransferase, TrmH family [Sulfurovum sp. NBC37-1]
          Length = 234

 Score =  107 bits (267), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 64/166 (38%), Positives = 95/166 (57%), Gaps = 6/166 (3%)

Query: 111 HQGLALETAPLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSP 170
           HQGL LE + L  P+L  V+    L++LD + D  NIGAI+RSA A   D +I T     
Sbjct: 66  HQGLLLEISELEQPSLSDVKREDFLVILDGLTDVGNIGAIVRSAYALGADAVIATGVKQL 125

Query: 171 SESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIG--LSSDSKKPLEQEIKNDK 228
           +  A+ A+++SGAL  +P++ I N+ D   ++H  GF+  G  +  D+ + +E E K   
Sbjct: 126 NFEAI-ARTSSGALLDMPFLLIPNILDVCNELHQVGFKLYGAAMEGDAVQLMEFERKR-- 182

Query: 229 IALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
            ALILG+EGKGL  K Q     +  + M     +LNVS AAA+ ++
Sbjct: 183 -ALILGSEGKGLSKKAQGKIDHLISIEMKHAFDSLNVSAAAAILIH 227


>gi|320187058|gb|EFW61769.1| 23S rRNA guanosine-2'-O--methyltransferase [Shigella flexneri CDC
           796-83]
 gi|332087040|gb|EGI92174.1| RNA 2'-O ribose methyltransferase substrate binding family protein
           [Shigella boydii 3594-74]
          Length = 240

 Score =  107 bits (267), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 76/238 (31%), Positives = 115/238 (48%), Gaps = 18/238 (7%)

Query: 50  FLYGVHTVSAALNN-PSR--KIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVG 106
            +YG+H V A L   P R  ++F L   ++   RL     L H    + V  Q  ++   
Sbjct: 1   MIYGIHAVQALLERAPERFQEVFILKGREDK--RL---LPLIHALEAQGVVIQLANRQYL 55

Query: 107 KE----AVHQGLALETAPLLS------PTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVA 156
            E    AVHQG+     P         P L A  +   L++LD V DPHN+GA LRSA A
Sbjct: 56  DEKSDGAVHQGIIARVKPGRQYQENDLPDLIASLDQPFLLILDGVTDPHNLGACLRSADA 115

Query: 157 FSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDS 216
                +I  K  S   +A   K A GA E +P IR++NL   ++ +       +G + ++
Sbjct: 116 AGVHAVIVPKDRSAQLNATAKKVACGAAESVPLIRVTNLVRTMRMLQEENIWIVGTAGEA 175

Query: 217 KKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
              L Q     ++AL++GAEG+G+R  T+E    +  + M G + +LNVS A  + L+
Sbjct: 176 DHTLYQSKMTGRLALVMGAEGEGMRRLTREHCDELISIPMAGSVSSLNVSVATGICLF 233


>gi|242372749|ref|ZP_04818323.1| RNA methyltransferase [Staphylococcus epidermidis M23864:W1]
 gi|242349522|gb|EES41123.1| RNA methyltransferase [Staphylococcus epidermidis M23864:W1]
          Length = 255

 Score =  107 bits (267), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 60/189 (31%), Positives = 105/189 (55%), Gaps = 9/189 (4%)

Query: 93  VKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQ-------LLMVLDHVNDPH 145
           V+TVP   +D +    A HQG+A   AP      D    SQ        +M+LD + DPH
Sbjct: 56  VQTVPKSKLDFL--SNAPHQGVAALVAPYEYADFDQFLQSQKDKDGFSTVMILDGLEDPH 113

Query: 146 NIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSW 205
           N+G+ILR+A A   DG+I  KR S + +  +AK+++GA++H+P IR++NL+  + ++   
Sbjct: 114 NLGSILRTADASGVDGVIIPKRRSVALTQTVAKASTGAIQHVPVIRVTNLSKTIDELKDN 173

Query: 206 GFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNV 265
           GF   G ++++         +  +A+++G+EG+G+     +       + M G + +LN 
Sbjct: 174 GFWVAGTAANNATDYRDLQADMSLAIVIGSEGQGMSRLVSDKCDFYIKIPMVGHVNSLNA 233

Query: 266 SNAAAVALY 274
           S AA++ +Y
Sbjct: 234 SVAASLMMY 242


>gi|311114079|ref|YP_003985300.1| RNA methyltransferase [Gardnerella vaginalis ATCC 14019]
 gi|310945573|gb|ADP38277.1| RNA methyltransferase [Gardnerella vaginalis ATCC 14019]
          Length = 360

 Score =  107 bits (267), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 54/146 (36%), Positives = 86/146 (58%), Gaps = 1/146 (0%)

Query: 134 LLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRIS 193
           L + LD V DP N+GA++RSA AF  +G+I  +R S S +A   K ++GA  H+P  R+ 
Sbjct: 205 LFIALDGVTDPQNLGAVIRSAAAFGANGVILPERRSASVTAAAWKVSAGAAAHLPVARVV 264

Query: 194 NLTDALQKMHSWGFQTIGLSSDSKKPL-EQEIKNDKIALILGAEGKGLRPKTQETATSMA 252
           NL  A+Q +   G+  IGL     K + E   + D + ++LG+EGKG+   T+E   ++A
Sbjct: 265 NLNKAIQGLRERGWYAIGLDGGGDKLVGETGFETDPLVVVLGSEGKGMSRLTREACDAIA 324

Query: 253 HLHMPGIIKALNVSNAAAVALYITQN 278
            + +   +++LN S AA ++LY   N
Sbjct: 325 GIPISSAVESLNASVAAGISLYAVAN 350


>gi|148828043|ref|YP_001292796.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Haemophilus
           influenzae PittGG]
 gi|148719285|gb|ABR00413.1| hypothetical protein CGSHiGG_07820 [Haemophilus influenzae PittGG]
          Length = 246

 Score =  107 bits (267), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 75/237 (31%), Positives = 127/237 (53%), Gaps = 17/237 (7%)

Query: 51  LYGVHTVSAALNNPSRKIFQLLATKNAL-ARLDWDANLPHPFP--VKTVPPQTIDKIVGK 107
           +YG+H V++ L +   ++ ++   K     RL    N  +     V+ V  QT+DK    
Sbjct: 5   IYGIHAVNSILTHSPERLIEVFVLKGREDKRLQPLLNELYSLGIGVQFVNRQTLDKKADG 64

Query: 108 EAVHQGLA--LETAPLLSPT-LDAV---RNSQLLMVLDHVNDPHNIGAILRSAVAFSCDG 161
           E VHQG+   ++ A  L+   LD +   + + L++VLD V DPHN+GA LR+A A   + 
Sbjct: 65  E-VHQGIIARVQAAKELNENDLDEILSNKQNPLVLVLDGVTDPHNLGACLRTADAAGAEA 123

Query: 162 IITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHS----WGFQTIGLSSDSK 217
           +I  K  S   ++++ K A GA E +P IR++NL+  L+ +      W    +G + ++ 
Sbjct: 124 VIVPKDKSAQLTSIVRKVACGAAETVPLIRVTNLSRTLRDLQQNHNIW---VVGTAGEAT 180

Query: 218 KPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
           + + Q      +AL++GAEG+G+R  T+E    +  + M G + +LNVS A  V L+
Sbjct: 181 ETIYQSKLTGPLALVMGAEGEGMRRLTREHCDQLISIPMAGSVSSLNVSVATGVCLF 237


>gi|157368686|ref|YP_001476675.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Serratia
           proteamaculans 568]
 gi|157320450|gb|ABV39547.1| RNA methyltransferase, TrmH family, group 3 [Serratia
           proteamaculans 568]
          Length = 243

 Score =  107 bits (267), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 72/243 (29%), Positives = 117/243 (48%), Gaps = 28/243 (11%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLATKN--------ALARLDWDANLPHPFPVKTVPPQTI 101
            +YG+H V A L+N  ++  ++   K          +A L+          ++    Q +
Sbjct: 4   IIYGIHAVKALLDNDPQRFLEVFILKGRDDRRLQPLIAELEATG-----IVIQVANRQWL 58

Query: 102 DKIVGKEAVHQGLALET----------APLLSPTLDAVRNSQLLMVLDHVNDPHNIGAIL 151
           D+ V + AVHQG+               P L  ++D    +  L+VLD V DPHN+GA L
Sbjct: 59  DEKV-EGAVHQGIIARVREGRQYQENDLPALLESVD----TPFLLVLDGVTDPHNLGACL 113

Query: 152 RSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIG 211
           RSA A     +I  +  S   +A   K A GA E++P IR++NL   L+ +       +G
Sbjct: 114 RSADAAGVHAVIVPRDRSAQLNATAKKVACGAAENVPLIRVTNLARTLRLLQEMNVWVVG 173

Query: 212 LSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAV 271
            + ++   L Q      +AL++GAEG+G+R  T+E    +  + M G + +LNVS A  +
Sbjct: 174 TAGEADHTLFQSKMTGPMALVMGAEGEGMRRLTREHCDELISIPMAGTVSSLNVSVATGI 233

Query: 272 ALY 274
            L+
Sbjct: 234 CLF 236


>gi|254230075|ref|ZP_04923473.1| RNA methyltransferase, TrmH family, group 3 [Vibrio sp. Ex25]
 gi|262393043|ref|YP_003284897.1| 23S rRNA (guanosine-2'-O-) -methyltransferase RlmB [Vibrio sp.
           Ex25]
 gi|151937409|gb|EDN56269.1| RNA methyltransferase, TrmH family, group 3 [Vibrio sp. Ex25]
 gi|262336637|gb|ACY50432.1| 23S rRNA (guanosine-2'-O-) -methyltransferase RlmB [Vibrio sp.
           Ex25]
          Length = 248

 Score =  107 bits (267), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 76/240 (31%), Positives = 119/240 (49%), Gaps = 18/240 (7%)

Query: 48  NLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLP-------HPFPVKTVPPQT 100
           N F+YG+H V A L     +  +    K    R D D  +P           ++ +  +T
Sbjct: 3   NEFIYGIHAVKAVLEREPERFIEAYVLK---GRQD-DRLMPILNDLQVCGVSIQQMTRKT 58

Query: 101 IDKIVGKEAVHQGLALETAP---LLSPTLD---AVRNSQLLMVLDHVNDPHNIGAILRSA 154
           +D    + A HQG+     P   L    +D   A   S LL+VLD V DPHN+GA LR+A
Sbjct: 59  LDD-KARGANHQGIIARVKPAKQLNENDIDDILAQHESPLLLVLDGVTDPHNLGACLRNA 117

Query: 155 VAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSS 214
            A     II  K  S   +A ++K A GA E +P IR++NL   ++ +   G   +G + 
Sbjct: 118 DAAGAAAIIVPKDRSAPMNATVSKVACGAAEVVPLIRVTNLARTMRTLQEKGIWFVGTAG 177

Query: 215 DSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
           ++   + Q      +A+++GAEG G+R  T+ET   +  + M G + +LNVS A+ + L+
Sbjct: 178 EATHDIYQAKLTGPLAIVMGAEGDGMRRLTRETCDDLIKIPMAGSVSSLNVSVASGICLF 237


>gi|117923731|ref|YP_864348.1| RNA methyltransferase [Magnetococcus sp. MC-1]
 gi|117607487|gb|ABK42942.1| 23S rRNA Gm-2251 2'-O-methyltransferase [Magnetococcus sp. MC-1]
          Length = 246

 Score =  107 bits (267), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 68/195 (34%), Positives = 106/195 (54%), Gaps = 11/195 (5%)

Query: 91  FPVKTVPPQTIDKI----VGKEAVHQGLALETAPLLSPT----LDAVRNSQ--LLMVLDH 140
           F  + VP Q  ++     +     HQG+    AP  + +    LD V  ++  LL++LD 
Sbjct: 44  FRARGVPIQFCERTAMDRMADGGAHQGVIARCAPREAMSWDDLLDVVEKAKQPLLVILDG 103

Query: 141 VNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQ 200
           V DPHN+GAI+RSA AF    +I  K  +   +A   K+++GA E +  IR++NL  A++
Sbjct: 104 VEDPHNLGAIMRSAEAFGALAVILPKDRTAPLNAGAIKASAGAAERLDLIRVTNLARAIE 163

Query: 201 KMHSWGFQTIGLSSDSKKPLEQEIK-NDKIALILGAEGKGLRPKTQETATSMAHLHMPGI 259
           ++       IGL+ ++  PL   +     +AL++G EG GLR  T+E    +A + M G 
Sbjct: 164 QLQQRNVWVIGLAGEAGAPLIGTLDCKGPLALVMGNEGSGLRRLTRERCDQLAAIPMGGG 223

Query: 260 IKALNVSNAAAVALY 274
           + +LNVS A  VALY
Sbjct: 224 VGSLNVSVATGVALY 238


>gi|260102409|ref|ZP_05752646.1| TrmH family RNA methyltransferase [Lactobacillus helveticus DSM
           20075]
 gi|260083777|gb|EEW67897.1| TrmH family RNA methyltransferase [Lactobacillus helveticus DSM
           20075]
 gi|323465877|gb|ADX69564.1| RNA methyltransferase, TrmH family, group 3 [Lactobacillus
           helveticus H10]
          Length = 250

 Score =  107 bits (267), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 65/193 (33%), Positives = 103/193 (53%), Gaps = 9/193 (4%)

Query: 93  VKTVPPQTIDKIVGKEAVHQGLALETAPL----LSPTLDAVRNSQ---LLMVLDHVNDPH 145
           ++ VP   +D++V     HQGL L  +      LS  LD   +      L++LD + DPH
Sbjct: 54  IQNVPKNKLDRLV-DGGNHQGLVLAISSFEYADLSKLLDQFDDEGKEPFLLMLDSIEDPH 112

Query: 146 NIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSW 205
           N+G+ILRSA A   DGII  KR++   ++V+AK+++GA++++P  R++NL    +++   
Sbjct: 113 NLGSILRSADATGVDGIIIPKRHATGLTSVVAKTSTGAIDYVPVARVNNLVQTTKELKKR 172

Query: 206 GFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNV 265
           G+   G         E   K  K  L++G EGKG+ P  ++       L M G +++LN 
Sbjct: 173 GYWIFGTDMAGTDYREWNAKG-KTVLVIGNEGKGIAPLLKKQMDQTITLPMIGHVQSLNA 231

Query: 266 SNAAAVALYITQN 278
           S A  V LY   N
Sbjct: 232 SVATGVLLYQAYN 244


>gi|161506928|ref|YP_001576882.1| putative tRNA/rRNA methyltransferase [Lactobacillus helveticus DPC
           4571]
 gi|160347917|gb|ABX26591.1| putative tRNA/rRNA methyltransferase [Lactobacillus helveticus DPC
           4571]
          Length = 250

 Score =  107 bits (267), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 65/193 (33%), Positives = 103/193 (53%), Gaps = 9/193 (4%)

Query: 93  VKTVPPQTIDKIVGKEAVHQGLALETAPL----LSPTLDAVRNSQ---LLMVLDHVNDPH 145
           ++ VP   +D++V     HQGL L  +      LS  LD   +      L++LD + DPH
Sbjct: 54  IQNVPKNKLDRLV-DGGNHQGLVLAISSFEYADLSKLLDQFDDEGKEPFLLMLDSIEDPH 112

Query: 146 NIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSW 205
           N+G+ILRSA A   DGII  KR++   ++V+AK+++GA++++P  R++NL    +++   
Sbjct: 113 NLGSILRSADATGVDGIIIPKRHATGLTSVVAKTSTGAIDYVPVARVNNLVQTTKELKKR 172

Query: 206 GFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNV 265
           G+   G         E   K  K  L++G EGKG+ P  ++       L M G +++LN 
Sbjct: 173 GYWIFGTDMAGTDYREWNAKG-KTVLVIGNEGKGIAPLLKKQMDQTITLPMIGHVQSLNA 231

Query: 266 SNAAAVALYITQN 278
           S A  V LY   N
Sbjct: 232 SVATGVLLYQAYN 244


>gi|227502089|ref|ZP_03932138.1| possible tRNA/rRNA methyltransferase [Corynebacterium accolens ATCC
           49725]
 gi|227077148|gb|EEI15111.1| possible tRNA/rRNA methyltransferase [Corynebacterium accolens ATCC
           49725]
          Length = 316

 Score =  107 bits (267), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 75/279 (26%), Positives = 138/279 (49%), Gaps = 26/279 (9%)

Query: 7   KKSEKIFSLKDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNN--P 64
           K  ++++  K  H AKL R  R+           RH  +   + + G + V   L+   P
Sbjct: 40  KAEDRVYHAK--HKAKLERERRN---------SGRHQKETAEMVV-GRNPVIECLHAKVP 87

Query: 65  SRKIFQLLATKNALARLDWDANLPHP--FPVKTVPPQTIDKIVGKEAVHQGLALETAPL- 121
           +  ++    T+N   RL    ++ +    P+  V    +D++ G   +HQG+ L+  P  
Sbjct: 88  ATTLYIAAGTRND-KRLSEAVSMCNTRNIPIIEVQRHEMDRMTGN-GMHQGIGLQIPPYK 145

Query: 122 LSPTLDAVRNS------QLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAV 175
            +   D + N+       + ++LD++ DP N+GA++RS  AF  DG+I  +R S S +AV
Sbjct: 146 YAAVEDLIANAAENPRPGMFVILDNITDPRNLGAVIRSVAAFGGDGVIIPERRSASVTAV 205

Query: 176 LAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQ-EIKNDKIALILG 234
             ++++G    +P  R +N+T  +++    G+Q +GL +     L+  E   D + +++G
Sbjct: 206 AWRTSAGTAARLPVARATNITRTVKEFQKNGYQVVGLDAGGDHTLDTYEGGTDPVVIVIG 265

Query: 235 AEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVAL 273
           +EGKG+     ET   +  + M G +++LN S AA   L
Sbjct: 266 SEGKGISRLVSETCDVLMSIPMTGWVESLNASVAAGSVL 304


>gi|296112249|ref|YP_003626187.1| SpoU family rRNA methylase [Moraxella catarrhalis RH4]
 gi|295919943|gb|ADG60294.1| SpoU family rRNA methylase [Moraxella catarrhalis RH4]
 gi|326560717|gb|EGE11085.1| SpoU family rRNA methylase [Moraxella catarrhalis 46P47B1]
 gi|326561758|gb|EGE12093.1| SpoU family rRNA methylase [Moraxella catarrhalis 7169]
 gi|326562300|gb|EGE12626.1| SpoU family rRNA methylase [Moraxella catarrhalis 103P14B1]
 gi|326563077|gb|EGE13350.1| SpoU family rRNA methylase [Moraxella catarrhalis 12P80B1]
 gi|326569018|gb|EGE19087.1| SpoU family rRNA methylase [Moraxella catarrhalis BC1]
 gi|326571709|gb|EGE21722.1| SpoU family rRNA methylase [Moraxella catarrhalis BC8]
 gi|326571838|gb|EGE21844.1| SpoU family rRNA methylase [Moraxella catarrhalis BC7]
 gi|326574377|gb|EGE24320.1| SpoU family rRNA methylase [Moraxella catarrhalis CO72]
 gi|326575504|gb|EGE25429.1| SpoU family rRNA methylase [Moraxella catarrhalis 101P30B1]
 gi|326578077|gb|EGE27937.1| SpoU family rRNA methylase [Moraxella catarrhalis O35E]
          Length = 290

 Score =  107 bits (267), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 86/290 (29%), Positives = 138/290 (47%), Gaps = 37/290 (12%)

Query: 6   KKKSEKI--FSLKDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNN 63
           KK+S+K    S K S   KL + H   K            ++P+N + YG+H VS  +  
Sbjct: 2   KKRSQKTDNQSFKSSSKEKLNKPHHQAKP-----------AKPKNPYFYGIHAVSMLIKR 50

Query: 64  PSRKIFQLLATKNALARLDWDANLPHPFPVKTVP----------PQTIDKIVGKEAVHQG 113
              ++  L        R D   +  H   V++             + + ++ G +  HQG
Sbjct: 51  RPEEVLGLFIQ----LRDDGQMSSEHQLIVQSAKHFGISIQNAHRERLTELCGSQQ-HQG 105

Query: 114 LAL--ETAPLLSPT-LD--AVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRY 168
           +     TAP+   T LD   +++  L +VLD + D HN+GA LR+A A   D +I  +  
Sbjct: 106 VVALARTAPMADETILDNLLMQDDVLFLVLDQITDAHNLGACLRTACAMGVDAVILPRHQ 165

Query: 169 SPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSD-SKKPLEQEIKND 227
           S   +  +AK + GA E IP I ++NL   L+KM   G    G + D S KP  +     
Sbjct: 166 SAPITPTVAKVSVGASEVIPVISVTNLARTLEKMKKSGVFIFGTALDKSAKPAFECDFGG 225

Query: 228 KIALILGAEGKGLRPKTQETATSMAHLHMPGII---KALNVSNAAAVALY 274
           K+A+I+G+EG G+R  TQ    ++ ++ M  ++   ++LNVS A  + LY
Sbjct: 226 KVAIIMGSEGDGMRRLTQTMCDTLVYIPMAEVLDRPQSLNVSVATGMVLY 275


>gi|282896448|ref|ZP_06304469.1| RNA methyltransferase TrmH, group 3 [Raphidiopsis brookii D9]
 gi|281198736|gb|EFA73616.1| RNA methyltransferase TrmH, group 3 [Raphidiopsis brookii D9]
          Length = 324

 Score =  107 bits (267), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 73/248 (29%), Positives = 129/248 (52%), Gaps = 20/248 (8%)

Query: 41  RHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPF--------P 92
           +++ + +N  +YG + V +AL +  R + +L  T    +RL +D    H           
Sbjct: 59  KNSEEQDNDLIYGRYPVLSALES-HRNLNRLWIT----SRLRYDPRFHHLVLQAKDNGTV 113

Query: 93  VKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTL-DAVRNSQ-----LLMVLDHVNDPHN 146
           +  V P+ +D+I    A HQG+A + AP     L D +  +Q     +++V D + DPHN
Sbjct: 114 IDEVDPKRLDQITNG-ANHQGVAAQIAPYTYTELEDLISQAQTVSEPVIVVADGITDPHN 172

Query: 147 IGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWG 206
           +GAI+R+A A    G++  +R +   ++ + K A+GALE+    R+ NL+ AL+++   G
Sbjct: 173 LGAIIRTAEAIGAQGLVIPQRRAVGITSTVVKVAAGALENFSVARVVNLSRALEQLKESG 232

Query: 207 FQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVS 266
           F   G ++   +PL          L++G+EG+GL   TQ++   +  + + G   +LN S
Sbjct: 233 FWIYGTAATGSEPLHSVRFTGSTVLVVGSEGEGLSMLTQKSCDVLVSIPLQGKTPSLNAS 292

Query: 267 NAAAVALY 274
            A  +ALY
Sbjct: 293 VATGMALY 300


>gi|307132421|ref|YP_003884437.1| 23S rRNA (Gm2251)-methyltransferase [Dickeya dadantii 3937]
 gi|306529950|gb|ADM99880.1| 23S rRNA (Gm2251)-methyltransferase [Dickeya dadantii 3937]
          Length = 244

 Score =  107 bits (267), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 74/237 (31%), Positives = 113/237 (47%), Gaps = 16/237 (6%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLATKNALAR------LDWDANLPHPFPVKTVPPQTIDK 103
            +YG+H V A L    ++  ++   K    R       + +AN      V+    Q +D 
Sbjct: 4   IIYGIHAVKALLEQDPQRFLEVFTLKGREDRRLQPLIAELEAN---GIAVQVANRQWLDD 60

Query: 104 IVGKEAVHQGLALETAPLLS------PTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAF 157
            V + AVHQG+               P L A  ++  L+VLD V DPHN+GA LRSA A 
Sbjct: 61  KV-EGAVHQGIVARVKEGRQYQENDLPGLLASLDTPFLLVLDGVTDPHNLGACLRSADAA 119

Query: 158 SCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSK 217
               +I  +  S   +A   K A GA E +P IR++NL   L+ +       +G + ++ 
Sbjct: 120 GVHAVIVPRDRSAQLNATAKKVACGAAETVPLIRVTNLARTLRFLQEQNVWIVGTAGEAD 179

Query: 218 KPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
             L Q      +AL++GAEG+G+R  T+E    +  + M G + +LNVS A  V L+
Sbjct: 180 HTLYQSKLTGPLALVMGAEGEGMRRLTREHCDELISIPMAGSVSSLNVSVATGVCLF 236


>gi|225022148|ref|ZP_03711340.1| hypothetical protein CORMATOL_02181 [Corynebacterium matruchotii
           ATCC 33806]
 gi|305680558|ref|ZP_07403366.1| RNA methyltransferase, TrmH family, group 3 [Corynebacterium
           matruchotii ATCC 14266]
 gi|224945081|gb|EEG26290.1| hypothetical protein CORMATOL_02181 [Corynebacterium matruchotii
           ATCC 33806]
 gi|305660089|gb|EFM49588.1| RNA methyltransferase, TrmH family, group 3 [Corynebacterium
           matruchotii ATCC 14266]
          Length = 320

 Score =  107 bits (267), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 72/267 (26%), Positives = 126/267 (47%), Gaps = 22/267 (8%)

Query: 18  SHYAKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNN--PSRKIFQLLATK 75
           +H  KL R  RD         + RH        + G + V   L+   P+  ++    T+
Sbjct: 48  AHKRKLERQRRD---------QGRHDRSASTELVVGRNPVIECLHARVPATALYIAQGTR 98

Query: 76  NALARLDWDANLPHP--FPVKTVPPQTIDKIVGKEAVHQGLALETAPL-------LSPTL 126
           N   RL     L H    P+  VP   +D + G   +HQG+ L+  P        L  T+
Sbjct: 99  ND-DRLTEAVQLAHSRSIPLIEVPRIELDSMTGN-GLHQGVGLQIPPFEYADVFDLIGTV 156

Query: 127 DAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEH 186
              +   +++VLD++ DP N+GA++RS  AF   G++  +R S S +AV  ++++G    
Sbjct: 157 ADSKEQGMIVVLDNITDPRNLGAVIRSTAAFGGQGVVIPERRSASVTAVAWRTSAGTAAR 216

Query: 187 IPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQE 246
           +P  + +N+T  L++    G+Q +GL +      +       + +++G+EGKGL    +E
Sbjct: 217 LPVAKATNITRTLKEFQQNGYQVVGLDAGGDTTYDSYDGTGPVVIVVGSEGKGLSRLVRE 276

Query: 247 TATSMAHLHMPGIIKALNVSNAAAVAL 273
           T   +  +     +++LN S AA V L
Sbjct: 277 TCDVLVSVPTTSWVESLNASVAAGVVL 303


>gi|311029029|ref|ZP_07707119.1| 23S rRNA methyltransferase [Bacillus sp. m3-13]
          Length = 249

 Score =  107 bits (267), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 67/192 (34%), Positives = 107/192 (55%), Gaps = 15/192 (7%)

Query: 93  VKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAV------RNSQ-LLMVLDHVNDPH 145
           V+ VP + ID++V  E  HQG+    A      LD +      RN     ++LD + DPH
Sbjct: 52  VQFVPRKKIDQMV--EGNHQGVVASVAAYDYAELDDLYKAAEQRNEDPFFLILDEIEDPH 109

Query: 146 NIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSW 205
           N+G+I+R+A A    GII  KR +   +A +AKS++GA+EHIP +R++NL   + ++   
Sbjct: 110 NLGSIMRTADAVGAHGIIIPKRRAVGLTATVAKSSTGAIEHIPVVRVTNLARTVDELKER 169

Query: 206 GFQTIGLSSDSKKPLEQEIKNDK---IALILGAEGKGLRPKTQETATSMAHLHMPGIIKA 262
           G    G  +D+K  ++   K D    + LI+G+EGKG+    +E    +  L M G + +
Sbjct: 170 GLWIFG--TDAKGTVDY-TKMDGSLPLGLIIGSEGKGMARLLKEKCDFLVSLPMVGKVTS 226

Query: 263 LNVSNAAAVALY 274
           LN S AA++ +Y
Sbjct: 227 LNASVAASLLMY 238


>gi|262275145|ref|ZP_06052956.1| 23S rRNA (guanosine-2'-O-) -methyltransferase RlmB [Grimontia
           hollisae CIP 101886]
 gi|262221708|gb|EEY73022.1| 23S rRNA (guanosine-2'-O-) -methyltransferase RlmB [Grimontia
           hollisae CIP 101886]
          Length = 245

 Score =  107 bits (267), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 77/245 (31%), Positives = 120/245 (48%), Gaps = 28/245 (11%)

Query: 48  NLFLYGVHTVSAALN-NPSR--KIF--------QLLATKNALARLDWDANLPHPFPVKTV 96
           N  +YG+H V A L+ +PSR  ++F        ++L   N L+RL           ++ +
Sbjct: 3   NEMIYGIHAVKAVLDSDPSRFIEVFVLKGRQDERVLPVLNELSRLG--------VTLQEM 54

Query: 97  PPQTIDKIVGKEAVHQGLALETAPL-------LSPTLDAVRNSQLLMVLDHVNDPHNIGA 149
             + +D    K A HQGL     P        L   LD   N  LL+VLD V DPHN+GA
Sbjct: 55  SRKALDD-KAKGASHQGLIARVKPGRQYNENDLDAILDGKENP-LLLVLDGVTDPHNLGA 112

Query: 150 ILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQT 209
            LR+A A     +I  K  S   +A   K A GA E +P +R++NL   ++ +   G   
Sbjct: 113 CLRNADAAGVCAVIVPKDKSAQLNATARKVAVGAAEVVPLVRVTNLARTMRALQERGIWF 172

Query: 210 IGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAA 269
           +G + ++   +        +A+++GAEG G+R  T+ET   +  + M G + +LNVS A 
Sbjct: 173 VGTAGEATHDVYDAKLTGPLAIVMGAEGDGMRRLTRETCDDLISIPMAGSVSSLNVSVAT 232

Query: 270 AVALY 274
            + L+
Sbjct: 233 GICLF 237


>gi|225351596|ref|ZP_03742619.1| hypothetical protein BIFPSEUDO_03193 [Bifidobacterium
           pseudocatenulatum DSM 20438]
 gi|225157940|gb|EEG71223.1| hypothetical protein BIFPSEUDO_03193 [Bifidobacterium
           pseudocatenulatum DSM 20438]
          Length = 333

 Score =  107 bits (267), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 53/142 (37%), Positives = 85/142 (59%), Gaps = 1/142 (0%)

Query: 134 LLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRIS 193
           L + LD V DP N+GA++RSA AF  +G+I  +R S S +A   K ++GA  H+P  R+ 
Sbjct: 176 LFIALDGVTDPQNLGAVIRSAAAFGANGVILPERRSASVTAAAWKVSAGAAAHMPVARVV 235

Query: 194 NLTDALQKMHSWGFQTIGLSSDSKKPL-EQEIKNDKIALILGAEGKGLRPKTQETATSMA 252
           NLT A++ +   G+ ++GL       + E   + D + ++LG+EG GL    +ET  S+A
Sbjct: 236 NLTKAIESLKERGYYSVGLDGGGDALVGETGFETDPLVVVLGSEGNGLSRLVRETCDSIA 295

Query: 253 HLHMPGIIKALNVSNAAAVALY 274
            + M  ++++LN S AA + LY
Sbjct: 296 GIPMSNMVESLNASVAAGITLY 317


>gi|212716506|ref|ZP_03324634.1| hypothetical protein BIFCAT_01432 [Bifidobacterium catenulatum DSM
           16992]
 gi|212660587|gb|EEB21162.1| hypothetical protein BIFCAT_01432 [Bifidobacterium catenulatum DSM
           16992]
          Length = 333

 Score =  107 bits (267), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 53/142 (37%), Positives = 85/142 (59%), Gaps = 1/142 (0%)

Query: 134 LLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRIS 193
           L + LD V DP N+GA++RSA AF  +G+I  +R S S +A   K ++GA  H+P  R+ 
Sbjct: 176 LFIALDGVTDPQNLGAVIRSAAAFGANGVILPERRSASVTAAAWKVSAGAAAHMPVARVV 235

Query: 194 NLTDALQKMHSWGFQTIGLSSDSKKPL-EQEIKNDKIALILGAEGKGLRPKTQETATSMA 252
           NLT A++ +   G+ ++GL       + E   + D + ++LG+EG GL    +ET  S+A
Sbjct: 236 NLTKAIESLKERGYYSVGLDGGGDALVGETGFETDPLVVVLGSEGNGLSRLVRETCDSIA 295

Query: 253 HLHMPGIIKALNVSNAAAVALY 274
            + M  ++++LN S AA + LY
Sbjct: 296 GIPMSNMVESLNASVAAGITLY 317


>gi|304315921|ref|YP_003851066.1| RNA methyltransferase, TrmH family, group 3 [Thermoanaerobacterium
           thermosaccharolyticum DSM 571]
 gi|302777423|gb|ADL67982.1| RNA methyltransferase, TrmH family, group 3 [Thermoanaerobacterium
           thermosaccharolyticum DSM 571]
          Length = 248

 Score =  107 bits (267), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 73/239 (30%), Positives = 127/239 (53%), Gaps = 12/239 (5%)

Query: 45  QPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLD--WDANLPHPFPVKTVPPQTID 102
           + EN+ +YG + V  A+N   R+I ++  +KNA   +     A       V T    T+D
Sbjct: 3   ENENI-IYGRNPVLEAIN-SGREIEKIYVSKNAKGNISKIIKAARDKNIIVSTTDNGTLD 60

Query: 103 KIVGKEAVHQGLA-LETAPLLSPTLDAVRNSQ------LLMVLDHVNDPHNIGAILRSAV 155
           K+      HQG+A L +        D +  ++       +++LD + D HN+GAI+R+A 
Sbjct: 61  KL-SNYGNHQGIAALCSLYKYYEVEDILEYAEKRGEKPFILLLDGITDTHNLGAIIRTAE 119

Query: 156 AFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSD 215
           AFS  GII  KR S   ++ + K+++GA E+I  +++SN+ +A+  +   G   +G S D
Sbjct: 120 AFSAHGIIIPKRRSAVVNSTVVKTSAGATEYIKIVKVSNINNAINNLKKQGVWIVGSSLD 179

Query: 216 SKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
           +    +       +A+++G+EGKG+   TQ+    +A + M G I +LN S AA++ +Y
Sbjct: 180 ADVDFQNVDYTGPVAIVIGSEGKGMSELTQKNCDYIAKIPMRGNINSLNASVAASIFMY 238


>gi|311693514|gb|ADP96387.1| RNA methyltransferase, TrmH family, group 3 [marine bacterium HP15]
          Length = 245

 Score =  107 bits (267), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 77/235 (32%), Positives = 114/235 (48%), Gaps = 12/235 (5%)

Query: 50  FLYGVHTVSAALNNPSRKIFQL-LATKNALARLDWDANLPHPFPVK--TVPPQTIDKIVG 106
           F++G H V A L     +  Q+ + T     R+    +      VK   V  + +D+ V 
Sbjct: 5   FVFGWHAVEAVLKREPERFQQVWIQTGRQDKRVKSITDTLDGLGVKWKVVHRKELDERV- 63

Query: 107 KEAVHQGLALE-------TAPLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSC 159
              VHQG+          T   L   L A      L+VLD V DPHN+GA +R+A A   
Sbjct: 64  -SGVHQGVVAAVSESREWTEDDLLAQLAASDKPPFLLVLDGVTDPHNLGACMRTADAAGV 122

Query: 160 DGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKP 219
             +I  K  S S + V  K A GA E +P++R++NL   L+ +   G   IG + ++   
Sbjct: 123 QAVIVPKDKSASLTPVARKVACGAAETVPFVRVTNLARFLRSLQDQGVWLIGTAGEADAT 182

Query: 220 LEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
           L Q      +AL++GAEGKG+R  T+E    + ++ M G + +LNVS A  V LY
Sbjct: 183 LYQADFKGPVALVMGAEGKGMRRLTREHCDQLINIPMLGHVDSLNVSVATGVCLY 237


>gi|23335906|ref|ZP_00121137.1| COG0566: rRNA methylases [Bifidobacterium longum DJO10A]
 gi|189440335|ref|YP_001955416.1| rRNA methylase [Bifidobacterium longum DJO10A]
 gi|227547049|ref|ZP_03977098.1| tRNA/rRNA methyltransferase [Bifidobacterium longum subsp. infantis
           ATCC 55813]
 gi|239622892|ref|ZP_04665923.1| tRNA/rRNA methyltransferase protein [Bifidobacterium longum subsp.
           infantis CCUG 52486]
 gi|296455116|ref|YP_003662260.1| RNA methyltransferase [Bifidobacterium longum subsp. longum JDM301]
 gi|312133669|ref|YP_004001008.1| spou4 [Bifidobacterium longum subsp. longum BBMN68]
 gi|317482327|ref|ZP_07941347.1| RNA methyltransferase [Bifidobacterium sp. 12_1_47BFAA]
 gi|322690129|ref|YP_004209863.1| RNA methyltransferase [Bifidobacterium longum subsp. infantis 157F]
 gi|322692082|ref|YP_004221652.1| RNA methyltransferase [Bifidobacterium longum subsp. longum JCM
           1217]
 gi|189428770|gb|ACD98918.1| rRNA methylase [Bifidobacterium longum DJO10A]
 gi|227212466|gb|EEI80355.1| tRNA/rRNA methyltransferase [Bifidobacterium longum subsp. infantis
           ATCC 55813]
 gi|239514889|gb|EEQ54756.1| tRNA/rRNA methyltransferase protein [Bifidobacterium longum subsp.
           infantis CCUG 52486]
 gi|291517770|emb|CBK71386.1| rRNA methylase, putative, group 3 [Bifidobacterium longum subsp.
           longum F8]
 gi|296184548|gb|ADH01430.1| RNA methyltransferase, TrmH family, group 3 [Bifidobacterium longum
           subsp. longum JDM301]
 gi|311772933|gb|ADQ02421.1| SpoU4 [Bifidobacterium longum subsp. longum BBMN68]
 gi|316916207|gb|EFV37609.1| RNA methyltransferase [Bifidobacterium sp. 12_1_47BFAA]
 gi|320456938|dbj|BAJ67560.1| RNA methyltransferase [Bifidobacterium longum subsp. longum JCM
           1217]
 gi|320461465|dbj|BAJ72085.1| RNA methyltransferase [Bifidobacterium longum subsp. infantis 157F]
          Length = 330

 Score =  107 bits (267), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 54/146 (36%), Positives = 87/146 (59%), Gaps = 1/146 (0%)

Query: 134 LLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRIS 193
           L + LD V DP N+GA++RSA AF  +G+I  +R S S +A   K ++GA  H+P  R+ 
Sbjct: 177 LFIALDGVTDPQNLGAVIRSAAAFGANGVILPERRSASVNAAAWKVSAGAAAHMPVARVV 236

Query: 194 NLTDALQKMHSWGFQTIGLSSDSKKPL-EQEIKNDKIALILGAEGKGLRPKTQETATSMA 252
           NLT AL+ +   G+  +GL     K + E   ++D + ++LG+EG GL    +ET  ++A
Sbjct: 237 NLTKALEGLKERGYYVVGLDGGGDKLVGETGFESDPLVVVLGSEGSGLGRLVRETCDAIA 296

Query: 253 HLHMPGIIKALNVSNAAAVALYITQN 278
            + +   +++LN S AA ++LY   N
Sbjct: 297 GIPISSSVESLNASVAAGISLYAVSN 322


>gi|268592873|ref|ZP_06127094.1| RNA methyltransferase, TrmH family, group 3 [Providencia rettgeri
           DSM 1131]
 gi|291311662|gb|EFE52115.1| RNA methyltransferase, TrmH family, group 3 [Providencia rettgeri
           DSM 1131]
          Length = 249

 Score =  107 bits (267), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 76/235 (32%), Positives = 113/235 (48%), Gaps = 12/235 (5%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDK----IV 105
            +YG+H V A L    ++I ++   K    R      L H      V  Q  ++      
Sbjct: 4   MIYGIHAVKALLERSPQRIKEVYILKGREDRRLMP--LVHEIEALGVVVQVANRQWMDSQ 61

Query: 106 GKEAVHQGLALETAPLLS------PTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSC 159
            + AVHQG+  +  P         P L    +S  L+VLD V DPHN+GA LRSA A   
Sbjct: 62  TEGAVHQGIIAKVLPGKQYQEGDLPDLLENTSSPFLLVLDGVTDPHNLGACLRSADAAGV 121

Query: 160 DGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKP 219
             +I  K  S   +A   K A GA E++P IR++NL   L+ +  +    +G + ++   
Sbjct: 122 HAVIVPKDKSAQLNATAKKVACGAAENVPLIRVTNLARTLRLLQEYNVWIVGTAGEADHN 181

Query: 220 LEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
           L Q      IAL++GAEG+G+R  T+E    +  + M G + +LNVS A  V L+
Sbjct: 182 LYQSKLTGSIALVMGAEGEGMRRLTREHCDELISIPMAGSVSSLNVSVATGVCLF 236


>gi|120406285|ref|YP_956114.1| RNA methyltransferase [Mycobacterium vanbaalenii PYR-1]
 gi|254806469|sp|A1TG08|Y5337_MYCVP RecName: Full=Uncharacterized tRNA/rRNA methyltransferase Mvan_5337
 gi|119959103|gb|ABM16108.1| RNA methyltransferase, TrmH family, group 3 [Mycobacterium
           vanbaalenii PYR-1]
          Length = 314

 Score =  107 bits (267), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 65/187 (34%), Positives = 102/187 (54%), Gaps = 12/187 (6%)

Query: 96  VPPQTIDKIVGKEAVHQGLALETAP---------LLSPTLDAVRNSQLLMVLDHVNDPHN 146
           VP   +D+I     +HQG+AL+  P         L     DA+    LL+ LD+++DP N
Sbjct: 121 VPRHDLDRIA-ANGMHQGIALQVPPYNYAHPDDLLAEAKSDAM--PALLVALDNISDPRN 177

Query: 147 IGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWG 206
           +GAI+RS  AF   G++  +R S S +AV  ++++GA    P  R +NLT AL++    G
Sbjct: 178 LGAIVRSVAAFGGHGVLIPQRRSASVTAVAWRTSAGAAARTPVARATNLTRALKQWADAG 237

Query: 207 FQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVS 266
            Q +GL +D    ++Q      I +++G+EGKGL    +E   ++  + M G  ++LN S
Sbjct: 238 LQVVGLDADGDTTVDQIDGAGPIVVVVGSEGKGLSRLVRENCDAVVSIPMAGPTESLNAS 297

Query: 267 NAAAVAL 273
            AA V L
Sbjct: 298 VAAGVVL 304


>gi|255325869|ref|ZP_05366961.1| RNA methyltransferase, TrmH family, group 3 [Corynebacterium
           tuberculostearicum SK141]
 gi|255297081|gb|EET76406.1| RNA methyltransferase, TrmH family, group 3 [Corynebacterium
           tuberculostearicum SK141]
          Length = 315

 Score =  107 bits (267), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 76/279 (27%), Positives = 139/279 (49%), Gaps = 26/279 (9%)

Query: 7   KKSEKIFSLKDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNN--P 64
           K  ++I+  K  H AKL R+ R+           RH  +   + + G + V   L+   P
Sbjct: 40  KAEDRIYHAK--HKAKLERDRRN---------SGRHQKETAEMVV-GRNPVIECLHAKVP 87

Query: 65  SRKIFQLLATKNALARLDWDANLPHP--FPVKTVPPQTIDKIVGKEAVHQGLALETAPLL 122
           +  ++ +  T+N   RL     + +    P+  V    +D++ G   +HQG+ L+  P  
Sbjct: 88  ATTLYIVAGTRND-KRLSEAVAMCNTRNIPIIEVQRHEMDRMTGN-GMHQGIGLQIPPYK 145

Query: 123 SPTLD-----AVRNSQ--LLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAV 175
              +D     A  N++  + ++LD++ DP N+GA++RS  AF  DG+I  +R S S +AV
Sbjct: 146 YADVDELIARAAENARPGMFVILDNITDPRNLGAVIRSVAAFGGDGVIIPERRSASVTAV 205

Query: 176 LAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQ-EIKNDKIALILG 234
             ++++G    +P  R +N+T  +Q+    G+Q IGL +  +  L+      D + +++G
Sbjct: 206 AWRTSAGTAARLPVARATNITRTVQQFQKSGYQVIGLDAGGEHTLDTYNGATDPVVIVIG 265

Query: 235 AEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVAL 273
           +EGKG+    +E    +  + M   +++LN S AA   L
Sbjct: 266 SEGKGISRLVRENCDVIMSIPMTDWVESLNASVAAGSVL 304


>gi|213693319|ref|YP_002323905.1| RNA methyltransferase, TrmH family, group 3 [Bifidobacterium longum
           subsp. infantis ATCC 15697]
 gi|213524780|gb|ACJ53527.1| RNA methyltransferase, TrmH family, group 3 [Bifidobacterium longum
           subsp. infantis ATCC 15697]
          Length = 333

 Score =  107 bits (266), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 54/146 (36%), Positives = 87/146 (59%), Gaps = 1/146 (0%)

Query: 134 LLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRIS 193
           L + LD V DP N+GA++RSA AF  +G+I  +R S S +A   K ++GA  H+P  R+ 
Sbjct: 180 LFIALDGVTDPQNLGAVIRSAAAFGANGVILPERRSASVNAAAWKVSAGAAAHMPVARVV 239

Query: 194 NLTDALQKMHSWGFQTIGLSSDSKKPL-EQEIKNDKIALILGAEGKGLRPKTQETATSMA 252
           NLT AL+ +   G+  +GL     K + E   ++D + ++LG+EG GL    +ET  ++A
Sbjct: 240 NLTKALEGLKERGYYVVGLDGGGDKLVGETGFESDPLVVVLGSEGSGLGRLVRETCDAIA 299

Query: 253 HLHMPGIIKALNVSNAAAVALYITQN 278
            + +   +++LN S AA ++LY   N
Sbjct: 300 GIPISSSVESLNASVAAGISLYAVSN 325


>gi|148264836|ref|YP_001231542.1| RNA methyltransferase [Geobacter uraniireducens Rf4]
 gi|146398336|gb|ABQ26969.1| RNA methyltransferase, TrmH family, group 3 [Geobacter
           uraniireducens Rf4]
          Length = 242

 Score =  107 bits (266), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 65/230 (28%), Positives = 116/230 (50%), Gaps = 6/230 (2%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLP--HPFPVKTVPPQTIDKIVGK 107
            +YG+++V  AL    R     +A   +  RL+    L      PV+    + I ++ G 
Sbjct: 5   IIYGLNSVMEALRGKRRAFELFVAPGGSDRRLEKLLALAAEKGVPVRQRDKRDIARLCGT 64

Query: 108 EAVHQGLALETAPLLSPTLDAV---RNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIIT 164
           E  HQG+AL   P     L  +       LL+VLD V DPHN+GA++RSA      G+I 
Sbjct: 65  EH-HQGVALRAEPFAYAQLSDILVPGTDGLLLVLDGVQDPHNLGALIRSAACAGAQGVII 123

Query: 165 TKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEI 224
            +  +   +A + K+++GA+E IP   ++N+   L+++ + GF   G   +S   +  + 
Sbjct: 124 PRDRAVGVTATVEKASAGAIETIPVAEVTNVAHTLEELKNAGFWIYGADGESPLSIFDQK 183

Query: 225 KNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
               + L++G+EG+G+RP  ++    +  + + G + +LN S A  + L+
Sbjct: 184 LTGAVVLVIGSEGEGIRPLVKKKCDFLVSIPLRGGVNSLNASVAGGILLF 233


>gi|320459501|dbj|BAJ70122.1| RNA methyltransferase [Bifidobacterium longum subsp. infantis ATCC
           15697]
          Length = 330

 Score =  107 bits (266), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 54/146 (36%), Positives = 87/146 (59%), Gaps = 1/146 (0%)

Query: 134 LLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRIS 193
           L + LD V DP N+GA++RSA AF  +G+I  +R S S +A   K ++GA  H+P  R+ 
Sbjct: 177 LFIALDGVTDPQNLGAVIRSAAAFGANGVILPERRSASVNAAAWKVSAGAAAHMPVARVV 236

Query: 194 NLTDALQKMHSWGFQTIGLSSDSKKPL-EQEIKNDKIALILGAEGKGLRPKTQETATSMA 252
           NLT AL+ +   G+  +GL     K + E   ++D + ++LG+EG GL    +ET  ++A
Sbjct: 237 NLTKALEGLKERGYYVVGLDGGGDKLVGETGFESDPLVVVLGSEGSGLGRLVRETCDAIA 296

Query: 253 HLHMPGIIKALNVSNAAAVALYITQN 278
            + +   +++LN S AA ++LY   N
Sbjct: 297 GIPISSSVESLNASVAAGISLYAVSN 322


>gi|116333232|ref|YP_794759.1| rRNA methylase [Lactobacillus brevis ATCC 367]
 gi|116098579|gb|ABJ63728.1| rRNA methylase [Lactobacillus brevis ATCC 367]
          Length = 255

 Score =  107 bits (266), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 78/246 (31%), Positives = 123/246 (50%), Gaps = 13/246 (5%)

Query: 39  KSRHTSQPENLFLYGVHTVSAALNNPS--RKIFQLLATK-NALARLDWDANLPHPFPVKT 95
           K    ++  N F+ G H   AAL +     K+F     K  AL  +   A   H   +  
Sbjct: 2   KPVENNEENNDFVIGRHPAVAALRSQQTINKVFLQSGLKAEALDEIRQLAKKRH-LVISE 60

Query: 96  VPPQTIDKIVGKEAVHQGLALETAPLLSPTLD-------AVRNSQLLMVLDHVNDPHNIG 148
           VP Q +D +   +  HQG+AL  +     T+D       A   +   +VLD V DPHN+G
Sbjct: 61  VPKQKLDLLTDHQN-HQGVALGVSAFAYATIDDLFDRAAAAGEAPFFLVLDGVEDPHNLG 119

Query: 149 AILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQ 208
           +ILR+A A    GII  KR +   ++V+AK+++GA+E +P  R++NL + ++++   G  
Sbjct: 120 SILRTADASGVHGIIIPKRRAVGLTSVVAKTSTGAIERVPVARVTNLVNTVRELKDRGVW 179

Query: 209 TIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNA 268
             G         + + K    ALI+G EGKG+    +ET   M  + M G +++LN S A
Sbjct: 180 VFGTDMAGTDYRDWDAKGAS-ALIIGNEGKGISRLLKETVDQMLTIPMVGEVQSLNASVA 238

Query: 269 AAVALY 274
           A + +Y
Sbjct: 239 AGLLMY 244


>gi|16767615|ref|NP_463230.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Salmonella enterica
           subsp. enterica serovar Typhimurium str. LT2]
 gi|56416160|ref|YP_153235.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Salmonella enterica
           subsp. enterica serovar Paratyphi A str. ATCC 9150]
 gi|62182815|ref|YP_219232.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Salmonella enterica
           subsp. enterica serovar Choleraesuis str. SC-B67]
 gi|161617640|ref|YP_001591605.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Salmonella enterica
           subsp. enterica serovar Paratyphi B str. SPB7]
 gi|167994986|ref|ZP_02576076.1| RNA methyltransferase, TrmH family, group 3 [Salmonella enterica
           subsp. enterica serovar 4,[5],12:i:- str. CVM23701]
 gi|168231407|ref|ZP_02656465.1| RNA methyltransferase, TrmH family, group 3 [Salmonella enterica
           subsp. enterica serovar Kentucky str. CDC 191]
 gi|168239664|ref|ZP_02664722.1| RNA methyltransferase, TrmH family, group 3 [Salmonella enterica
           subsp. enterica serovar Schwarzengrund str. SL480]
 gi|168245157|ref|ZP_02670089.1| RNA methyltransferase, TrmH family, group 3 [Salmonella enterica
           subsp. enterica serovar Heidelberg str. SL486]
 gi|168822505|ref|ZP_02834505.1| RNA methyltransferase, TrmH family, group 3 [Salmonella enterica
           subsp. enterica serovar Weltevreden str. HI_N05-537]
 gi|194444737|ref|YP_002043624.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Salmonella enterica
           subsp. enterica serovar Newport str. SL254]
 gi|194449058|ref|YP_002048412.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Salmonella enterica
           subsp. enterica serovar Heidelberg str. SL476]
 gi|194469123|ref|ZP_03075107.1| RNA methyltransferase, TrmH family, group 3 [Salmonella enterica
           subsp. enterica serovar Kentucky str. CVM29188]
 gi|194734163|ref|YP_002117310.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Salmonella enterica
           subsp. enterica serovar Schwarzengrund str. CVM19633]
 gi|197263055|ref|ZP_03163129.1| RNA methyltransferase, TrmH family, group 3 [Salmonella enterica
           subsp. enterica serovar Saintpaul str. SARA23]
 gi|197365085|ref|YP_002144722.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Salmonella enterica
           subsp. enterica serovar Paratyphi A str. AKU_12601]
 gi|204927331|ref|ZP_03218533.1| RNA methyltransferase, TrmH family, group 3 [Salmonella enterica
           subsp. enterica serovar Javiana str. GA_MM04042433]
 gi|213428664|ref|ZP_03361414.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Salmonella enterica
           subsp. enterica serovar Typhi str. E02-1180]
 gi|213582911|ref|ZP_03364737.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Salmonella enterica
           subsp. enterica serovar Typhi str. E98-0664]
 gi|213852966|ref|ZP_03382498.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Salmonella enterica
           subsp. enterica serovar Typhi str. M223]
 gi|224586209|ref|YP_002640008.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Salmonella enterica
           subsp. enterica serovar Paratyphi C strain RKS4594]
 gi|238910527|ref|ZP_04654364.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Salmonella enterica
           subsp. enterica serovar Tennessee str. CDC07-0191]
 gi|289829973|ref|ZP_06547424.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Salmonella enterica
           subsp. enterica serovar Typhi str. E98-3139]
 gi|52783321|sp|Q8ZKA2|RLMB_SALTY RecName: Full=23S rRNA (guanosine-2'-O-)-methyltransferase RlmB;
           AltName: Full=23S rRNA Gm2251 2'-O-methyltransferase
 gi|16422930|gb|AAL23189.1| putative tRNA/rRNA methyltransferase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. LT2]
 gi|56130417|gb|AAV79923.1| probable tRNA/rRNA methyltransferase [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. ATCC 9150]
 gi|62130448|gb|AAX68151.1| putative tRNA/rRNA methyltransferase [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. SC-B67]
 gi|161367004|gb|ABX70772.1| hypothetical protein SPAB_05503 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|194403400|gb|ACF63622.1| RNA methyltransferase, TrmH family, group 3 [Salmonella enterica
           subsp. enterica serovar Newport str. SL254]
 gi|194407362|gb|ACF67581.1| RNA methyltransferase, TrmH family, group 3 [Salmonella enterica
           subsp. enterica serovar Heidelberg str. SL476]
 gi|194455487|gb|EDX44326.1| RNA methyltransferase, TrmH family, group 3 [Salmonella enterica
           subsp. enterica serovar Kentucky str. CVM29188]
 gi|194709665|gb|ACF88886.1| RNA methyltransferase, TrmH family, group 3 [Salmonella enterica
           subsp. enterica serovar Schwarzengrund str. CVM19633]
 gi|197096562|emb|CAR62172.1| probable tRNA/rRNA methyltransferase [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. AKU_12601]
 gi|197241310|gb|EDY23930.1| RNA methyltransferase, TrmH family, group 3 [Salmonella enterica
           subsp. enterica serovar Saintpaul str. SARA23]
 gi|197287651|gb|EDY27042.1| RNA methyltransferase, TrmH family, group 3 [Salmonella enterica
           subsp. enterica serovar Schwarzengrund str. SL480]
 gi|204323996|gb|EDZ09191.1| RNA methyltransferase, TrmH family, group 3 [Salmonella enterica
           subsp. enterica serovar Javiana str. GA_MM04042433]
 gi|205327237|gb|EDZ14001.1| RNA methyltransferase, TrmH family, group 3 [Salmonella enterica
           subsp. enterica serovar 4,[5],12:i:- str. CVM23701]
 gi|205334208|gb|EDZ20972.1| RNA methyltransferase, TrmH family, group 3 [Salmonella enterica
           subsp. enterica serovar Kentucky str. CDC 191]
 gi|205336077|gb|EDZ22841.1| RNA methyltransferase, TrmH family, group 3 [Salmonella enterica
           subsp. enterica serovar Heidelberg str. SL486]
 gi|205341078|gb|EDZ27842.1| RNA methyltransferase, TrmH family, group 3 [Salmonella enterica
           subsp. enterica serovar Weltevreden str. HI_N05-537]
 gi|224470737|gb|ACN48567.1| putative tRNA/rRNA methyltransferase [Salmonella enterica subsp.
           enterica serovar Paratyphi C strain RKS4594]
 gi|261249459|emb|CBG27324.1| probable tRNA/rRNA methyltransferase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. D23580]
 gi|267996701|gb|ACY91586.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Salmonella enterica
           subsp. enterica serovar Typhimurium str. 14028S]
 gi|301160857|emb|CBW20388.1| probable tRNA/rRNA methyltransferase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. SL1344]
 gi|312915467|dbj|BAJ39441.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Salmonella enterica
           subsp. enterica serovar Typhimurium str. T000240]
 gi|320088796|emb|CBY98554.1| hypothetical tRNA/rRNA methyltransferase [Salmonella enterica
           subsp. enterica serovar Weltevreden str. 2007-60-3289-1]
 gi|321222665|gb|EFX47737.1| 23S rRNA guanosine-2'-O- -methyltransferase rlmB [Salmonella
           enterica subsp. enterica serovar Typhimurium str.
           TN061786]
 gi|322615531|gb|EFY12451.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Salmonella enterica
           subsp. enterica serovar Montevideo str. 315996572]
 gi|322618591|gb|EFY15480.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Salmonella enterica
           subsp. enterica serovar Montevideo str. 495297-1]
 gi|322621996|gb|EFY18846.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Salmonella enterica
           subsp. enterica serovar Montevideo str. 495297-3]
 gi|322627720|gb|EFY24511.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Salmonella enterica
           subsp. enterica serovar Montevideo str. 495297-4]
 gi|322631027|gb|EFY27791.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Salmonella enterica
           subsp. enterica serovar Montevideo str. 515920-1]
 gi|322637754|gb|EFY34455.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Salmonella enterica
           subsp. enterica serovar Montevideo str. 515920-2]
 gi|322642418|gb|EFY39022.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Salmonella enterica
           subsp. enterica serovar Montevideo str. 531954]
 gi|322644013|gb|EFY40561.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Salmonella enterica
           subsp. enterica serovar Montevideo str.
           NC_MB110209-0054]
 gi|322650481|gb|EFY46889.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Salmonella enterica
           subsp. enterica serovar Montevideo str. OH_2009072675]
 gi|322653555|gb|EFY49883.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Salmonella enterica
           subsp. enterica serovar Montevideo str.
           CASC_09SCPH15965]
 gi|322659740|gb|EFY55983.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Salmonella enterica
           subsp. enterica serovar Montevideo str. 19N]
 gi|322662049|gb|EFY58265.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Salmonella enterica
           subsp. enterica serovar Montevideo str. 81038-01]
 gi|322666202|gb|EFY62380.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Salmonella enterica
           subsp. enterica serovar Montevideo str. MD_MDA09249507]
 gi|322672622|gb|EFY68733.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Salmonella enterica
           subsp. enterica serovar Montevideo str. 414877]
 gi|322676052|gb|EFY72123.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Salmonella enterica
           subsp. enterica serovar Montevideo str. 366867]
 gi|322680536|gb|EFY76574.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Salmonella enterica
           subsp. enterica serovar Montevideo str. 413180]
 gi|322684570|gb|EFY80574.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Salmonella enterica
           subsp. enterica serovar Montevideo str. 446600]
 gi|322717317|gb|EFZ08888.1| 23S rRNA (guanosine-2'-O-)-methyltransferase rlmB [Salmonella
           enterica subsp. enterica serovar Choleraesuis str. A50]
 gi|323132707|gb|ADX20137.1| 23S rRNA (guanosine-2'-O-)-methyltransferase rlmB [Salmonella
           enterica subsp. enterica serovar Typhimurium str. 4/74]
 gi|323192885|gb|EFZ78111.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Salmonella enterica
           subsp. enterica serovar Montevideo str. 609458-1]
 gi|323197239|gb|EFZ82379.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Salmonella enterica
           subsp. enterica serovar Montevideo str. 556150-1]
 gi|323201644|gb|EFZ86708.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Salmonella enterica
           subsp. enterica serovar Montevideo str. 609460]
 gi|323206158|gb|EFZ91120.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Salmonella enterica
           subsp. enterica serovar Montevideo str. 507440-20]
 gi|323213166|gb|EFZ97968.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Salmonella enterica
           subsp. enterica serovar Montevideo str. 556152]
 gi|323215540|gb|EGA00284.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Salmonella enterica
           subsp. enterica serovar Montevideo str. MB101509-0077]
 gi|323219525|gb|EGA04010.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Salmonella enterica
           subsp. enterica serovar Montevideo str. MB102109-0047]
 gi|323227828|gb|EGA11982.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Salmonella enterica
           subsp. enterica serovar Montevideo str. MB110209-0055]
 gi|323228998|gb|EGA13127.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Salmonella enterica
           subsp. enterica serovar Montevideo str. MB111609-0052]
 gi|323236390|gb|EGA20466.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Salmonella enterica
           subsp. enterica serovar Montevideo str. 2009083312]
 gi|323238705|gb|EGA22757.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Salmonella enterica
           subsp. enterica serovar Montevideo str. 2009085258]
 gi|323241844|gb|EGA25873.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Salmonella enterica
           subsp. enterica serovar Montevideo str. 315731156]
 gi|323248007|gb|EGA31944.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Salmonella enterica
           subsp. enterica serovar Montevideo str. IA_2009159199]
 gi|323254662|gb|EGA38473.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Salmonella enterica
           subsp. enterica serovar Montevideo str. IA_2010008282]
 gi|323258279|gb|EGA41956.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Salmonella enterica
           subsp. enterica serovar Montevideo str. IA_2010008283]
 gi|323263575|gb|EGA47096.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Salmonella enterica
           subsp. enterica serovar Montevideo str. IA_2010008284]
 gi|323265829|gb|EGA49325.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Salmonella enterica
           subsp. enterica serovar Montevideo str. IA_2010008285]
 gi|323270273|gb|EGA53721.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Salmonella enterica
           subsp. enterica serovar Montevideo str. IA_2010008287]
 gi|332991180|gb|AEF10163.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Salmonella enterica
           subsp. enterica serovar Typhimurium str. UK-1]
          Length = 243

 Score =  107 bits (266), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 76/238 (31%), Positives = 116/238 (48%), Gaps = 18/238 (7%)

Query: 50  FLYGVHTVSAALNN-PSR--KIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVG 106
            +YG+H V A L   P R  ++F L   ++   RL     L H    + V  Q  ++   
Sbjct: 4   MIYGIHAVQALLERAPERFQEVFILKGREDK--RL---LPLIHALESQGVVIQLANRQYL 58

Query: 107 KE----AVHQGLALETAPLLS------PTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVA 156
            E    AVHQG+     P         P L A+ +   L++LD V DPHN+GA LRSA A
Sbjct: 59  DEKSDGAVHQGIIARVKPGRQYQENDLPDLIALHDRPFLLILDGVTDPHNLGACLRSADA 118

Query: 157 FSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDS 216
                +I  K  S   +A   K A GA E +P IR++NL   ++ +       +G + ++
Sbjct: 119 AGVHAVIVPKDRSAQLNATAKKVACGAAESVPLIRVTNLARTMRMLQEENIWIVGTAGEA 178

Query: 217 KKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
              L Q     ++AL++GAEG+G+R  T+E    +  + M G + +LNVS A  + L+
Sbjct: 179 DHTLYQSKMPGRMALVMGAEGEGMRRLTREHCDELISIPMAGSVSSLNVSVATGICLF 236


>gi|306836882|ref|ZP_07469838.1| RNA methyltransferase [Corynebacterium accolens ATCC 49726]
 gi|304567254|gb|EFM42863.1| RNA methyltransferase [Corynebacterium accolens ATCC 49726]
          Length = 316

 Score =  107 bits (266), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 75/279 (26%), Positives = 138/279 (49%), Gaps = 26/279 (9%)

Query: 7   KKSEKIFSLKDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNN--P 64
           K  ++++  K  H AKL R  R+           RH  +   + + G + V   L+   P
Sbjct: 40  KAEDRVYHAK--HKAKLERERRN---------SGRHQKETAEMVV-GRNPVIECLHAKVP 87

Query: 65  SRKIFQLLATKNALARLDWDANLPHP--FPVKTVPPQTIDKIVGKEAVHQGLALETAPL- 121
           +  ++    T+N   RL    ++ +    P+  V    +D++ G   +HQG+ L+  P  
Sbjct: 88  ATTLYIAAGTRND-KRLSEAVSMCNTRNIPIIEVQRHEMDRMTGN-GMHQGIGLQIPPYK 145

Query: 122 LSPTLDAVRNS------QLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAV 175
            +   D + N+       + ++LD++ DP N+GA++RS  AF  DG+I  +R S S +AV
Sbjct: 146 YAAVEDLIANAAENPRPGMFVILDNITDPRNLGAVIRSVAAFGGDGVIIPERRSASVTAV 205

Query: 176 LAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQ-EIKNDKIALILG 234
             ++++G    +P  R +N+T  +++    G+Q +GL +     L+  E   D + +++G
Sbjct: 206 AWRTSAGTAARLPVARATNITRTVKEFQKNGYQVVGLDAGGDHTLDTYEGGTDPVVIVIG 265

Query: 235 AEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVAL 273
           +EGKG+     ET   +  + M G +++LN S AA   L
Sbjct: 266 SEGKGISRLVSETCDVLMSIPMTGWVESLNASVAAGSVL 304


>gi|152973939|ref|YP_001373456.1| RNA methyltransferase [Bacillus cereus subsp. cytotoxis NVH 391-98]
 gi|152022691|gb|ABS20461.1| RNA methyltransferase, TrmH family, group 3 [Bacillus cytotoxicus
           NVH 391-98]
          Length = 247

 Score =  107 bits (266), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 61/185 (32%), Positives = 102/185 (55%), Gaps = 9/185 (4%)

Query: 97  PPQTIDKIVGKEAVHQGLALETAPLLSPTLD------AVRNSQ-LLMVLDHVNDPHNIGA 149
           P + +D++V  E  HQG+  + A      L+      A RN +   ++LD + DPHN+G+
Sbjct: 54  PKKKLDQLV--EGNHQGVIAQVAAYQYAELEDLFKVAAKRNEEPFFLILDEIEDPHNLGS 111

Query: 150 ILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQT 209
           I+R+A A    GII  KR S   +A +AK+++GA+E+IP +R++NL+  + ++   G   
Sbjct: 112 IMRTADATGAHGIIIPKRRSVGLTASVAKASTGAIEYIPVVRVTNLSRTIDELKERGLWI 171

Query: 210 IGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAA 269
            G  +  K        N  I L++G+EGKG+     +    + HL M G + +LN S AA
Sbjct: 172 AGTDAKGKTDYRNLDGNMPIGLVIGSEGKGMSRIIGQKCDFLVHLPMVGKVTSLNASVAA 231

Query: 270 AVALY 274
           ++ +Y
Sbjct: 232 SLLMY 236


>gi|166711529|ref|ZP_02242736.1| tRNA/rRNA methyltransferase [Xanthomonas oryzae pv. oryzicola
           BLS256]
          Length = 249

 Score =  107 bits (266), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 74/239 (30%), Positives = 124/239 (51%), Gaps = 13/239 (5%)

Query: 47  ENLFLYGVHTVSAALNNPSRKIFQLL---ATKN-ALARLDWDANLPHPFPVKTVPPQTID 102
           +N ++ GV+ V++++ N +  + ++L    +KN  L  ++  A       V+ V  Q +D
Sbjct: 4   QNQWIVGVNAVASSVENDADNVREVLIEAGSKNPRLTEIEEQAR-RKGIDVRRVNTQALD 62

Query: 103 KIVGKEAVHQGLALETAPL-------LSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAV 155
             VG +  HQG+A   A         L   ++A     L+++LD V DPHN+GA LRSA 
Sbjct: 63  G-VGGQVRHQGVAARYAAARLWAENELEGLVEAAEGRALVLILDGVQDPHNLGACLRSAA 121

Query: 156 AFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSD 215
           A     ++  K  S S +A + K+++GA + IP + ++NL   L+ +   G    GL+ +
Sbjct: 122 AAGVTAVVIPKDKSASVNATVRKTSAGAADRIPVVAVTNLARCLRDLQKQGVWLYGLAGE 181

Query: 216 SKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
           ++  L        + L+LG E  GLR  T+E    +  + MPG I++LNVS A  V L+
Sbjct: 182 AEASLYSVDLRGNVGLVLGGESDGLRRLTREHCDGLVKIPMPGEIESLNVSVATGVTLF 240


>gi|170767082|ref|ZP_02901535.1| RNA methyltransferase, TrmH family, group 3 [Escherichia albertii
           TW07627]
 gi|170124520|gb|EDS93451.1| RNA methyltransferase, TrmH family, group 3 [Escherichia albertii
           TW07627]
          Length = 243

 Score =  107 bits (266), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 72/234 (30%), Positives = 112/234 (47%), Gaps = 10/234 (4%)

Query: 50  FLYGVHTVSAALNN-PSR--KIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVG 106
            +YG+H V A L   P R  ++F L   ++        A   H   ++    Q +D+   
Sbjct: 4   MIYGIHAVQALLERAPERFQEVFILKGREDKRLLPLIHALESHGVVIQLANRQYLDE-KS 62

Query: 107 KEAVHQGLALETAPLLS------PTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCD 160
              VHQG+     P         P L A  +   L++LD V DPHN+GA LRSA A    
Sbjct: 63  DGGVHQGIIARVKPGRQYQENDLPDLIASLDQSFLLILDGVTDPHNLGACLRSADAAGVH 122

Query: 161 GIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPL 220
            +I  K  S   +A   K A GA E +P IR++NL   ++ +       +G + ++   L
Sbjct: 123 AVIVPKDRSAQLNATARKVACGAAESVPLIRVTNLARTMRMLQEENIWIVGTAGEADHTL 182

Query: 221 EQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
            Q     ++AL++GAEG+G+R  T+E    +  + M G + +LNVS A  + L+
Sbjct: 183 YQSKMTGRLALVMGAEGEGMRRLTREHCDELISIPMAGSVSSLNVSVATGICLF 236


>gi|197251745|ref|YP_002149283.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Salmonella enterica
           subsp. enterica serovar Agona str. SL483]
 gi|197215448|gb|ACH52845.1| RNA methyltransferase, TrmH family, group 3 [Salmonella enterica
           subsp. enterica serovar Agona str. SL483]
          Length = 243

 Score =  107 bits (266), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 76/238 (31%), Positives = 116/238 (48%), Gaps = 18/238 (7%)

Query: 50  FLYGVHTVSAALNN-PSR--KIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVG 106
            +YG+H V A L   P R  ++F L   ++   RL     L H    + V  Q  ++   
Sbjct: 4   MIYGIHAVQALLERAPERFQEVFILKGREDK--RL---LPLIHALESQGVVIQLANRQYL 58

Query: 107 KE----AVHQGLALETAPLLS------PTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVA 156
            E    AVHQG+     P         P L A+ +   L++LD V DPHN+GA LRSA A
Sbjct: 59  DEKSDGAVHQGIIARVKPGRQYQENDLPDLIALHDRPFLLILDGVTDPHNLGACLRSADA 118

Query: 157 FSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDS 216
                +I  K  S   +A   K A GA E +P IR++NL   ++ +       +G + ++
Sbjct: 119 AGVHAVIVPKDRSAQLNATAKKVACGAAESVPLIRVTNLARTMRMLREENIWIVGTAGEA 178

Query: 217 KKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
              L Q     ++AL++GAEG+G+R  T+E    +  + M G + +LNVS A  + L+
Sbjct: 179 DHTLYQSKMPGRMALVMGAEGEGMRRLTREHCDELISIPMAGSVSSLNVSVATGICLF 236


>gi|148981039|ref|ZP_01816259.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Vibrionales bacterium
           SWAT-3]
 gi|145961015|gb|EDK26338.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Vibrionales bacterium
           SWAT-3]
          Length = 246

 Score =  107 bits (266), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 72/236 (30%), Positives = 120/236 (50%), Gaps = 10/236 (4%)

Query: 48  NLFLYGVHTVSAALN-NPSRKI--FQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKI 104
           N F+YG+H V A L  +P+R I  + L   ++       +        ++ +  + +D  
Sbjct: 3   NEFIYGIHAVKAVLEKDPARFIEAYVLKGRQDERLLPLLNQLQQFGVSIQQMGRKPLDD- 61

Query: 105 VGKEAVHQGLALETAP---LLSPTLD---AVRNSQLLMVLDHVNDPHNIGAILRSAVAFS 158
             + A HQG+  +  P   L    LD   A     LL+VLD V DPHN+GA LR+A A  
Sbjct: 62  KAQGANHQGIIAKVKPAKQLNETHLDDILAQHEQPLLLVLDGVTDPHNLGACLRNADAAG 121

Query: 159 CDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKK 218
              +I  K  S   +A ++K A GA E +P +R++NL   ++ +   G   +G + ++  
Sbjct: 122 VAAVIVPKDRSSPLTATVSKVACGAAETVPLVRVTNLARTMRALQEQGVWFVGTAGEATH 181

Query: 219 PLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
            + Q      +A+++GAEG G+R  T+ET   +  + M G + +LNVS A+ + L+
Sbjct: 182 DIYQAKLTGPLAVVMGAEGDGMRRLTRETCDDLIKIPMAGSVSSLNVSVASGICLF 237


>gi|238787548|ref|ZP_04631346.1| 23S rRNA (guanosine-2'-O-)-methyltransferase rlmB [Yersinia
           frederiksenii ATCC 33641]
 gi|238724335|gb|EEQ15977.1| 23S rRNA (guanosine-2'-O-)-methyltransferase rlmB [Yersinia
           frederiksenii ATCC 33641]
          Length = 246

 Score =  107 bits (266), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 72/240 (30%), Positives = 113/240 (47%), Gaps = 22/240 (9%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPF---------PVKTVPPQT 100
            +YG+H V A L+N  ++  ++   K        D     P           ++    Q 
Sbjct: 4   IIYGIHAVKALLDNDPQRFLEVFILKGR------DDRRLQPLISELEAAGLVIQVASRQW 57

Query: 101 IDKIVGKEAVHQGLALETAPLLS------PTLDAVRNSQLLMVLDHVNDPHNIGAILRSA 154
           +D  V +  VHQG+               P L A   +  L+VLD V DPHN+GA LRSA
Sbjct: 58  LDSQV-EGGVHQGIVARVREGRQYQENDLPALLASVETPFLLVLDGVTDPHNLGACLRSA 116

Query: 155 VAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSS 214
            A     +I  +  S   +A+  K ASGA E++P I+++NL   L+ +       +G + 
Sbjct: 117 DAAGVHAVIVPRDRSAQLNAIAKKVASGAAENVPLIKVTNLARTLRVLQEHNVWIVGTAG 176

Query: 215 DSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
           ++   L Q      +AL++GAEG+G+R  T+E    +  + M G + +LNVS A  V L+
Sbjct: 177 EADHTLYQSKMTGPMALVMGAEGEGMRRLTREHCDELISIPMAGSVSSLNVSVATGVCLF 236


>gi|331650305|ref|ZP_08351377.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli M605]
 gi|330908522|gb|EGH37041.1| 23S rRNA (guanosine-2'-O-) -methyltransferase rlmB [Escherichia
           coli AA86]
 gi|331040699|gb|EGI12857.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli M605]
          Length = 243

 Score =  107 bits (266), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 76/238 (31%), Positives = 115/238 (48%), Gaps = 18/238 (7%)

Query: 50  FLYGVHTVSAALN-NPSR--KIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVG 106
            +YG+H V A L   P R  ++F L   ++   RL     L H    + V  Q  ++   
Sbjct: 4   MIYGIHAVQALLERTPERFQEVFILKGREDK--RL---LPLIHALESQGVVIQLANRQYL 58

Query: 107 KE----AVHQGLALETAPLLS------PTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVA 156
            E    AVHQG+     P         P L A  +   L++LD V DPHN+GA LRSA A
Sbjct: 59  DEKSDGAVHQGIIARVKPGRQYQENDLPDLIASLDQPFLLILDGVTDPHNLGACLRSADA 118

Query: 157 FSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDS 216
                +I  K  S   +A   K A GA E +P IR++NL   ++ +       +G + ++
Sbjct: 119 AGVHAVIVPKDRSAQLNATAKKVACGAAESVPLIRVTNLARTMRMLQEENIWIVGTAGEA 178

Query: 217 KKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
              L Q     ++AL++GAEG+G+R  T+E    +  + M G + +LNVS A  + L+
Sbjct: 179 DHTLYQSKMTGRLALVMGAEGEGMRRLTREHCDELISIPMAGSVSSLNVSVATGICLF 236


>gi|293417683|ref|ZP_06660305.1| RNA methyltransferase [Escherichia coli B185]
 gi|291430401|gb|EFF03399.1| RNA methyltransferase [Escherichia coli B185]
          Length = 243

 Score =  107 bits (266), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 76/238 (31%), Positives = 115/238 (48%), Gaps = 18/238 (7%)

Query: 50  FLYGVHTVSAALNN-PSR--KIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVG 106
            +YG+H V A L   P R  ++F L   ++   RL     L H    + V  Q  ++   
Sbjct: 4   MIYGIHAVQALLERAPERFQEVFILKGREDK--RL---LPLIHALESQGVVIQLANRQYL 58

Query: 107 KE----AVHQGLALETAPLLS------PTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVA 156
            E    AVHQG+     P         P L A  +   L++LD V DPHN+GA LRSA A
Sbjct: 59  DEKSDGAVHQGIIARVKPGRQYQENDLPELIASLDQPFLLILDGVTDPHNLGACLRSADA 118

Query: 157 FSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDS 216
                +I  K  S   +A   K A GA E +P IR++NL   ++ +       +G + ++
Sbjct: 119 AGVHAVIVPKDRSAQLNATAKKVACGAAESVPLIRVTNLARTMRMLQEENIWIVGTAGEA 178

Query: 217 KKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
              L Q     ++AL++GAEG+G+R  T+E    +  + M G + +LNVS A  + L+
Sbjct: 179 DHTLYQSKMTGRLALVMGAEGEGMRRLTREHCDELISIPMAGSVSSLNVSVATGICLF 236


>gi|239815199|ref|YP_002944109.1| RNA methyltransferase, TrmH family, group 3 [Variovorax paradoxus
           S110]
 gi|239801776|gb|ACS18843.1| RNA methyltransferase, TrmH family, group 3 [Variovorax paradoxus
           S110]
          Length = 248

 Score =  107 bits (266), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 56/141 (39%), Positives = 82/141 (58%)

Query: 134 LLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRIS 193
           LL+VLD V DPHN+GA LR A       +I  K ++   +A +AK ASGA E +PY  ++
Sbjct: 100 LLLVLDGVTDPHNLGACLRVADGAGAHAVIAPKDHAAGINATVAKVASGAAETVPYFMVT 159

Query: 194 NLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAH 253
           NL   L ++       +G S D+   L Q      +AL+LGAEG+G+R  T++T   +  
Sbjct: 160 NLARTLNELKERSIWCVGTSDDAPGTLYQSDLKRPLALVLGAEGEGMRQLTRKTCDELVS 219

Query: 254 LHMPGIIKALNVSNAAAVALY 274
           + M G +++LNVS A+ V LY
Sbjct: 220 IPMAGAVESLNVSVASGVCLY 240


>gi|23465262|ref|NP_695865.1| tRNA/rRNA methyltransferase [Bifidobacterium longum NCC2705]
 gi|23325895|gb|AAN24501.1| possible tRNA/rRNA methyltransferase [Bifidobacterium longum
           NCC2705]
          Length = 169

 Score =  107 bits (266), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 54/146 (36%), Positives = 87/146 (59%), Gaps = 1/146 (0%)

Query: 134 LLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRIS 193
           L + LD V DP N+GA++RSA AF  +G+I  +R S S +A   K ++GA  H+P  R+ 
Sbjct: 16  LFIALDGVTDPQNLGAVIRSAAAFGANGVILPERRSASVNAAAWKVSAGAAAHMPVARVV 75

Query: 194 NLTDALQKMHSWGFQTIGLSSDSKKPL-EQEIKNDKIALILGAEGKGLRPKTQETATSMA 252
           NLT AL+ +   G+  +GL     K + E   ++D + ++LG+EG GL    +ET  ++A
Sbjct: 76  NLTKALEGLKERGYYVVGLDGGGDKLVGETGFESDPLVVVLGSEGSGLGRLVRETCDAIA 135

Query: 253 HLHMPGIIKALNVSNAAAVALYITQN 278
            + +   +++LN S AA ++LY   N
Sbjct: 136 GIPISSSVESLNASVAAGISLYAVSN 161


>gi|186681662|ref|YP_001864858.1| RNA methyltransferase [Nostoc punctiforme PCC 73102]
 gi|186464114|gb|ACC79915.1| RNA methyltransferase, TrmH family, group 3 [Nostoc punctiforme PCC
           73102]
          Length = 363

 Score =  107 bits (266), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 79/261 (30%), Positives = 136/261 (52%), Gaps = 24/261 (9%)

Query: 31  KKMQSFNQKSRHTSQP---ENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANL 87
           ++  +F+Q S  ++QP   +N  +YG H V +AL    R + ++  T     RL +D + 
Sbjct: 87  QRNSNFSQ-SPVSTQPIEEDNDIIYGRHPVLSALQK-QRNLNRIWIT----TRLRYDPSF 140

Query: 88  PHPF--------PVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTL-DAVRNSQ----- 133
            H           +  V P+ +D +    A HQG+A +TAP     L D +  S+     
Sbjct: 141 HHFLLQAKENGTVIDEVEPKRLDYLTNG-ANHQGVAAQTAPYGYIELADLIEQSKSVTDP 199

Query: 134 LLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRIS 193
           +++V D + DPHN+GAI+R+A A    G++  +R +   ++ + K A+GALE+    R+ 
Sbjct: 200 VIVVADGITDPHNLGAIIRTAEAIGAQGLVIPQRRASGITSTVMKVAAGALENFTVSRVV 259

Query: 194 NLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAH 253
           NL+ AL+++   GF   G ++   +P+        I L++G+EG+GL   TQ +   +  
Sbjct: 260 NLSRALEELKEAGFWIYGTAASGSEPVHTVNFKGPIVLVIGSEGEGLGMLTQRSCDFLVS 319

Query: 254 LHMPGIIKALNVSNAAAVALY 274
           + + G   +LN S AA +ALY
Sbjct: 320 IPLQGKTPSLNASVAAGMALY 340


>gi|289433595|ref|YP_003463467.1| RNA methyltransferase, TrmH family, group 3 [Listeria seeligeri
           serovar 1/2b str. SLCC3954]
 gi|289169839|emb|CBH26377.1| RNA methyltransferase, TrmH family, group 3 [Listeria seeligeri
           serovar 1/2b str. SLCC3954]
          Length = 251

 Score =  107 bits (266), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 64/192 (33%), Positives = 109/192 (56%), Gaps = 15/192 (7%)

Query: 93  VKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQ-------LLMVLDHVNDPH 145
           V+ VP Q I+K+V    VHQG+A + A      LD + N+          ++LD + DPH
Sbjct: 54  VQFVPKQKIEKVV--SGVHQGVAAQVAAYQYAELDDLFNAAEAKGEMPFFIILDELEDPH 111

Query: 146 NIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLT---DALQKM 202
           N+G+I+R+A +    GII  KR S   +  +AK+++GA+E++P +R++N+    + LQK 
Sbjct: 112 NLGSIMRTADSVGAHGIIIPKRRSVGLTQTVAKASTGAMEYVPVVRVTNMVRTMEELQKR 171

Query: 203 HSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKA 262
             W F T    S   + ++ ++    +A+++G+EG G+    +E    + HL M G + +
Sbjct: 172 GLWIFGTDAKGSSDYRTMDVDM---PLAIVIGSEGFGMSRLVREKCDFLIHLPMRGKVTS 228

Query: 263 LNVSNAAAVALY 274
           LN S AA++ LY
Sbjct: 229 LNASVAASLLLY 240


>gi|28899580|ref|NP_799185.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Vibrio
           parahaemolyticus RIMD 2210633]
 gi|260361407|ref|ZP_05774469.1| RNA methyltransferase, TrmH family, group 3 [Vibrio
           parahaemolyticus K5030]
 gi|260876679|ref|ZP_05889034.1| RNA methyltransferase, TrmH family, group 3 [Vibrio
           parahaemolyticus AN-5034]
 gi|260896628|ref|ZP_05905124.1| RNA methyltransferase, TrmH family, group 3 [Vibrio
           parahaemolyticus Peru-466]
 gi|260900887|ref|ZP_05909282.1| RNA methyltransferase, TrmH family, group 3 [Vibrio
           parahaemolyticus AQ4037]
 gi|52783311|sp|Q87L11|RLMB_VIBPA RecName: Full=23S rRNA (guanosine-2'-O-)-methyltransferase RlmB;
           AltName: Full=23S rRNA Gm2251 2'-O-methyltransferase
 gi|28807816|dbj|BAC61069.1| RNA methyltransferase, TrmH family [Vibrio parahaemolyticus RIMD
           2210633]
 gi|308086301|gb|EFO35996.1| RNA methyltransferase, TrmH family, group 3 [Vibrio
           parahaemolyticus Peru-466]
 gi|308093965|gb|EFO43660.1| RNA methyltransferase, TrmH family, group 3 [Vibrio
           parahaemolyticus AN-5034]
 gi|308106500|gb|EFO44040.1| RNA methyltransferase, TrmH family, group 3 [Vibrio
           parahaemolyticus AQ4037]
 gi|308112895|gb|EFO50435.1| RNA methyltransferase, TrmH family, group 3 [Vibrio
           parahaemolyticus K5030]
          Length = 247

 Score =  107 bits (266), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 78/241 (32%), Positives = 121/241 (50%), Gaps = 20/241 (8%)

Query: 48  NLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLP--HPFPVKTVPPQTI---- 101
           N F+YG+H V A L     +  +    K    R D D  +P  +   V  V  Q +    
Sbjct: 3   NEFIYGIHAVKAVLEREPERFIEAYVLK---GRQD-DRLMPILNDLQVCGVSIQQMTRKT 58

Query: 102 --DKIVGKEAVHQGLA--LETAPLLSPT----LDAVRNSQLLMVLDHVNDPHNIGAILRS 153
             DK  G  A HQG+   ++ A  L+      + A   + LL+VLD V DPHN+GA LR+
Sbjct: 59  LDDKAHG--ANHQGIIARVKVAKQLNENDIDDILAQHETPLLLVLDGVTDPHNLGACLRN 116

Query: 154 AVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLS 213
           A A     II  K  S   +A ++K A GA E +P IR++NL   ++ +   G   +G +
Sbjct: 117 ADAAGVAAIIVPKDRSAPMNATVSKVACGAAEVVPLIRVTNLARTMRTLQEQGIWFVGTA 176

Query: 214 SDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVAL 273
            ++   + Q      +A+++GAEG G+R  T+ET   +  + M G + +LNVS A+ + L
Sbjct: 177 GEATHDIYQAKLTGPLAIVMGAEGDGMRRLTRETCDDLIKIPMAGSVSSLNVSVASGICL 236

Query: 274 Y 274
           +
Sbjct: 237 F 237


>gi|15804769|ref|NP_290810.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Escherichia coli
           O157:H7 EDL933]
 gi|15834410|ref|NP_313183.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Escherichia coli
           O157:H7 str. Sakai]
 gi|16132002|ref|NP_418601.1| 23S rRNA (Gm2251)-methyltransferase [Escherichia coli str. K-12
           substr. MG1655]
 gi|24115535|ref|NP_710045.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Shigella flexneri 2a
           str. 301]
 gi|26251072|ref|NP_757112.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Escherichia coli
           CFT073]
 gi|30065552|ref|NP_839723.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Shigella flexneri 2a
           str. 2457T]
 gi|74314665|ref|YP_313084.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Shigella sonnei
           Ss046]
 gi|89110900|ref|AP_004680.1| 23S rRNA (Gm2251)-methyltransferase [Escherichia coli str. K-12
           substr. W3110]
 gi|91213729|ref|YP_543715.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Escherichia coli
           UTI89]
 gi|110644537|ref|YP_672267.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Escherichia coli 536]
 gi|110808098|ref|YP_691618.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Shigella flexneri 5
           str. 8401]
 gi|117626526|ref|YP_859849.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Escherichia coli APEC
           O1]
 gi|157158474|ref|YP_001465680.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Escherichia coli
           E24377A]
 gi|157163645|ref|YP_001460963.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Escherichia coli HS]
 gi|168751468|ref|ZP_02776490.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli
           O157:H7 str. EC4113]
 gi|168754751|ref|ZP_02779758.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli
           O157:H7 str. EC4401]
 gi|168760422|ref|ZP_02785429.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli
           O157:H7 str. EC4501]
 gi|168766459|ref|ZP_02791466.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli
           O157:H7 str. EC4486]
 gi|168774107|ref|ZP_02799114.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli
           O157:H7 str. EC4196]
 gi|168780612|ref|ZP_02805619.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli
           O157:H7 str. EC4076]
 gi|168784817|ref|ZP_02809824.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli
           O157:H7 str. EC869]
 gi|168801835|ref|ZP_02826842.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli
           O157:H7 str. EC508]
 gi|170021810|ref|YP_001726764.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Escherichia coli ATCC
           8739]
 gi|170083626|ref|YP_001732946.1| 23S rRNA (Gm2251)-methyltransferase [Escherichia coli str. K-12
           substr. DH10B]
 gi|170679577|ref|YP_001746575.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Escherichia coli
           SMS-3-5]
 gi|188494408|ref|ZP_03001678.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli
           53638]
 gi|191165658|ref|ZP_03027498.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli B7A]
 gi|191170707|ref|ZP_03032259.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli F11]
 gi|191174517|ref|ZP_03036015.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli F11]
 gi|193066002|ref|ZP_03047060.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli E22]
 gi|193070849|ref|ZP_03051781.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli
           E110019]
 gi|194426679|ref|ZP_03059233.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli B171]
 gi|194434585|ref|ZP_03066842.1| RNA methyltransferase, TrmH family, group 3 [Shigella dysenteriae
           1012]
 gi|194439536|ref|ZP_03071610.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli
           101-1]
 gi|195935970|ref|ZP_03081352.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Escherichia coli
           O157:H7 str. EC4024]
 gi|208806918|ref|ZP_03249255.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli
           O157:H7 str. EC4206]
 gi|208813496|ref|ZP_03254825.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli
           O157:H7 str. EC4045]
 gi|208818601|ref|ZP_03258921.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli
           O157:H7 str. EC4042]
 gi|209399233|ref|YP_002273722.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli
           O157:H7 str. EC4115]
 gi|215489524|ref|YP_002331955.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Escherichia coli
           O127:H6 str. E2348/69]
 gi|217326510|ref|ZP_03442594.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli
           O157:H7 str. TW14588]
 gi|218551450|ref|YP_002385242.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Escherichia
           fergusonii ATCC 35469]
 gi|218556732|ref|YP_002389646.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Escherichia coli
           IAI1]
 gi|218561339|ref|YP_002394252.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Escherichia coli S88]
 gi|218692514|ref|YP_002400726.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Escherichia coli
           ED1a]
 gi|218697929|ref|YP_002405596.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Escherichia coli
           55989]
 gi|218702877|ref|YP_002410506.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Escherichia coli
           IAI39]
 gi|218707791|ref|YP_002415310.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Escherichia coli
           UMN026]
 gi|227886777|ref|ZP_04004582.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Escherichia coli
           83972]
 gi|237703847|ref|ZP_04534328.1| RNA methyltransferase [Escherichia sp. 3_2_53FAA]
 gi|238903287|ref|YP_002929083.1| 23S rRNA (Gm2251)-methyltransferase [Escherichia coli BW2952]
 gi|253775195|ref|YP_003038026.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|254037194|ref|ZP_04871271.1| 23S rRNA-methyltransferase [Escherichia sp. 1_1_43]
 gi|254164109|ref|YP_003047217.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Escherichia coli B
           str. REL606]
 gi|254796199|ref|YP_003081036.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Escherichia coli
           O157:H7 str. TW14359]
 gi|256019825|ref|ZP_05433690.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Shigella sp. D9]
 gi|256025115|ref|ZP_05438980.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Escherichia sp.
           4_1_40B]
 gi|260847010|ref|YP_003224788.1| 23S rRNA (Gm2251)-methyltransferase [Escherichia coli O103:H2 str.
           12009]
 gi|260858333|ref|YP_003232224.1| 23S rRNA (Gm2251)-methyltransferase [Escherichia coli O26:H11 str.
           11368]
 gi|261225300|ref|ZP_05939581.1| 23S rRNA (Gm2251)-methyltransferase [Escherichia coli O157:H7 str.
           FRIK2000]
 gi|261255448|ref|ZP_05947981.1| 23S rRNA (Gm2251)-methyltransferase [Escherichia coli O157:H7 str.
           FRIK966]
 gi|291285592|ref|YP_003502410.1| 23S rRNA (guanosine-2'-O-)-methyltransferase rlmB [Escherichia coli
           O55:H7 str. CB9615]
 gi|293402807|ref|ZP_06646904.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Escherichia coli
           FVEC1412]
 gi|293407907|ref|ZP_06651747.1| RNA methyltransferase [Escherichia coli B354]
 gi|293476491|ref|ZP_06664899.1| RNA methyltransferase [Escherichia coli B088]
 gi|298378337|ref|ZP_06988221.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Escherichia coli
           FVEC1302]
 gi|300816519|ref|ZP_07096740.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli MS
           107-1]
 gi|300821273|ref|ZP_07101421.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli MS
           119-7]
 gi|300899718|ref|ZP_07117944.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli MS
           198-1]
 gi|300906010|ref|ZP_07123734.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli MS
           84-1]
 gi|300920795|ref|ZP_07137196.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli MS
           115-1]
 gi|300922413|ref|ZP_07138533.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli MS
           182-1]
 gi|300929288|ref|ZP_07144764.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli MS
           187-1]
 gi|300940667|ref|ZP_07155228.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli MS
           21-1]
 gi|300949140|ref|ZP_07163182.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli MS
           116-1]
 gi|300955237|ref|ZP_07167630.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli MS
           175-1]
 gi|300987255|ref|ZP_07178084.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli MS
           45-1]
 gi|300988642|ref|ZP_07178782.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli MS
           200-1]
 gi|301023421|ref|ZP_07187204.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli MS
           69-1]
 gi|301028002|ref|ZP_07191286.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli MS
           196-1]
 gi|301045987|ref|ZP_07193170.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli MS
           185-1]
 gi|301302597|ref|ZP_07208727.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli MS
           124-1]
 gi|301325944|ref|ZP_07219365.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli MS
           78-1]
 gi|301646627|ref|ZP_07246493.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli MS
           146-1]
 gi|306815605|ref|ZP_07449754.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Escherichia coli
           NC101]
 gi|307140874|ref|ZP_07500230.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Escherichia coli
           H736]
 gi|307314872|ref|ZP_07594464.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli W]
 gi|309796991|ref|ZP_07691391.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli MS
           145-7]
 gi|312965854|ref|ZP_07780080.1| RNA 2'-O ribose methyltransferase substrate binding family protein
           [Escherichia coli 2362-75]
 gi|312974012|ref|ZP_07788183.1| RNA 2'-O ribose methyltransferase substrate binding family protein
           [Escherichia coli 1827-70]
 gi|331644927|ref|ZP_08346044.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli H736]
 gi|331656008|ref|ZP_08356996.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli M718]
 gi|331660755|ref|ZP_08361687.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli
           TA206]
 gi|331665844|ref|ZP_08366738.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli
           TA143]
 gi|331671085|ref|ZP_08371918.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli
           TA271]
 gi|331671329|ref|ZP_08372127.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli
           TA280]
 gi|331680310|ref|ZP_08380969.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli H591]
 gi|331681199|ref|ZP_08381836.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli H299]
 gi|332280964|ref|ZP_08393377.1| 23S rRNA ()-methyltransferase [Shigella sp. D9]
 gi|52783780|sp|P63177|RLMB_ECOLI RecName: Full=23S rRNA (guanosine-2'-O-)-methyltransferase RlmB;
           AltName: Full=23S rRNA Gm2251 2'-O-methyltransferase
 gi|52783781|sp|P63179|RLMB_ECO57 RecName: Full=23S rRNA (guanosine-2'-O-)-methyltransferase RlmB;
           AltName: Full=23S rRNA Gm2251 2'-O-methyltransferase
 gi|52783782|sp|P63180|RLMB_SHIFL RecName: Full=23S rRNA (guanosine-2'-O-)-methyltransferase RlmB;
           AltName: Full=23S rRNA Gm2251 2'-O-methyltransferase
 gi|54039247|sp|P63178|RLMB_ECOL6 RecName: Full=23S rRNA (guanosine-2'-O-)-methyltransferase RlmB;
           AltName: Full=23S rRNA Gm2251 2'-O-methyltransferase
 gi|12519168|gb|AAG59376.1|AE005651_5 orf, hypothetical protein [Escherichia coli O157:H7 str. EDL933]
 gi|26111504|gb|AAN83686.1|AE016771_197 Hypothetical tRNA/rRNA methyltransferase yjfH [Escherichia coli
           CFT073]
 gi|537021|gb|AAA97076.1| ORF_o243 [Escherichia coli str. K-12 substr. MG1655]
 gi|1790623|gb|AAC77137.1| 23S rRNA (Gm2251)-methyltransferase [Escherichia coli str. K-12
           substr. MG1655]
 gi|13364633|dbj|BAB38579.1| hypothetical protein [Escherichia coli O157:H7 str. Sakai]
 gi|24054863|gb|AAN45752.1| orf, conserved hypothetical protein [Shigella flexneri 2a str. 301]
 gi|30043816|gb|AAP19535.1| hypothetical protein S4603 [Shigella flexneri 2a str. 2457T]
 gi|73858142|gb|AAZ90849.1| conserved hypothetical protein [Shigella sonnei Ss046]
 gi|85676931|dbj|BAE78181.1| 23S rRNA (Gm2251)-methyltransferase [Escherichia coli str. K12
           substr. W3110]
 gi|91075303|gb|ABE10184.1| hypothetical tRNA/rRNA methyltransferase YjfH [Escherichia coli
           UTI89]
 gi|110346129|gb|ABG72366.1| hypothetical tRNA/rRNA methyltransferase YjfH [Escherichia coli
           536]
 gi|110617646|gb|ABF06313.1| conserved hypothetical protein [Shigella flexneri 5 str. 8401]
 gi|115515650|gb|ABJ03725.1| conserved hypothetical protein [Escherichia coli APEC O1]
 gi|157069325|gb|ABV08580.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli HS]
 gi|157080504|gb|ABV20212.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli
           E24377A]
 gi|169756738|gb|ACA79437.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli ATCC
           8739]
 gi|169891461|gb|ACB05168.1| 23S rRNA (Gm2251)-methyltransferase [Escherichia coli str. K-12
           substr. DH10B]
 gi|170517295|gb|ACB15473.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli
           SMS-3-5]
 gi|187770173|gb|EDU34017.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli
           O157:H7 str. EC4196]
 gi|188014500|gb|EDU52622.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli
           O157:H7 str. EC4113]
 gi|188489607|gb|EDU64710.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli
           53638]
 gi|189001755|gb|EDU70741.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli
           O157:H7 str. EC4076]
 gi|189357886|gb|EDU76305.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli
           O157:H7 str. EC4401]
 gi|189364243|gb|EDU82662.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli
           O157:H7 str. EC4486]
 gi|189368907|gb|EDU87323.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli
           O157:H7 str. EC4501]
 gi|189374953|gb|EDU93369.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli
           O157:H7 str. EC869]
 gi|189376090|gb|EDU94506.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli
           O157:H7 str. EC508]
 gi|190904353|gb|EDV64062.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli B7A]
 gi|190905197|gb|EDV64838.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli F11]
 gi|190908931|gb|EDV68518.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli F11]
 gi|192926325|gb|EDV80961.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli E22]
 gi|192955795|gb|EDV86266.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli
           E110019]
 gi|194415418|gb|EDX31686.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli B171]
 gi|194417170|gb|EDX33282.1| RNA methyltransferase, TrmH family, group 3 [Shigella dysenteriae
           1012]
 gi|194421535|gb|EDX37548.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli
           101-1]
 gi|208726719|gb|EDZ76320.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli
           O157:H7 str. EC4206]
 gi|208734773|gb|EDZ83460.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli
           O157:H7 str. EC4045]
 gi|208738724|gb|EDZ86406.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli
           O157:H7 str. EC4042]
 gi|209160633|gb|ACI38066.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli
           O157:H7 str. EC4115]
 gi|209750198|gb|ACI73406.1| hypothetical protein ECs5156 [Escherichia coli]
 gi|209750200|gb|ACI73407.1| hypothetical protein ECs5156 [Escherichia coli]
 gi|209750202|gb|ACI73408.1| hypothetical protein ECs5156 [Escherichia coli]
 gi|209750204|gb|ACI73409.1| hypothetical protein ECs5156 [Escherichia coli]
 gi|209750206|gb|ACI73410.1| hypothetical protein ECs5156 [Escherichia coli]
 gi|215267596|emb|CAS12051.1| 23S rRNA (Gm2251)-methyltransferase [Escherichia coli O127:H6 str.
           E2348/69]
 gi|217322731|gb|EEC31155.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli
           O157:H7 str. TW14588]
 gi|218354661|emb|CAV01659.1| 23S rRNA (Gm2251)-methyltransferase [Escherichia coli 55989]
 gi|218358992|emb|CAQ91652.1| 23S rRNA (Gm2251)-methyltransferase [Escherichia fergusonii ATCC
           35469]
 gi|218363501|emb|CAR01155.1| 23S rRNA (Gm2251)-methyltransferase [Escherichia coli IAI1]
 gi|218368108|emb|CAR05915.1| 23S rRNA (Gm2251)-methyltransferase [Escherichia coli S88]
 gi|218372863|emb|CAR20743.1| 23S rRNA (Gm2251)-methyltransferase [Escherichia coli IAI39]
 gi|218430078|emb|CAR10923.1| 23S rRNA (Gm2251)-methyltransferase [Escherichia coli ED1a]
 gi|218434888|emb|CAR15826.1| 23S rRNA (Gm2251)-methyltransferase [Escherichia coli UMN026]
 gi|222035950|emb|CAP78695.1| 23S rRNA [Escherichia coli LF82]
 gi|226840300|gb|EEH72302.1| 23S rRNA-methyltransferase [Escherichia sp. 1_1_43]
 gi|226901759|gb|EEH88018.1| RNA methyltransferase [Escherichia sp. 3_2_53FAA]
 gi|227836350|gb|EEJ46816.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Escherichia coli
           83972]
 gi|238859752|gb|ACR61750.1| 23S rR