BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780603|ref|YP_003065016.1| tRNA/rRNA methyltransferase
protein [Candidatus Liberibacter asiaticus str. psy62]
         (282 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|254780603|ref|YP_003065016.1| tRNA/rRNA methyltransferase protein [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040280|gb|ACT57076.1| tRNA/rRNA methyltransferase protein [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 282

 Score =  201 bits (510), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 282/282 (100%), Positives = 282/282 (100%)

Query: 1   MNLISKKKSEKIFSLKDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAA 60
           MNLISKKKSEKIFSLKDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAA
Sbjct: 1   MNLISKKKSEKIFSLKDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAA 60

Query: 61  LNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAP 120
           LNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAP
Sbjct: 61  LNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAP 120

Query: 121 LLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSA 180
           LLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSA
Sbjct: 121 LLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSA 180

Query: 181 SGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGL 240
           SGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGL
Sbjct: 181 SGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGL 240

Query: 241 RPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHFAK 282
           RPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHFAK
Sbjct: 241 RPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHFAK 282


>gi|315121804|ref|YP_004062293.1| tRNA/rRNA methyltransferase protein [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495206|gb|ADR51805.1| tRNA/rRNA methyltransferase protein [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 300

 Score =  185 bits (469), Expect = 6e-45,   Method: Composition-based stats.
 Identities = 222/286 (77%), Positives = 251/286 (87%), Gaps = 4/286 (1%)

Query: 1   MNLISKKKSEKIFSLKDSHYAKLRRNHRDYKKMQSFNQK----SRHTSQPENLFLYGVHT 56
           M L+   K+ KI S KDSHYAKLRRN+RD KK+Q  NQK    ++H +Q  NLFLYG+HT
Sbjct: 15  MKLMPPNKNNKISSPKDSHYAKLRRNYRDRKKIQLINQKDTLQNKHITQANNLFLYGIHT 74

Query: 57  VSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLAL 116
           V AALNNP RKIFQLLAT+N+L RL+WDAN PHPFPVK V P TID+IVGKEAVHQGLAL
Sbjct: 75  VGAALNNPQRKIFQLLATRNSLTRLNWDANRPHPFPVKIVSPSTIDQIVGKEAVHQGLAL 134

Query: 117 ETAPLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVL 176
           ET PL SPTLD ++NSQL+++LDH+NDPHN+GAILRS+VAF C GIITT+RYSPSESAVL
Sbjct: 135 ETTPLSSPTLDTIQNSQLIIILDHINDPHNVGAILRSSVAFGCGGIITTRRYSPSESAVL 194

Query: 177 AKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAE 236
           AKSASGALEHIPYIRI NLTDAL K+H+W FQTIGLSS+S  PLE+EIK+DKIALILGAE
Sbjct: 195 AKSASGALEHIPYIRIGNLTDALHKIHAWQFQTIGLSSESNNPLEKEIKSDKIALILGAE 254

Query: 237 GKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHFAK 282
           GKGLR KTQETATS+AHL+MPGIIK+LNVSNAAAVALYITQNHFAK
Sbjct: 255 GKGLRQKTQETATSIAHLNMPGIIKSLNVSNAAAVALYITQNHFAK 300


>gi|302389955|ref|YP_003825776.1| RNA methyltransferase, TrmH family, group 3 [Thermosediminibacter
           oceani DSM 16646]
 gi|302200583|gb|ADL08153.1| RNA methyltransferase, TrmH family, group 3 [Thermosediminibacter
           oceani DSM 16646]
          Length = 265

 Score =  166 bits (419), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 54/257 (21%), Positives = 106/257 (41%), Gaps = 2/257 (0%)

Query: 25  RNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWD 84
            + R  K +++  Q   +  +     + G+     ALN+    +  L+ + + L R    
Sbjct: 6   PSKRQIKMIRALAQLKNYRKRHGLFLVEGLRATEEALNSDY-LVEFLVVSDDFLERHREK 64

Query: 85  ANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDHVNDP 144
                   V  VP +  D +   EA   G+                ++ L++ LD + DP
Sbjct: 65  IKEYENIKVYEVPRKVYDTLSDTEAPQ-GIMAVVRMKNHELTSIYEDNFLIVALDGIKDP 123

Query: 145 HNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHS 204
            NIG I+R+A A    GI+  K      +  + +S  G++ H+P I   +L   L ++  
Sbjct: 124 GNIGTIIRTADAAGASGILAGKGCVDIYNPKVVRSTMGSIFHLPVIEGVDLPVVLHELSQ 183

Query: 205 WGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALN 264
              + +     ++K          + L+ G+E +G+ P+  + +T +  + MPG  ++LN
Sbjct: 184 KRAKIVVTHLGAEKSYFDADLTGPVVLVFGSEAEGVSPEILKISTEVVKIPMPGKAESLN 243

Query: 265 VSNAAAVALYITQNHFA 281
           V+ A  + L+       
Sbjct: 244 VAVAGGIVLFEAVRQRN 260


>gi|256005539|ref|ZP_05430500.1| RNA methyltransferase, TrmH family, group 3 [Clostridium
           thermocellum DSM 2360]
 gi|255990519|gb|EEU00640.1| RNA methyltransferase, TrmH family, group 3 [Clostridium
           thermocellum DSM 2360]
 gi|316940069|gb|ADU74103.1| RNA methyltransferase, TrmH family, group 3 [Clostridium
           thermocellum DSM 1313]
          Length = 267

 Score =  155 bits (392), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 56/281 (19%), Positives = 113/281 (40%), Gaps = 23/281 (8%)

Query: 1   MNLISKKKSEKIFSLKDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAA 60
           MN I+  ++  I  +K                     ++ ++  + +  F+ G+  V  A
Sbjct: 1   MNYITSAQNPIIKEVKSL-------------------KQKKYREEKKLFFIEGIRFVEEA 41

Query: 61  LNNPSRKIFQLLATKNALARLDWDANLP---HPFPVKTVPPQTIDKIVGKEAVHQGLALE 117
           L    +    L++ K A     ++         +PV  +P +   +I   +   QG+   
Sbjct: 42  LKEGVQIERILVSDKLAETNSGYEILKKVSNGGYPVFQLPHKLFMEISDTQ-NPQGILAV 100

Query: 118 TAPLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLA 177
            +       D        ++LD V DP N+G I+R+A A    G+I +K      +  + 
Sbjct: 101 LSMKNCDIEDVWDEKNFFVILDSVQDPGNMGTIIRTADAAGMTGVIVSKGCVDVYNPKVL 160

Query: 178 KSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEG 237
           +S  G++ HIP  +  ++ + + +M   G +      +           + IA+++G E 
Sbjct: 161 RSTMGSIFHIPICQSQDIFETMDRMKKRGIKICAAHLEGSCDYFDLEYKNNIAIVIGNEA 220

Query: 238 KGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQN 278
            G+  + +  A  +  + MPG  ++LN S AA + +Y    
Sbjct: 221 NGISEEVKNFADILVRIPMPGRAESLNASVAAGILMYEILR 261


>gi|125973737|ref|YP_001037647.1| RNA methyltransferase [Clostridium thermocellum ATCC 27405]
 gi|281417893|ref|ZP_06248913.1| RNA methyltransferase, TrmH family, group 3 [Clostridium
           thermocellum JW20]
 gi|125713962|gb|ABN52454.1| RNA methyltransferase, TrmH family, group 3 [Clostridium
           thermocellum ATCC 27405]
 gi|281409295|gb|EFB39553.1| RNA methyltransferase, TrmH family, group 3 [Clostridium
           thermocellum JW20]
          Length = 267

 Score =  155 bits (392), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 56/281 (19%), Positives = 113/281 (40%), Gaps = 23/281 (8%)

Query: 1   MNLISKKKSEKIFSLKDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAA 60
           MN I+  ++  I  +K                     ++ ++  + +  F+ G+  V  A
Sbjct: 1   MNYITSAQNPIIKEVKSL-------------------KQKKYREEKKLFFIEGIRFVEEA 41

Query: 61  LNNPSRKIFQLLATKNALARLDWDANLP---HPFPVKTVPPQTIDKIVGKEAVHQGLALE 117
           L    +    L++ K A     ++         +PV  +P +   +I   +   QG+   
Sbjct: 42  LKEGVQIERILVSDKLAETNSGYEILKKVSNGGYPVFQLPHKLFMEISDTQ-NPQGILAV 100

Query: 118 TAPLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLA 177
            +       D        ++LD V DP N+G I+R+A A    G+I +K      +  + 
Sbjct: 101 LSMKNCDIEDVWDEKNFFVILDSVQDPGNMGTIIRTADAAGMTGVIVSKGCVDVYNPKVL 160

Query: 178 KSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEG 237
           +S  G++ HIP  +  ++ + + +M   G +      +           + IA+++G E 
Sbjct: 161 RSTMGSIFHIPICQSQDIFETMDRMKKRGIKICAAHLEGSCDYFDLEYKNNIAIVIGNEA 220

Query: 238 KGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQN 278
            G+  + +  A  +  + MPG  ++LN S AA + +Y    
Sbjct: 221 NGISEEVKNFADILVRIPMPGRAESLNASVAAGILMYEILR 261


>gi|255281427|ref|ZP_05345982.1| RNA methyltransferase, TrmH family [Bryantella formatexigens DSM
           14469]
 gi|255267915|gb|EET61120.1| RNA methyltransferase, TrmH family [Bryantella formatexigens DSM
           14469]
          Length = 260

 Score =  153 bits (387), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 44/256 (17%), Positives = 102/256 (39%), Gaps = 4/256 (1%)

Query: 26  NHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDA 85
           +++  K +     K++   +       GV         P   + +   +++   +   + 
Sbjct: 6   SNKQIKNLVQLLTKAKARREQGLFVAEGVRMYRE---TPKDDLVKTYVSESFYEKE-ENR 61

Query: 86  NLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDHVNDPH 145
            L     ++ V  +        +     L L      +P       + LL++L+ + DP 
Sbjct: 62  ALLQGTELEIVTDRVFASTSDTKTPQGILCLVRQREYTPAQMLRAENPLLLLLEDIQDPG 121

Query: 146 NIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSW 205
           N+G I R+A A    GII +   +   +    +S  G++  +P++   ++    +K+ + 
Sbjct: 122 NLGTIFRAAEAAGATGIIMSSGTADIYNPKTIRSTMGSIYRMPFLYTKDIAAMQEKLKAR 181

Query: 206 GFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNV 265
           G +T            ++      A ++G EG+GL     E A +   + M G +++LN 
Sbjct: 182 GIRTYAAHLKGSCTYTEQAYRKGCAFLIGNEGRGLSDALAEKADARIKIPMSGEVESLNA 241

Query: 266 SNAAAVALYITQNHFA 281
           + +AA+ ++  +   +
Sbjct: 242 AVSAAILMFEAKRQRS 257


>gi|121534244|ref|ZP_01666069.1| tRNA/rRNA methyltransferase (SpoU) [Thermosinus carboxydivorans
           Nor1]
 gi|121307347|gb|EAX48264.1| tRNA/rRNA methyltransferase (SpoU) [Thermosinus carboxydivorans
           Nor1]
          Length = 270

 Score =  153 bits (386), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 60/260 (23%), Positives = 105/260 (40%), Gaps = 4/260 (1%)

Query: 24  RRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNA---LAR 80
             N++  KK+ S  QK ++  +     + G+  V  A  +  R        K A     +
Sbjct: 7   SSNNQVIKKVASLKQK-KYRDEYNLFVVEGIRLVEEAAGSTWRPAMCFYTEKAAAAPRVQ 65

Query: 81  LDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDH 140
              +        +  V      KI   E     L +      +       + +L++VLD+
Sbjct: 66  ATLEILAAKGCRIFPVADNVYAKITDTEQPQGILCVMEKKRYTFDDLQSSDRELIVVLDN 125

Query: 141 VNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQ 200
           V DP N+G ++R+A A  C G+I TK  +   S    ++  G+L H+P I      +   
Sbjct: 126 VQDPGNVGTVVRTADAAGCCGVILTKGCADLFSGKTVRATMGSLFHLPVITGVAEQEVAA 185

Query: 201 KMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGII 260
            +   G + +  + DS            +A++ G EG G+     E A    ++ + G  
Sbjct: 186 FLERQGIRLLATALDSSSLYHDVDLRSPVAIVFGNEGAGVSKVILEKADERLYIPLYGRA 245

Query: 261 KALNVSNAAAVALYITQNHF 280
           ++LNV+ AAAV LY  +   
Sbjct: 246 ESLNVAVAAAVILYEARRQR 265


>gi|153853513|ref|ZP_01994893.1| hypothetical protein DORLON_00882 [Dorea longicatena DSM 13814]
 gi|149753668|gb|EDM63599.1| hypothetical protein DORLON_00882 [Dorea longicatena DSM 13814]
          Length = 263

 Score =  152 bits (383), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 46/260 (17%), Positives = 102/260 (39%), Gaps = 6/260 (2%)

Query: 26  NHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLD--- 82
           ++   K++ +  +K +   +     + G+         P  K+ ++  +++   +     
Sbjct: 6   SNARIKRLVNLKKKRKLRDEESVFLVEGIRMFREV---PLDKLKEVYVSESFYKKEKDTV 62

Query: 83  WDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDHVN 142
            +        V+ +           +     L +                 L+MVLDH+ 
Sbjct: 63  KEVLKDSKVRVEELTDTVFAHASDTKTPQGILCVVEQMNHEINELTSAKCPLIMVLDHLQ 122

Query: 143 DPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKM 202
           DP N+G ILR+A      GI+  +      +    +S  G++  +P++ + +L   +Q +
Sbjct: 123 DPGNLGTILRTAEGAGVTGILMDRECVDVYNPKTIRSTMGSIYRMPFVYVEDLGKGIQDL 182

Query: 203 HSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKA 262
              G  T     +     ++E   +  A ++G EG GLR +  + A     + M G +++
Sbjct: 183 KDKGITTYAAHLEGTNSYDEEDLTNPCAFLIGNEGNGLRREIADMADCYVKIPMLGQVES 242

Query: 263 LNVSNAAAVALYITQNHFAK 282
           LN + A++V ++       K
Sbjct: 243 LNAAIASSVLMFEAARQRRK 262


>gi|300857265|ref|YP_003782249.1| putative rRNA methylase [Clostridium ljungdahlii DSM 13528]
 gi|300437380|gb|ADK17147.1| predicted rRNA methylase [Clostridium ljungdahlii DSM 13528]
          Length = 266

 Score =  151 bits (382), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 65/264 (24%), Positives = 114/264 (43%), Gaps = 15/264 (5%)

Query: 29  DYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNAL---ARLDWDA 85
            YKK  +   K+          + G + V  AL + +  I Q+   +  +     +    
Sbjct: 4   KYKKSTNLTDKTEFR----EDLIEGRNAVIEALKSSNTTIEQIFLAEGNMSGSINIILAK 59

Query: 86  NLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAV-------RNSQLLMVL 138
                  VK V  + +DKI  +   HQG+  +  P     ++ +       + +  ++VL
Sbjct: 60  AKEKHIVVKQVDRKKLDKIS-QTGAHQGVIAQITPYKYCEVEDILEYAREKKEAPFIIVL 118

Query: 139 DHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDA 198
           D + DPHN GAI+R+A      GII  KR +   + V+ KS+ GA E++   +++NL   
Sbjct: 119 DEIEDPHNFGAIIRTAEICGAHGIIIPKRRNVGITPVVYKSSVGAAEYMKICKVTNLNTT 178

Query: 199 LQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPG 258
           ++K+   G    G     +            ALI+G+EG+G+   T+E    +  + M G
Sbjct: 179 IEKLKKDGIWVYGADMSGENYCFDVDFKGPAALIIGSEGRGIAKLTKEKCDVLVKIPMVG 238

Query: 259 IIKALNVSNAAAVALYITQNHFAK 282
            + +LN S A  + +Y       K
Sbjct: 239 RVSSLNASVAGGILMYEILKQRIK 262


>gi|114704462|ref|ZP_01437370.1| putative trna/rrna methyltransferase protein [Fulvimarina pelagi
           HTCC2506]
 gi|114539247|gb|EAU42367.1| putative trna/rrna methyltransferase protein [Fulvimarina pelagi
           HTCC2506]
          Length = 310

 Score =  150 bits (378), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 142/265 (53%), Positives = 184/265 (69%), Gaps = 8/265 (3%)

Query: 16  KDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATK 75
           +D+HYA LRR HRD K+    N        PE L LYG+HTV+AAL NP R   +LL T+
Sbjct: 50  RDTHYANLRRAHRDRKRELKPN-------APEPLLLYGLHTVAAALQNPDRIRHRLLITR 102

Query: 76  NALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLL 135
           NA ARL+ D +     P++ V P+ +D+++G EAVHQG  LET PL    LDA+ ++ LL
Sbjct: 103 NARARLELD-DAEIDCPIEQVEPKDLDRLLGGEAVHQGACLETEPLEPLRLDALGDATLL 161

Query: 136 MVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNL 195
           +VLD V DPHN+GAILRSA AF+ DG+ITT R+SP ES VLAK+ASGALEH+  I + NL
Sbjct: 162 LVLDQVTDPHNVGAILRSATAFAADGLITTSRHSPRESGVLAKAASGALEHVRQIEVRNL 221

Query: 196 TDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLH 255
            + L+++   GF+TIGL S+ +   EQ I+ +KIA++LGAEGKGLR KT+ T   +A L 
Sbjct: 222 AETLERLSKLGFRTIGLDSEGESDFEQAIEGEKIAVVLGAEGKGLRQKTRATCDVLARLE 281

Query: 256 MPGIIKALNVSNAAAVALYITQNHF 280
           MPG I +LNVSNAAAVALY  +   
Sbjct: 282 MPGAIHSLNVSNAAAVALYAIRRRL 306


>gi|295399475|ref|ZP_06809457.1| tRNA/rRNA methyltransferase (SpoU) [Geobacillus thermoglucosidasius
           C56-YS93]
 gi|312109966|ref|YP_003988282.1| tRNA/rRNA methyltransferase (SpoU) [Geobacillus sp. Y4.1MC1]
 gi|294978941|gb|EFG54537.1| tRNA/rRNA methyltransferase (SpoU) [Geobacillus thermoglucosidasius
           C56-YS93]
 gi|311215067|gb|ADP73671.1| tRNA/rRNA methyltransferase (SpoU) [Geobacillus sp. Y4.1MC1]
          Length = 256

 Score =  149 bits (377), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 65/277 (23%), Positives = 112/277 (40%), Gaps = 27/277 (9%)

Query: 1   MNLISKKKSEKIFSLKDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAA 60
           M  I   K+ ++   K                        +   +     + G H V  A
Sbjct: 1   MKRIESVKNPQVKQWKKLLMK-------------------KERDKTGLFLIEGFHLVEEA 41

Query: 61  LNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAP 120
           L +    I QL+  +N      WD +     PV  V    +  I   E   QG+A     
Sbjct: 42  LKSNI-SIIQLIVKENKAIPATWDIS---GIPVAIVTEDVMKAISDTE-TPQGIAAVCEQ 96

Query: 121 LLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSA 180
            L   +D  R + LL+  D V DP NIG ++R+A A   D +I  K  +   +  + ++ 
Sbjct: 97  FLYGDIDWTRANVLLI--DAVQDPGNIGTMIRTADAAGIDAVILGKGCADLYNPKVIRAT 154

Query: 181 SGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGL 240
            G+L H+P IR +   + ++K+        G S ++ +           AL++G EG G+
Sbjct: 155 QGSLFHLPIIRGNLR-EWIEKLQEQNVPIYGTSLENGEDYRCINPPRPFALLVGNEGSGV 213

Query: 241 RPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQ 277
             +  +  T   ++ + G  ++LNV+ AA + LY  +
Sbjct: 214 HKELLQMTTKNLYIPIYGQAESLNVAVAAGILLYHLR 250


>gi|210610310|ref|ZP_03288339.1| hypothetical protein CLONEX_00529 [Clostridium nexile DSM 1787]
 gi|210152540|gb|EEA83546.1| hypothetical protein CLONEX_00529 [Clostridium nexile DSM 1787]
          Length = 257

 Score =  149 bits (376), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 44/255 (17%), Positives = 104/255 (40%), Gaps = 4/255 (1%)

Query: 26  NHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDA 85
           ++   K +    +KS+  ++ +   + G+         P  ++ ++  +++   +   + 
Sbjct: 6   SNPQVKNLLQLQKKSKVRNEEQVFIVEGLRMFMEV---PQDQVKKVYVSESLYNKKKEEL 62

Query: 86  NLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDHVNDPH 145
           +L   FPV+ +  +    +   +     L +             + +   +VLD++ DP 
Sbjct: 63  HLER-FPVEVLADKVFQHVSDTKTPQGILCVVKQRKYEIEDLISKENPHFIVLDNLQDPG 121

Query: 146 NIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSW 205
           N+G I+R+A       +  +       +    +S  G++  +P++ + +L   L K    
Sbjct: 122 NLGTIVRTAEGAGVTAVFMSNDCVDIYNPKTIRSTMGSIYRVPFVYVDDLLALLDKFQKK 181

Query: 206 GFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNV 265
              T       K   ++E      A+++G EG GLR +  E A     + M G +++LN 
Sbjct: 182 KVTTYAAHLKGKNTYDKENYQSGTAILIGNEGNGLRDEVAEKADVWVQIPMQGKVESLNA 241

Query: 266 SNAAAVALYITQNHF 280
           + AA++ ++      
Sbjct: 242 AIAASILMFEVYRQR 256


>gi|86609412|ref|YP_478174.1| RNA methyltransferase [Synechococcus sp. JA-2-3B'a(2-13)]
 gi|86557954|gb|ABD02911.1| RNA methyltransferase, TrmH family [Synechococcus sp.
           JA-2-3B'a(2-13)]
          Length = 270

 Score =  149 bits (375), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 43/258 (16%), Positives = 94/258 (36%), Gaps = 4/258 (1%)

Query: 24  RRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDW 83
              +   +K++  + +S+   +     + G H +  AL               A      
Sbjct: 8   SPKNPWIRKLRQLH-RSKGRREQGAFLVEGSHLIEEALRVGWPLQALCYTPDWASRHPHL 66

Query: 84  DANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDHVND 143
            A+LP     + V  + +  +   E+    +A+  +  +S     +   +L +V++ + D
Sbjct: 67  LADLPKGLRRQPVSSEVMAALCTTESPEGAVAVAVSWQISSP--PLSKLRLGLVVETLQD 124

Query: 144 PHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISN-LTDALQKM 202
           P N+G+++R   A   DG+  +      E+  + ++++G     P   + +         
Sbjct: 125 PGNLGSLIRVVAAAGADGLWLSADSVDPENPKVLRASAGQWFRRPPQVVPDLAAWIQSCR 184

Query: 203 HSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKA 262
                      S +      +        +LG EG GLR  T + A +   + M   +++
Sbjct: 185 CHGIQVLAATLSPTANCYWDQDLTRPTLFLLGNEGAGLREATIQQADAQVRIPMAEGVES 244

Query: 263 LNVSNAAAVALYITQNHF 280
           LNV+    + LY      
Sbjct: 245 LNVAMTGGLLLYEALRQR 262


>gi|323141055|ref|ZP_08075960.1| putative RNA methyltransferase, TrmH family, group 3
           [Phascolarctobacterium sp. YIT 12067]
 gi|322414431|gb|EFY05245.1| putative RNA methyltransferase, TrmH family, group 3
           [Phascolarctobacterium sp. YIT 12067]
          Length = 261

 Score =  149 bits (375), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 53/257 (20%), Positives = 104/257 (40%), Gaps = 2/257 (0%)

Query: 26  NHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDA 85
            +   K      QK ++  Q       G+ TV  A+   + +     A ++   R   + 
Sbjct: 7   QNPMVKAAAELKQK-KYRQQQGLFLAEGLRTVEEAVRYGAVQSIFYTAIEDDRTRAVLEE 65

Query: 86  NLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDHVNDPH 145
                  +  V  + + KI   E   QG+            + + + ++L+VLD V DP 
Sbjct: 66  AAAKQIKLVCVSDKVLKKIADTE-TPQGIIAVCEMRSKRLDEFLASGKMLLVLDRVTDPG 124

Query: 146 NIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSW 205
           NIG +LR+A A    G++  +  +   +    +++ G+L H+P +   +    +Q     
Sbjct: 125 NIGTMLRTADAAGVGGLLLLQGCADIYAPKTVRASMGSLFHLPVLSGLSEELLVQAARKA 184

Query: 206 GFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNV 265
           G++ +    D    L +     ++A ++G E  G+ P     A     + M G  ++LNV
Sbjct: 185 GYELLVTCLDGADNLYKADLQGRLAFVMGNEANGVSPALLAAADKRVFIPMQGRAESLNV 244

Query: 266 SNAAAVALYITQNHFAK 282
           + AA + ++       K
Sbjct: 245 AMAAGIVMFEALRQKLK 261


>gi|15896402|ref|NP_349751.1| rRNA methylase [Clostridium acetobutylicum ATCC 824]
 gi|15026220|gb|AAK81091.1|AE007810_10 RRNA methylase, YACO B.subtilis ortholog [Clostridium
           acetobutylicum ATCC 824]
 gi|325510559|gb|ADZ22195.1| RRNA methylase [Clostridium acetobutylicum EA 2018]
          Length = 252

 Score =  148 bits (374), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 60/247 (24%), Positives = 115/247 (46%), Gaps = 10/247 (4%)

Query: 44  SQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPH--PFPVKTVPPQTI 101
           ++     + G + V  AL + S     L+++  +   ++           PVK V  + +
Sbjct: 3   NKEREDLIEGRNAVIEALKSDSTIEQVLVSSGKSEGSINVILAKAKEKGIPVKYVDRKKL 62

Query: 102 DKIVGKEAVHQGLALETAPLLSPTLDAV-------RNSQLLMVLDHVNDPHNIGAILRSA 154
           DKI     VHQG+   + P     +D +            ++VLD + DPHN+G+I+R+A
Sbjct: 63  DKIS-NGGVHQGVIAISTPYNYCDVDDIILNAKEKNEDPFILVLDEIEDPHNLGSIIRTA 121

Query: 155 VAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSS 214
                 GII  KR +   +  + K+++GA++++   ++SN+  A+ K+   G    G   
Sbjct: 122 ELCGVHGIIIPKRRNVGVTPTVYKTSAGAVKYVKIAKVSNINLAIDKLKKEGIWVYGAEI 181

Query: 215 DSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
           D +     +     +AL++G+EG+G+   T++    +  + M G + +LN S AA + +Y
Sbjct: 182 DGENYCYNQNMTGALALVIGSEGRGISKLTKQKCDVLVKIPMVGKVNSLNASVAAGIVMY 241

Query: 275 ITQNHFA 281
                  
Sbjct: 242 EILKQRI 248


>gi|222148346|ref|YP_002549303.1| tRNA/rRNA metyltransferase [Agrobacterium vitis S4]
 gi|221735334|gb|ACM36297.1| tRNA/rRNA metyltransferase [Agrobacterium vitis S4]
          Length = 293

 Score =  148 bits (374), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 148/288 (51%), Positives = 193/288 (67%), Gaps = 14/288 (4%)

Query: 6   KKKSEKIFSLKDSHYAKLRRNHRDYKKMQS--FNQKSRHTSQPE-----------NLFLY 52
            K +    S +DSHYA LRR  RD K+ +      + +   +              +FLY
Sbjct: 2   SKDNPNDTSDRDSHYATLRRQVRDAKRERGEIPTPQPQKRRKSNADWTPPPIAPDQVFLY 61

Query: 53  GVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQ 112
           G+HTV AALNNP RK  +L  T+NAL RL+       PFPV+ V PQ +DK +G EA+HQ
Sbjct: 62  GLHTVRAALNNPERKPIKLSLTQNALVRLEIGPVDALPFPVEIVTPQDLDKHLGPEAIHQ 121

Query: 113 GLALETAPLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSE 172
           G+ LET PL    L+A++ S LL+VLD V DPHN+GAI+R+AVAF    +ITT R+SP+E
Sbjct: 122 GVMLETRPLPPRRLEALKESPLLLVLDQVTDPHNVGAIMRTAVAFGAGAVITTMRHSPTE 181

Query: 173 SAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALI 232
           S VLAKSASGALE IPYI+I+NL +AL ++H  GF +IGL S+  +PLE+    DK+AL+
Sbjct: 182 SGVLAKSASGALELIPYIQITNLAEALGELHKLGFVSIGLDSEGPRPLEETFSGDKLALV 241

Query: 233 LGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
           LG+EGKGLR KT++T  ++A L MPG IK+LNVSNAAA+ALY     F
Sbjct: 242 LGSEGKGLRQKTRDTVNALARLDMPGEIKSLNVSNAAAIALY-ASRQF 288


>gi|163759379|ref|ZP_02166465.1| RNA methyltransferase, TrmH family, group 3 [Hoeflea phototrophica
           DFL-43]
 gi|162283783|gb|EDQ34068.1| RNA methyltransferase, TrmH family, group 3 [Hoeflea phototrophica
           DFL-43]
          Length = 300

 Score =  148 bits (373), Expect = 8e-34,   Method: Composition-based stats.
 Identities = 135/285 (47%), Positives = 191/285 (67%), Gaps = 16/285 (5%)

Query: 14  SLKDSHYAKLRRNHRDYKKMQS----FNQKSRH------------TSQPENLFLYGVHTV 57
           S +D+HYAKLRR+HRD K+ +        + +                 E+++LYG+HTV
Sbjct: 12  SNRDTHYAKLRRSHRDAKREREGLPPVQPRGKRDLPARKGALYAERGAAESVYLYGLHTV 71

Query: 58  SAALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALE 117
            AAL+NP+R+I  L AT+NAL RL+   +   PFPV+ V PQ ID+++G +AVHQG+ LE
Sbjct: 72  RAALDNPARQITSLKATRNALMRLEIAEDAELPFPVELVAPQEIDRLLGDDAVHQGVLLE 131

Query: 118 TAPLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLA 177
             PL +  L  + ++ L+++LD V DPHN+GAI+RSAVAF    ++TT+R+SP ES VLA
Sbjct: 132 ARPLSARPLTDLGDATLVVILDQVTDPHNVGAIMRSAVAFGAGALVTTQRHSPQESGVLA 191

Query: 178 KSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEG 237
           K+ASGALE I +I + NL  A++ + + GF T+GL S+   P+E  +K  +IA++LGAEG
Sbjct: 192 KAASGALEMIDHIEVRNLASAIEDIKAQGFTTVGLDSEGPSPIEAGLKGARIAMVLGAEG 251

Query: 238 KGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHFAK 282
           KGLR KT+ET   +  L MPG IK+LNVSNA A+ALY  Q +  +
Sbjct: 252 KGLRQKTRETVDVLTRLDMPGAIKSLNVSNATAIALYAAQQYLNR 296


>gi|302876553|ref|YP_003845186.1| RNA methyltransferase, TrmH family, group 3 [Clostridium
           cellulovorans 743B]
 gi|307687225|ref|ZP_07629671.1| RNA methyltransferase [Clostridium cellulovorans 743B]
 gi|302579410|gb|ADL53422.1| RNA methyltransferase, TrmH family, group 3 [Clostridium
           cellulovorans 743B]
          Length = 309

 Score =  148 bits (372), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 64/297 (21%), Positives = 121/297 (40%), Gaps = 27/297 (9%)

Query: 9   SEKIFSLKDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPENL-------------FLYGVH 55
            +++   K   Y K    +   K  +    +     +P++               + G +
Sbjct: 17  KDQVKGKKKDFYQK---ENIKGKVDRKLEVRRNEERKPKDFETVKFESQVVREDIIEGRN 73

Query: 56  TVSAALNNPSRKIFQLLATKNA---LARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQ 112
            V  AL + S  I Q+L  K        +           VK V  + +D++  +  VHQ
Sbjct: 74  AVIEALKSSSTTIEQILVAKGDTTGSINVVLAEAREKRLVVKEVDRKKLDEMS-QTGVHQ 132

Query: 113 GLALETAPLLSPTLDAVRNS-------QLLMVLDHVNDPHNIGAILRSAVAFSCDGIITT 165
           G+     P     ++ +            +++LD + DPHN+GAILR+A      G++  
Sbjct: 133 GVIAIVTPYKYCEVEDILEYAQKKGEDPFIIILDEIEDPHNLGAILRTAEVCGVHGVVIP 192

Query: 166 KRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIK 225
           KR +   +  + K+++GA++++   ++ N+   +  +   G    G   D K   +    
Sbjct: 193 KRRNVGITPTVYKTSAGAVQYMKVAKVPNINSVIDSLKKKGIWIYGADMDGKVYCQDANF 252

Query: 226 NDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHFAK 282
               ALI+G+EG+G+   T+E    +  + M G I +LN S A  + +Y       K
Sbjct: 253 RGAAALIIGSEGRGISKLTKEKCDLLVKIPMVGQITSLNASVAGGILMYEILTQRMK 309


>gi|163785954|ref|ZP_02180402.1| putative rRNA methylase [Flavobacteriales bacterium ALC-1]
 gi|159877814|gb|EDP71870.1| putative rRNA methylase [Flavobacteriales bacterium ALC-1]
          Length = 265

 Score =  147 bits (371), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 50/258 (19%), Positives = 101/258 (39%), Gaps = 3/258 (1%)

Query: 24  RRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDW 83
              +   K++    +KSR   +     + G   +S A+     +I  LL   +  +  + 
Sbjct: 7   SPQNPLIKQLAQLKEKSRERKKSGLFLIEGKRELSLAIK-GGYEIKTLLFFPDLFSESEA 65

Query: 84  DANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPT-LDAVRNSQLLMVLDHVN 142
            A   +   +  +  +   K+  ++     +A+  +   +   L     + L++V +   
Sbjct: 66  KAMSSYGIEIIEISKEVFQKLAHRDTTEGVIAVVKSKDHTLEALTLKSKNPLILVAEAPE 125

Query: 143 DPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKM 202
            P NIGAILR+A A S D +I                +S        I +++  DA+  +
Sbjct: 126 KPGNIGAILRTADAASVDAVII-ANPKSDLYNPNIIRSSVGCVFTTEIAMASSNDAILYL 184

Query: 203 HSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKA 262
             + F          +P   +      A+++G E  GL    ++ AT    + M G+I +
Sbjct: 185 QKYNFNLFSAILQESEPYHTQDYTLPTAIVVGTEATGLTQAWRDAATQNISIPMHGVIDS 244

Query: 263 LNVSNAAAVALYITQNHF 280
           +NVS AA + ++  +   
Sbjct: 245 MNVSVAAGILIFEAKRQR 262


>gi|90417781|ref|ZP_01225693.1| RNA methyltransferase, TrmH family, group 3 [Aurantimonas
           manganoxydans SI85-9A1]
 gi|90337453|gb|EAS51104.1| RNA methyltransferase, TrmH family, group 3 [Aurantimonas
           manganoxydans SI85-9A1]
          Length = 284

 Score =  147 bits (370), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 140/274 (51%), Positives = 181/274 (66%), Gaps = 10/274 (3%)

Query: 16  KDSHYAKLRRNHRDYKK---------MQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSR 66
           KD+HYA LRR HRD K+               +    +    + LYG+HTV+AALNNP R
Sbjct: 11  KDTHYATLRRAHRDRKRTDGGAAPAGALKRRPQPGRPAPAGRVRLYGIHTVAAALNNPHR 70

Query: 67  KIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTL 126
           K+  LL T+NALARL   A      PV+ V P+ +D  +G EAVHQG+ LET PL +  L
Sbjct: 71  KLHSLLVTRNALARL-EIAEDAIRCPVEMVEPKRLDAELGGEAVHQGVMLETEPLPAIRL 129

Query: 127 DAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEH 186
             +  ++L++VLD V DPHN+GAILRSA AF  D ++TT R+SP ES VLAK+ASGALEH
Sbjct: 130 SDLGKARLVIVLDQVTDPHNVGAILRSATAFGADALVTTARHSPQESGVLAKAASGALEH 189

Query: 187 IPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQE 246
           +  I + NL DAL  +   GF+TIGL SD  +  E  +  ++IA++LGAEGKGLR KTQ 
Sbjct: 190 VTQIEVVNLADALSALSKQGFRTIGLDSDGPESFEASLSGERIAIVLGAEGKGLRQKTQA 249

Query: 247 TATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
           T  ++A L MPG I++LNVSNAAA+ALY T+ H 
Sbjct: 250 TVDALARLEMPGAIRSLNVSNAAAIALYATRRHL 283


>gi|170757788|ref|YP_001783140.1| RNA methyltransferase [Clostridium botulinum B1 str. Okra]
 gi|169123000|gb|ACA46836.1| RNA methyltransferase, TrmH family, group 3 [Clostridium botulinum
           B1 str. Okra]
          Length = 257

 Score =  147 bits (370), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 53/254 (20%), Positives = 102/254 (40%), Gaps = 8/254 (3%)

Query: 37  NQKSRHTSQPENLFLYGVHTVSAALNNPS--RKIFQLLATKNALARLDWDANLPHPFPVK 94
             +     +     + G + V  AL +     K+           ++           + 
Sbjct: 2   KNRVGQQEEIREDIIEGRNAVIEALKSNKTIEKVMVAKGDLEGSIKIIISLAKEKGIVIN 61

Query: 95  TVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRN------SQLLMVLDHVNDPHNIG 148
            V  + +D I    A    +A  T        D +R          +++LD + DPHN G
Sbjct: 62  EVDRKKLDSISQTRAHQGVIAFTTPYQYCAVEDIIRYAKQKEEDPFIIILDEIEDPHNFG 121

Query: 149 AILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQ 208
           +ILR+A      G+I  KR +   +  + K+++GA+E++   +++N+ + + K+   G  
Sbjct: 122 SILRTAEVCGAHGVIIPKRRNVGVTPTVYKTSAGAVEYMKISKVTNINNVIDKLKEKGIW 181

Query: 209 TIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNA 268
             G              +  IAL++G+EG+G+   T+    ++  + M G I +LN S A
Sbjct: 182 IYGADMCGNDYCFDVNLSGPIALVIGSEGRGISKLTKNKCDALVKIPMFGNITSLNASVA 241

Query: 269 AAVALYITQNHFAK 282
             + +Y       K
Sbjct: 242 GGMLMYEILKQRMK 255


>gi|296131814|ref|YP_003639061.1| RNA methyltransferase, TrmH family, group 3 [Thermincola sp. JR]
 gi|296030392|gb|ADG81160.1| RNA methyltransferase, TrmH family, group 3 [Thermincola potens JR]
          Length = 244

 Score =  146 bits (369), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 64/239 (26%), Positives = 114/239 (47%), Gaps = 11/239 (4%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLATKNA-LARLDWDANLPHPFPVKTVPPQTIDKIVGKE 108
            +YG + V  AL    R I ++L       A    +       PV+    +++DK+V  +
Sbjct: 4   IIYGRNPVIEALKA-ERPINKILLQHGTTRAGDILNLARQRKIPVQEADKRSLDKLV--Q 60

Query: 109 AVHQGLALETAPLLSPTLDAV-------RNSQLLMVLDHVNDPHNIGAILRSAVAFSCDG 161
             HQG+    A      +D +            +++LD + DPHN+GAI+R+A A    G
Sbjct: 61  GNHQGVIALVAMKAYADIDDILKTAQEKGEDPFILLLDELEDPHNLGAIIRTADAVGIHG 120

Query: 162 IITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLE 221
           ++  +R +   +  + K+++GA+E++   R++NL   ++ +   G   +G  + + + L 
Sbjct: 121 VVIPRRRAVGITPAVVKASAGAVEYVSVCRVTNLAQTIEYLKEKGCWVVGADAAAPQNLW 180

Query: 222 QEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
           Q      +AL++G+EGKG+    +E    +  L M G I +LN S AAAV  Y      
Sbjct: 181 QADLQGPLALVIGSEGKGISRLVREKCDFLVRLPMQGKIGSLNASVAAAVLCYEVLRQR 239


>gi|168187716|ref|ZP_02622351.1| RNA methyltransferase, TrmH family, group 3 [Clostridium botulinum
           C str. Eklund]
 gi|169294429|gb|EDS76562.1| RNA methyltransferase, TrmH family, group 3 [Clostridium botulinum
           C str. Eklund]
          Length = 263

 Score =  146 bits (369), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 57/260 (21%), Positives = 119/260 (45%), Gaps = 12/260 (4%)

Query: 31  KKMQSFNQKS--RHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDA--N 86
           K++++ N+++  R   +     + G + V  AL +     + ++A  N    ++      
Sbjct: 2   KELKNRNKRNFNREEKEEREDLIEGRNAVIEALRSDRTIEYVMVAKGNMTGSINKVLGIA 61

Query: 87  LPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNS-------QLLMVLD 139
                 +K V  + +D +      HQG+     P     ++ + N          +++LD
Sbjct: 62  KDKGIIIKEVDRKKLDSMS-ITGSHQGVMAIVTPYKYSEVEDIFNYAKEKGEEPFILILD 120

Query: 140 HVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDAL 199
            + DPHN+G+I+R+A      GI+  KR +   +  + K+++GA E++   +++N+  A+
Sbjct: 121 EIEDPHNLGSIMRTAEICGVHGIVIPKRRNVGVTPTVYKTSAGAAEYVKVAKVANINRAI 180

Query: 200 QKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGI 259
            ++   G    G   D +    Q      +AL++G+EG+G+   T++    +  + M G 
Sbjct: 181 DEIKERGTWVYGADMDGENYCFQTNFKGAVALVIGSEGRGISKLTKQKCDVLVKIPMIGK 240

Query: 260 IKALNVSNAAAVALYITQNH 279
           I +LN S AA + +Y     
Sbjct: 241 ITSLNASVAAGIMMYEVLKQ 260


>gi|325293360|ref|YP_004279224.1| tRNA/rRNA metyltransferase [Agrobacterium sp. H13-3]
 gi|325061213|gb|ADY64904.1| tRNA/rRNA metyltransferase [Agrobacterium sp. H13-3]
          Length = 295

 Score =  146 bits (368), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 151/291 (51%), Positives = 195/291 (67%), Gaps = 14/291 (4%)

Query: 6   KKKSEKIFSLKDSHYAKLRRNHRDYKKMQSF---NQKSRHTSQPENLF-----------L 51
            K      S +D+HYA LRR  RD K+ +      Q+ +  ++    +           L
Sbjct: 2   SKDDPNDKSTRDTHYATLRRAVRDAKRERGEIPTPQQPKRRNRGAEDWKPPQLAPDQVHL 61

Query: 52  YGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVH 111
           YG+HTV AAL+NP R++ +L  T NA ARLD       PFPV+ V PQ IDK++G EA+H
Sbjct: 62  YGLHTVRAALSNPERQLIKLSVTLNAFARLDIGEADAQPFPVEIVSPQDIDKVLGPEAIH 121

Query: 112 QGLALETAPLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPS 171
           QG+ LET PL    LDA++ S L++VLD V DPHN+GAI+RSAVAF+   +ITT R+SP+
Sbjct: 122 QGVMLETRPLPVKKLDALKKSPLILVLDQVTDPHNVGAIMRSAVAFNAGAVITTIRHSPT 181

Query: 172 ESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIAL 231
           ES VLAKSASGALE IPYI+I+NL D L ++H  GF ++GL S+   P+EQ     KIAL
Sbjct: 182 ESGVLAKSASGALELIPYIQITNLADTLGELHKLGFFSVGLDSEGPAPIEQTFTGAKIAL 241

Query: 232 ILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHFAK 282
           +LGAEGKGLR KT+ET +++A L MPG IK+LNVSNAAA+ALY TQ    K
Sbjct: 242 VLGAEGKGLRQKTRETVSALARLDMPGEIKSLNVSNAAAIALYATQQFLGK 292


>gi|15889284|ref|NP_354965.1| tRNA/rRNA metyltransferase [Agrobacterium tumefaciens str. C58]
 gi|15157117|gb|AAK87750.1| tRNA/rRNA metyltransferase [Agrobacterium tumefaciens str. C58]
          Length = 295

 Score =  146 bits (368), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 151/291 (51%), Positives = 196/291 (67%), Gaps = 14/291 (4%)

Query: 6   KKKSEKIFSLKDSHYAKLRRNHRDYKKMQSF---NQKSRHTSQPENLF-----------L 51
            K      S +D+HYA LRR  RD K+ +      Q+ +  ++  + +           L
Sbjct: 2   SKDDPNDKSTRDTHYATLRRAVRDAKRERGEIPTPQQPKRRNRGADDWKPPQLAPDQVHL 61

Query: 52  YGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVH 111
           YG+HTV AAL+NP R++ +L  T NA ARLD       PFPV+ V PQ IDK++G EA+H
Sbjct: 62  YGLHTVRAALSNPQRQLIKLSVTLNAFARLDIGEADAQPFPVEIVSPQEIDKVLGPEAIH 121

Query: 112 QGLALETAPLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPS 171
           QG+ LET PL    LDA++ S L++VLD V DPHN+GAI+RSAVAF+   +ITT R+SP+
Sbjct: 122 QGVMLETRPLPVKKLDALKKSPLILVLDQVTDPHNVGAIMRSAVAFNAGAVITTIRHSPT 181

Query: 172 ESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIAL 231
           ES VLAKSASGALE IPYI+I+NL D L ++H  GF ++GL S+   P+EQ     KIAL
Sbjct: 182 ESGVLAKSASGALELIPYIQITNLADTLGELHKLGFFSVGLDSEGPAPIEQTFTGAKIAL 241

Query: 232 ILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHFAK 282
           +LGAEGKGLR KT+ET +++A L MPG IK+LNVSNAAA+ALY TQ    K
Sbjct: 242 VLGAEGKGLRQKTRETVSALARLDMPGEIKSLNVSNAAAIALYATQQFLGK 292


>gi|187776558|ref|ZP_02993031.1| hypothetical protein CLOSPO_00070 [Clostridium sporogenes ATCC
           15579]
 gi|187775217|gb|EDU39019.1| hypothetical protein CLOSPO_00070 [Clostridium sporogenes ATCC
           15579]
          Length = 257

 Score =  146 bits (368), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 53/254 (20%), Positives = 101/254 (39%), Gaps = 8/254 (3%)

Query: 37  NQKSRHTSQPENLFLYGVHTVSAALNNPS--RKIFQLLATKNALARLDWDANLPHPFPVK 94
             +     +     + G + V  AL +     K+           ++           + 
Sbjct: 2   KNRVGQQEEIREDIIEGRNAVIEALKSNKTIEKVMVAKGDLEGSIKIIISLAKEKGIVIN 61

Query: 95  TVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRN------SQLLMVLDHVNDPHNIG 148
            V  + +D I    A    +A  T        D +R          +++LD + DPHN G
Sbjct: 62  EVDRKKLDSISQTRAHQGVIAFTTPYQYCAVEDIIRYAKQKEEEPFIVILDEIEDPHNFG 121

Query: 149 AILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQ 208
           +ILR+A      G+I  KR +   +  + K+++GA+E++   +++N+ + + K+   G  
Sbjct: 122 SILRTAEVCGVHGVIIPKRRNVGVTPTVYKTSAGAVEYMKISKVTNINNVIDKLKEKGIW 181

Query: 209 TIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNA 268
             G              +  IAL++G+EG+G+   T+     +  + M G I +LN S A
Sbjct: 182 IYGADMCGNDYCFDVSLSGPIALVIGSEGRGISKLTKSKCDVLVKIPMLGNITSLNASVA 241

Query: 269 AAVALYITQNHFAK 282
             + +Y       K
Sbjct: 242 GGMLMYEILKQRMK 255


>gi|153938342|ref|YP_001392853.1| RNA methyltransferase [Clostridium botulinum F str. Langeland]
 gi|152934238|gb|ABS39736.1| RNA methyltransferase, TrmH family, group 3 [Clostridium botulinum
           F str. Langeland]
 gi|295320831|gb|ADG01209.1| RNA methyltransferase, TrmH family, group 3 [Clostridium botulinum
           F str. 230613]
          Length = 257

 Score =  146 bits (368), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 53/254 (20%), Positives = 101/254 (39%), Gaps = 8/254 (3%)

Query: 37  NQKSRHTSQPENLFLYGVHTVSAALNNPS--RKIFQLLATKNALARLDWDANLPHPFPVK 94
             +     +     + G + V  AL +     K+           ++           + 
Sbjct: 2   KNRVGQQEEIREDIIEGRNAVIEALKSNKTIEKVMVAKGDLEGSIKIIISLAKEKGIVIN 61

Query: 95  TVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRN------SQLLMVLDHVNDPHNIG 148
            V  + +D I    A    +A  T        D +R          +++LD + DPHN G
Sbjct: 62  EVDRKKLDSISQTRAHQGVIAFTTPYQYCAVEDIIRYAKQKEEDPFIIILDEIEDPHNFG 121

Query: 149 AILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQ 208
           +ILR+A      G+I  KR +   +  + K+++GA+E++   +++N+ + + K+   G  
Sbjct: 122 SILRTAEVCGAHGVIIPKRRNVGVTPTVYKTSAGAVEYMKISKVTNINNVIDKLKEKGIW 181

Query: 209 TIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNA 268
             G              +  IAL++G+EG+G+   T+     +  + M G I +LN S A
Sbjct: 182 IYGADMCGNDYCFDVNLSGPIALVIGSEGRGISKLTKSKCDVLVKIPMLGNITSLNASVA 241

Query: 269 AAVALYITQNHFAK 282
             + +Y       K
Sbjct: 242 GGMLMYEILKQRMK 255


>gi|148381440|ref|YP_001255981.1| RNA methyltransferase, TrmH family, group 3 [Clostridium botulinum
           A str. ATCC 3502]
 gi|153932755|ref|YP_001385815.1| RNA methyltransferase [Clostridium botulinum A str. ATCC 19397]
 gi|153937009|ref|YP_001389222.1| RNA methyltransferase [Clostridium botulinum A str. Hall]
 gi|168178813|ref|ZP_02613477.1| RNA methyltransferase, TrmH family, group 3 [Clostridium botulinum
           NCTC 2916]
 gi|170759212|ref|YP_001788840.1| RNA methyltransferase [Clostridium botulinum A3 str. Loch Maree]
 gi|226950952|ref|YP_002806043.1| RNA methyltransferase, TrmH family, group 3 [Clostridium botulinum
           A2 str. Kyoto]
 gi|148290924|emb|CAL85060.1| putative tRNA/rRNA methyltransferase [Clostridium botulinum A str.
           ATCC 3502]
 gi|152928799|gb|ABS34299.1| RNA methyltransferase, TrmH family, group 3 [Clostridium botulinum
           A str. ATCC 19397]
 gi|152932923|gb|ABS38422.1| RNA methyltransferase, TrmH family, group 3 [Clostridium botulinum
           A str. Hall]
 gi|169406201|gb|ACA54612.1| RNA methyltransferase, TrmH family, group 3 [Clostridium botulinum
           A3 str. Loch Maree]
 gi|182670049|gb|EDT82025.1| RNA methyltransferase, TrmH family, group 3 [Clostridium botulinum
           NCTC 2916]
 gi|226841703|gb|ACO84369.1| RNA methyltransferase, TrmH family, group 3 [Clostridium botulinum
           A2 str. Kyoto]
          Length = 257

 Score =  146 bits (367), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 53/254 (20%), Positives = 101/254 (39%), Gaps = 8/254 (3%)

Query: 37  NQKSRHTSQPENLFLYGVHTVSAALNNPS--RKIFQLLATKNALARLDWDANLPHPFPVK 94
             +     +     + G + V  AL +     K+           ++           + 
Sbjct: 2   KNRVGQQEEIREDIIEGRNAVIEALKSNKTIEKVMVAKGDLEGSIKIIISLAKEKGIVIN 61

Query: 95  TVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRN------SQLLMVLDHVNDPHNIG 148
            V  + +D I    A    +A  T        D +R          +++LD + DPHN G
Sbjct: 62  EVDRKKLDSISQTRAHQGVIAFTTPYQYCAVEDIIRYAKQKEEDPFIIILDEIEDPHNFG 121

Query: 149 AILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQ 208
           +ILR+A      G+I  KR +   +  + K+++GA+E++   +++N+ + + K+   G  
Sbjct: 122 SILRTAEVCGAHGVIIPKRRNVGVTPTVYKTSAGAVEYMKISKVTNINNVIDKLKEKGIW 181

Query: 209 TIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNA 268
             G              +  IAL++G+EG+G+   T+     +  + M G I +LN S A
Sbjct: 182 IYGADMCGNDYCFDVNLSGPIALVIGSEGRGISKLTKNKCDVLVKIPMLGNITSLNASVA 241

Query: 269 AAVALYITQNHFAK 282
             + +Y       K
Sbjct: 242 GGMLMYEILKQRMK 255


>gi|125974550|ref|YP_001038460.1| RNA methyltransferase [Clostridium thermocellum ATCC 27405]
 gi|256004091|ref|ZP_05429076.1| RNA methyltransferase, TrmH family, group 3 [Clostridium
           thermocellum DSM 2360]
 gi|281419074|ref|ZP_06250091.1| RNA methyltransferase, TrmH family, group 3 [Clostridium
           thermocellum JW20]
 gi|125714775|gb|ABN53267.1| RNA methyltransferase, TrmH family, group 3 [Clostridium
           thermocellum ATCC 27405]
 gi|255992014|gb|EEU02111.1| RNA methyltransferase, TrmH family, group 3 [Clostridium
           thermocellum DSM 2360]
 gi|281407223|gb|EFB37484.1| RNA methyltransferase, TrmH family, group 3 [Clostridium
           thermocellum JW20]
 gi|316941668|gb|ADU75702.1| RNA methyltransferase, TrmH family, group 3 [Clostridium
           thermocellum DSM 1313]
          Length = 277

 Score =  146 bits (367), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 60/272 (22%), Positives = 120/272 (44%), Gaps = 15/272 (5%)

Query: 24  RRNHRDYKKMQSFNQKSRHTSQPE-----NLFLYGVHTVSAALNNPS--RKIFQLLATKN 76
           +++++  K  Q  + K     +          + G ++V  A+       KI      K 
Sbjct: 6   KKDYKKAKTSQRSDVKLNGRKEERDGAKDLDRIEGRNSVLEAIKAGRTINKILVPKGEKE 65

Query: 77  ALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAV------- 129
              R            V+      +DKI    A HQG+    A      +D +       
Sbjct: 66  GSIRQIIALARERGIVVQETDRSNLDKISTTHA-HQGVIAYVAFKDYVEVDDILKIAQDK 124

Query: 130 RNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPY 189
                +++LD + D +N+G+ILR+A A    G++  KR +   +A ++K+++GA+E++P 
Sbjct: 125 GEDPYIIILDGITDAYNLGSILRTADAVGAHGVVIPKRRAIGLNAAVSKASAGAIEYVPV 184

Query: 190 IRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETAT 249
            R++N++  ++ +       +G     +KP  +      +AL++G+EG+G+     E   
Sbjct: 185 ARVTNISQTIEYLKKKNIWIVGTDLSGEKPFFEADLKGPVALVIGSEGEGMGRLVSEKCD 244

Query: 250 SMAHLHMPGIIKALNVSNAAAVALYITQNHFA 281
            + ++ M G I +LN + AAA+ +Y  +    
Sbjct: 245 FIVNIPMQGKISSLNAAVAAAIIMYEIRRQRN 276


>gi|322807825|emb|CBZ05400.1| trmh family tRNA/rRNAmethyltransferase YacO [Clostridium botulinum
           H04402 065]
          Length = 257

 Score =  146 bits (367), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 53/254 (20%), Positives = 100/254 (39%), Gaps = 8/254 (3%)

Query: 37  NQKSRHTSQPENLFLYGVHTVSAALNNPS--RKIFQLLATKNALARLDWDANLPHPFPVK 94
             +     +     + G + V  AL +     K+           ++           + 
Sbjct: 2   KNRVGQQEEIREDIIEGRNAVIEALKSNKTIEKVMVAKGDLEGSIKIIISLAKEKGIVIN 61

Query: 95  TVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRN------SQLLMVLDHVNDPHNIG 148
            V  + +D I    A    +A  T        D +R          +++LD + DPHN G
Sbjct: 62  EVDRKKLDSISQTRAHQGVIAFTTPYQYCAVEDIIRYAKQKEEDPFIIILDEIEDPHNFG 121

Query: 149 AILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQ 208
           +ILR+A      G+I  KR +   +  + K+++GA E++   +++N+ + + K+   G  
Sbjct: 122 SILRTAEVCGAHGVIIPKRRNVGVTPTVYKTSAGAAEYMKISKVTNINNVIDKLKEKGIW 181

Query: 209 TIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNA 268
             G              +  IAL++G+EG+G+   T+     +  + M G I +LN S A
Sbjct: 182 IYGADMCGNDYCFDVNLSGPIALVIGSEGRGISKLTKNKCDVLVKIPMLGNITSLNASVA 241

Query: 269 AAVALYITQNHFAK 282
             + +Y       K
Sbjct: 242 GGMLMYEILKQRMK 255


>gi|182416811|ref|ZP_02948201.1| RNA methyltransferase, TrmH family [Clostridium butyricum 5521]
 gi|237668961|ref|ZP_04528945.1| tRNA/rRNA methyltransferase [Clostridium butyricum E4 str. BoNT E
           BL5262]
 gi|182379273|gb|EDT76772.1| RNA methyltransferase, TrmH family [Clostridium butyricum 5521]
 gi|237657309|gb|EEP54865.1| tRNA/rRNA methyltransferase [Clostridium butyricum E4 str. BoNT E
           BL5262]
          Length = 261

 Score =  146 bits (367), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 55/258 (21%), Positives = 108/258 (41%), Gaps = 8/258 (3%)

Query: 24  RRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDW 83
            +++  +K+ +   ++ ++ ++     + G   V  A       I  L+ T +   ++D 
Sbjct: 6   SKDNNLFKETKKLKER-KNRTKSNKYIIEGFRLVQEAFKAGLN-IECLIVTCDGKDKIDS 63

Query: 84  DAN--LPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDHV 141
                +     +  +      +I+  E     +A+      +  L+        ++ D V
Sbjct: 64  YLREYINKDIKIYEMVNSLFKEIISTEKPQGIVAIVHMNEKTLDLNGS----FYLLCDKV 119

Query: 142 NDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQK 201
            DP N+G I+R+A A   DGII TK      +    +S  G+L ++P          ++ 
Sbjct: 120 QDPGNLGTIIRTAHAVKADGIILTKGTVDIYNEKTIRSTMGSLFYVPVHYDDENMTLVKS 179

Query: 202 MHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIK 261
           +    F+ +  S D+ K   QE    K+ L +G EG G+  +  E A +   + MPG  +
Sbjct: 180 LKDKKFKIVVTSLDTDKDFFQESLKGKVLLTVGNEGNGVSDEVYELADTKVKIPMPGNAE 239

Query: 262 ALNVSNAAAVALYITQNH 279
           +LNV+ A +V +Y     
Sbjct: 240 SLNVAIATSVIMYEKIRQ 257


>gi|220910387|ref|YP_002485698.1| tRNA/rRNA methyltransferase SpoU [Cyanothece sp. PCC 7425]
 gi|219866998|gb|ACL47337.1| tRNA/rRNA methyltransferase (SpoU) [Cyanothece sp. PCC 7425]
          Length = 260

 Score =  146 bits (367), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 50/256 (19%), Positives = 96/256 (37%), Gaps = 6/256 (2%)

Query: 26  NHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNP-SRKIFQLLATKNALARLDWD 84
            +   K+M+  +Q  ++    +   L G H +  A+      ++        A    DW 
Sbjct: 6   QNPLIKQMRKLHQ-GKYRRAQQQFLLEGTHLLLEAVETGYPLEVICFTPQWQAKQAPDWL 64

Query: 85  ANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDHVNDP 144
           A L     ++ V  Q +  I        G+         P L+      L + ++ + DP
Sbjct: 65  AQLEQLTRLEVVSEQVLAAIAT-TVNPDGVVALAPFQPRPPLEIH---HLGLAVETLQDP 120

Query: 145 HNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHS 204
            N+G ++R+A A   +G++ +      E+  + ++ +G    +P     +    LQ    
Sbjct: 121 GNLGTMIRTAAAAGAEGVLLSSDSVELENPKVLRATAGQWFRLPLSVAEDFQAELQHYRQ 180

Query: 205 WGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALN 264
            G Q +     ++              +LG EG GL       A     + +   +++LN
Sbjct: 181 QGIQVVATLPQAQSNYWDVDLTCPTLFLLGNEGAGLSASVVALADRQVKIPLQPGVESLN 240

Query: 265 VSNAAAVALYITQNHF 280
           V+ AAA+ LY  Q   
Sbjct: 241 VAIAAALLLYEAQRQR 256


>gi|298208325|ref|YP_003716504.1| putative rRNA methylase [Croceibacter atlanticus HTCC2559]
 gi|83848246|gb|EAP86116.1| putative rRNA methylase [Croceibacter atlanticus HTCC2559]
          Length = 264

 Score =  146 bits (367), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 41/256 (16%), Positives = 94/256 (36%), Gaps = 2/256 (0%)

Query: 26  NHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDA 85
           ++   KK+    +KSR+  +     + G+  +  AL      I ++      ++    + 
Sbjct: 9   SNPTLKKLLQLQEKSRNRRKEGLFVVEGLRELRLALKGGYN-ISEVFFCPELVSEDTLNN 67

Query: 86  NLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDHVNDPH 145
            +  P     +  +   K+  + +    + +               + L+++ +    P 
Sbjct: 68  LIKAPISYTELSLEVYQKVAYRGSTEGVITIVKTKAHQLVDIKTSETPLILIAEAPEKPG 127

Query: 146 NIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSW 205
           NIGA+LR+A A + D +I                +S        + +   T+ +  +   
Sbjct: 128 NIGALLRTADAANVDAVII-ANPKTDLYNPNIIRSSVGCVFTNQVAVGTTTEIISFLKKQ 186

Query: 206 GFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNV 265
                  +  + +    +      A+++G E  GL  + ++ AT    + M G I ++NV
Sbjct: 187 KVNIYCAALQASEHYHLQDFTTATAIVVGTEATGLSDEWRKNATQNIIIPMQGEIDSMNV 246

Query: 266 SNAAAVALYITQNHFA 281
           S AA + +Y  +    
Sbjct: 247 SVAAGILIYEAKRQRK 262


>gi|168181845|ref|ZP_02616509.1| RNA methyltransferase, TrmH family, group 3 [Clostridium botulinum
           Bf]
 gi|237796961|ref|YP_002864513.1| TrmH family RNA methyltransferase [Clostridium botulinum Ba4 str.
           657]
 gi|182674742|gb|EDT86703.1| RNA methyltransferase, TrmH family, group 3 [Clostridium botulinum
           Bf]
 gi|229262334|gb|ACQ53367.1| RNA methyltransferase, TrmH family, group 3 [Clostridium botulinum
           Ba4 str. 657]
          Length = 257

 Score =  146 bits (367), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 53/254 (20%), Positives = 100/254 (39%), Gaps = 8/254 (3%)

Query: 37  NQKSRHTSQPENLFLYGVHTVSAALNNPS--RKIFQLLATKNALARLDWDANLPHPFPVK 94
             +     +     + G + V  AL +     K+           ++           + 
Sbjct: 2   KNRVGQQEEIREDIIEGRNAVIEALKSNKTIEKVMIAKGDLEGSIKIIISLAKEKGIVIN 61

Query: 95  TVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRN------SQLLMVLDHVNDPHNIG 148
            V  + +D I    A    +A  T        D +R          +++LD + DPHN G
Sbjct: 62  EVDRKKLDSISQTRAHQGVIAFTTPYQYCAVEDIIRYAKQKEEDPFIIILDEIEDPHNFG 121

Query: 149 AILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQ 208
           +ILR+A      G+I  KR +   +  + K+++GA E++   +++N+ + + K+   G  
Sbjct: 122 SILRTAEVCGAHGVIIPKRRNVGVTPTVYKTSAGAAEYMKISKVTNINNVIDKLKEKGIW 181

Query: 209 TIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNA 268
             G              +  IAL++G+EG+G+   T+     +  + M G I +LN S A
Sbjct: 182 IYGADMCGNDYCFDVNLSGPIALVIGSEGRGISKLTKNKCDVLVKIPMLGNITSLNASVA 241

Query: 269 AAVALYITQNHFAK 282
             + +Y       K
Sbjct: 242 GGMLMYEILKQRMK 255


>gi|56750360|ref|YP_171061.1| tRNA/rRNA methyltransferase [Synechococcus elongatus PCC 6301]
 gi|56685319|dbj|BAD78541.1| probable tRNA/rRNA methyltransferase [Synechococcus elongatus PCC
           6301]
          Length = 258

 Score =  145 bits (366), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 51/257 (19%), Positives = 97/257 (37%), Gaps = 4/257 (1%)

Query: 24  RRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDW 83
            R +   K+++  +Q ++   Q     L G H +  A+      +               
Sbjct: 4   SRQNPLTKQIRQLHQ-AKGRRQMGAFLLEGTHLLQEAIATNWPLLQVCATPAWQNQHPQL 62

Query: 84  DANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDHVND 143
                   P +TV    +  +         +A+              ++ LL+ ++ + D
Sbjct: 63  WQQAIQAAPEQTVSDDLLAYLCTTVNPDGVVAIAARQPQRQP---PTSASLLIAVETLQD 119

Query: 144 PHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMH 203
           P N+G I+R+A A   DG+  T      +   + ++++G    +P    ++L   L+   
Sbjct: 120 PGNLGTIIRTAAAAGADGLWLTADGVDPDHPKVLRASAGQWFRLPIAIATDLGQTLRSWQ 179

Query: 204 SWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKAL 263
             G+Q +     +   L Q        L+LG EG GL P     A S   +     +++L
Sbjct: 180 QQGYQIVSTLPRATTTLWQADLTRPTVLLLGNEGAGLSPDLAAIADSAVTIPQAAGVESL 239

Query: 264 NVSNAAAVALYITQNHF 280
           NV+ AAA+ LY  +   
Sbjct: 240 NVAIAAALLLYEARRQR 256


>gi|284048831|ref|YP_003399170.1| tRNA/rRNA methyltransferase (SpoU) [Acidaminococcus fermentans DSM
           20731]
 gi|283953052|gb|ADB47855.1| tRNA/rRNA methyltransferase (SpoU) [Acidaminococcus fermentans DSM
           20731]
          Length = 260

 Score =  145 bits (366), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 53/255 (20%), Positives = 99/255 (38%), Gaps = 5/255 (1%)

Query: 27  HRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDAN 86
           +   K+  S   K ++  +     L G   V  AL +    I  L  T   L        
Sbjct: 10  NDLVKRAASLKMK-KYRQKEGLFLLEGKRAVEEALASGWT-IRALFFT--RLPEGWEQQA 65

Query: 87  LPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDHVNDPHN 146
                P   VP   + KI   E      AL                 +++VLD + DP N
Sbjct: 66  ENSSLPWYEVPLPVLQKITATEDPQSVAAL-VELRREELAAFAPERGMVLVLDRIRDPGN 124

Query: 147 IGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWG 206
           +G ++R+A A    G++  +  +   +  + +S  G+L H+P        +  +     G
Sbjct: 125 LGTLIRTADALGAAGVVLLENTADLYNPKVVRSTMGSLFHLPVFTGVKTGELEEWCRQHG 184

Query: 207 FQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVS 266
           +     + +  + + +    +K AL+LG+E +G+ P+    A     + M G  ++LNV+
Sbjct: 185 YALWATALEGAEDMTRLTWPEKTALVLGSEAEGVSPEILAAADQKVKIPMAGHAESLNVA 244

Query: 267 NAAAVALYITQNHFA 281
            A  + ++     F+
Sbjct: 245 VAGGIVMFEAARAFS 259


>gi|255527269|ref|ZP_05394150.1| RNA methyltransferase, TrmH family, group 3 [Clostridium
           carboxidivorans P7]
 gi|296187248|ref|ZP_06855644.1| RNA methyltransferase, TrmH family, group 3 [Clostridium
           carboxidivorans P7]
 gi|255509054|gb|EET85413.1| RNA methyltransferase, TrmH family, group 3 [Clostridium
           carboxidivorans P7]
 gi|296048119|gb|EFG87557.1| RNA methyltransferase, TrmH family, group 3 [Clostridium
           carboxidivorans P7]
          Length = 276

 Score =  145 bits (366), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 60/279 (21%), Positives = 119/279 (42%), Gaps = 18/279 (6%)

Query: 13  FSLKDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLL 72
            + KD+   ++ +++           ++          + G + V   L +       L+
Sbjct: 6   KNFKDNSNRRIEKDNNF--------SRNTSEKSFREDLIEGRNAVIEVLKSERTVEQILV 57

Query: 73  ATKNALARLDWDANLPH--PFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVR 130
           A  +    ++    L       +K V  + +D++  +   HQG+  +  P     +D + 
Sbjct: 58  ANGDVSGSINLILALAKEKKVVIKQVDRKKLDQLS-QTGAHQGVIAQITPYKYCDVDDII 116

Query: 131 NS-------QLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGA 183
           +          +++LD + DPHN G+I+R+A      GII  KR +   +  + K++ GA
Sbjct: 117 SYAEEKGEKPFIVILDEIEDPHNFGSIIRTAETCGVHGIIIPKRRNVGLTPAVYKASVGA 176

Query: 184 LEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPK 243
           +EH+   +I+N+ +A+ K+   G    G   + +           +ALI+G+EGKG+   
Sbjct: 177 IEHMKIAKITNINNAIDKLKEQGIWVYGADMNGENYCYDVDFRGAVALIIGSEGKGILKL 236

Query: 244 TQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHFAK 282
           T+     +  + M G I +LN S A  + +Y       K
Sbjct: 237 TKNKCDVLVKIPMVGNISSLNASVAGGILMYEILKQRFK 275


>gi|226311224|ref|YP_002771118.1| RNA methyltransferase [Brevibacillus brevis NBRC 100599]
 gi|226094172|dbj|BAH42614.1| putative RNA methyltransferase [Brevibacillus brevis NBRC 100599]
          Length = 271

 Score =  145 bits (366), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 55/279 (19%), Positives = 107/279 (38%), Gaps = 18/279 (6%)

Query: 9   SEKIFSLKDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKI 68
           +E I S++          +   K++     + +   + +   + G H V  AL + +  +
Sbjct: 3   NEIITSVQ----------NPLVKRLHQLLSR-KGREEQQRFLVEGAHLVEEALKSGAEVV 51

Query: 69  FQLLATKNALARL--DWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTL 126
             +   +  +        AN P    V   P   + K+   ++    +A           
Sbjct: 52  TVIYDQQRDMDPACQRALANHPEAVQVIAAPETVLAKLSETKSPQGIVAEVKKTAADWAK 111

Query: 127 DAVRNSQ-----LLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSAS 181
              +  +     LL+ LD + DP N+G ILR+A A + DG++         +  + ++  
Sbjct: 112 WVDQKREEQGSLLLLFLDEIQDPGNLGTILRTAEAAAIDGVVLGSGSVDIYNGKVVRATM 171

Query: 182 GALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLR 241
           GAL  IP    S +  A +     G   I     +    ++       AL++G EG+G+ 
Sbjct: 172 GALFRIPVFTQSLVDTADEWKAKGGRVLISSLEQNSVSYDEADYAGLTALVIGNEGRGVS 231

Query: 242 PKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
            +    A    H+ + G  ++LN + AA + +Y  Q   
Sbjct: 232 KEMFAKADQFVHIPLYGGAESLNAAVAAGIFVYEAQRKR 270


>gi|113476712|ref|YP_722773.1| tRNA/rRNA methyltransferase SpoU [Trichodesmium erythraeum IMS101]
 gi|110167760|gb|ABG52300.1| tRNA/rRNA methyltransferase (SpoU) [Trichodesmium erythraeum
           IMS101]
          Length = 261

 Score =  145 bits (365), Expect = 8e-33,   Method: Composition-based stats.
 Identities = 47/256 (18%), Positives = 104/256 (40%), Gaps = 6/256 (2%)

Query: 26  NHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNA-LARLDWD 84
            +   K+++  +Q S+   + +   + G H +  A       I      +     +  ++
Sbjct: 6   QNSLVKQIRQLHQ-SKGRQEQQLFLVEGTHLLEEACKRNYPLITVCHTFEWQEKHKFLYE 64

Query: 85  ANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDHVNDP 144
                   ++ V  + I  +    +         A       + ++ + L +VLD + DP
Sbjct: 65  LVSQKAQRIELVSTKIIQSLATTVSP----DGVVAIAPQSQTNFLKITTLGIVLDKIQDP 120

Query: 145 HNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHS 204
            N+G I+R+AVA + DG+  ++         + ++++G   ++      NL + + K+ S
Sbjct: 121 GNLGTIIRTAVATNIDGLFVSRDSVDLSHPKVVRASAGEWFNLHKAISENLKNEILKLQS 180

Query: 205 WGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALN 264
            G Q +    +S     +        ++LG EG G+     + A     + +   +++LN
Sbjct: 181 QGLQVLATVPNSNINYWEIDLRKPTIIVLGNEGSGISKDLIDLADYSVKIPLSNGVESLN 240

Query: 265 VSNAAAVALYITQNHF 280
           V+ +AA+ LY  Q   
Sbjct: 241 VAVSAAIILYEIQRQR 256


>gi|255659335|ref|ZP_05404744.1| RNA methyltransferase, TrmH family, group 3 [Mitsuokella multacida
           DSM 20544]
 gi|260848417|gb|EEX68424.1| RNA methyltransferase, TrmH family, group 3 [Mitsuokella multacida
           DSM 20544]
          Length = 289

 Score =  145 bits (365), Expect = 8e-33,   Method: Composition-based stats.
 Identities = 72/289 (24%), Positives = 131/289 (45%), Gaps = 14/289 (4%)

Query: 1   MNLISKKKSEKIFSLKDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAA 60
           M     K+  +    +   + K    H+  +      ++      P+++ + G + V+ A
Sbjct: 1   MEQ---KRKTRPQERRSRKFEKEAPRHKRPQSETEPKRREEPRELPDDVLV-GRNAVTEA 56

Query: 61  LNNPS--RKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALET 118
           L +     K++     +                 V+ V    I+ + G    HQG+    
Sbjct: 57  LKSGRGINKLWIASGDREGSVAEIAALAKERGIVVQYVERAKIEALAGGHR-HQGVLAYV 115

Query: 119 APLLSPTLDAV-------RNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPS 171
           AP+    L+ +         +  L++LD + DPHN+GA+LR+A A    GI+  KR S S
Sbjct: 116 APVPYAELEDILKAAEAKGEAPFLVLLDELEDPHNLGALLRTADATGVHGILIPKRRSVS 175

Query: 172 ESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIAL 231
            +A +AK+++GA+E++P  RI N+   L+K+   GF   G   D +K   +      + L
Sbjct: 176 LNATVAKTSAGAVEYVPVARIGNIAQTLKKLKEKGFWVAGADMDGEKAYYEADLTGPLVL 235

Query: 232 ILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
           ++G+EGKG+   T+E    +  + M G I +LN S A ++ +Y +    
Sbjct: 236 VVGSEGKGMSRLTKEACDFIVRMPMVGRINSLNASVAGSILMYESMRQR 284


>gi|225572770|ref|ZP_03781525.1| hypothetical protein RUMHYD_00961 [Blautia hydrogenotrophica DSM
           10507]
 gi|225039827|gb|EEG50073.1| hypothetical protein RUMHYD_00961 [Blautia hydrogenotrophica DSM
           10507]
          Length = 260

 Score =  145 bits (365), Expect = 8e-33,   Method: Composition-based stats.
 Identities = 55/257 (21%), Positives = 102/257 (39%), Gaps = 4/257 (1%)

Query: 26  NHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDA 85
           ++   K +    QK++           G+     A ++   K++      + L       
Sbjct: 6   SNGQIKNIIQLQQKTKARRDRGLFVAEGLKMFQEAPDSWIEKVYIA----DRLYEEQEIQ 61

Query: 86  NLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDHVNDPH 145
                 PV+ V  +   +I   +     L L   P         + + LLMVL+ + DP 
Sbjct: 62  KRLGSLPVEIVDDRIFRQISDTKTPQGILCLLRCPHYRLEKILEKENPLLMVLEDLQDPG 121

Query: 146 NIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSW 205
           N+G I+R+A     DGI+ +K      +  + +S  G++  +P++ I N+ +AL+ +   
Sbjct: 122 NVGTIIRTAEGAGADGILLSKNTVDIFNPKVIRSTMGSIYRMPFVYIENMEEALRLLKKK 181

Query: 206 GFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNV 265
              T       K   + E      A  +G EG GL  +  E A     + M G +++LN 
Sbjct: 182 KVSTYAAHLQGKNTYDGESYLRGTAFFVGNEGNGLSRQLSEKADCWIRIPMEGQVESLNA 241

Query: 266 SNAAAVALYITQNHFAK 282
           + AA + +Y       +
Sbjct: 242 AMAAGILMYEAGRQRRR 258


>gi|163868081|ref|YP_001609285.1| tRNA/rRNA metyltransferase [Bartonella tribocorum CIP 105476]
 gi|161017732|emb|CAK01290.1| tRNA/rRNA metyltransferase [Bartonella tribocorum CIP 105476]
          Length = 276

 Score =  144 bits (364), Expect = 9e-33,   Method: Composition-based stats.
 Identities = 136/274 (49%), Positives = 182/274 (66%), Gaps = 5/274 (1%)

Query: 11  KIFSLKDSHYAKLRRNHRDYKKMQSFNQKSRHTS----QPENLFLYGVHTVSAALNNPSR 66
           K  + ++SHYA+LRR +RD K   S + K+        Q   + LYG+H+V AAL NP R
Sbjct: 2   KEKTSQNSHYARLRRRYRDTKASSSRSSKNMKKKTASLQQGIIHLYGIHSVQAALKNPKR 61

Query: 67  KIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTL 126
               L  T+NAL RL+   +  +P PV    P+ +D +VG EAVHQG+ LET+PL    L
Sbjct: 62  IFKCLYVTQNALKRLNMSES-DYPCPVTLCTPKYLDSLVGSEAVHQGIVLETSPLKPCKL 120

Query: 127 DAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEH 186
             + N+ L++V+D + DPHN+GAI+RSAVAF    +ITT R+SP ES VLAK+ASGALE 
Sbjct: 121 SELTNTDLVIVMDQITDPHNVGAIMRSAVAFKAKALITTCRHSPHESGVLAKAASGALEM 180

Query: 187 IPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQE 246
           I YI + NL + LQ++H  GF + GL S+  +PLE  +   KIAL+LGAEGKGLR KT+E
Sbjct: 181 IHYITVRNLAETLQEIHQTGFTSFGLDSEGDQPLETTLTGSKIALVLGAEGKGLRKKTRE 240

Query: 247 TATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
           T  ++A L MPG IK+LNVSNAA +ALY+   + 
Sbjct: 241 TVCALARLDMPGNIKSLNVSNAATIALYVAHKYL 274


>gi|126662021|ref|ZP_01733020.1| putative rRNA methylase [Flavobacteria bacterium BAL38]
 gi|126625400|gb|EAZ96089.1| putative rRNA methylase [Flavobacteria bacterium BAL38]
          Length = 264

 Score =  144 bits (364), Expect = 9e-33,   Method: Composition-based stats.
 Identities = 45/280 (16%), Positives = 95/280 (33%), Gaps = 19/280 (6%)

Query: 1   MNLISKKKSEKIFSLKDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAA 60
           M  I+  +                  +   K +    +K++   Q     + G   +  A
Sbjct: 1   MKQITSVQ------------------NPFIKSLVQLQEKAKVRKQTSTFIIEGKREIELA 42

Query: 61  LNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAP 120
           L         L   +        +    +   +  +  +   K+  ++     LA+    
Sbjct: 43  LKGDYELETILFLPEIISELELKNLIKSNGVDIIEISKEVYKKLAYRDTTEGILAIAKTK 102

Query: 121 LLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSA 180
            L+ +   +  + L+++ + +  P N+GAILR+A A + D +I                +
Sbjct: 103 SLALSELKLSKNPLILIGESLEKPGNVGAILRTADAANIDAVII-ANPKSDLYNPNIVRS 161

Query: 181 SGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGL 240
           S        I +    + +  + +        +         +      AL++G E  GL
Sbjct: 162 SVGCLFTRQIAVGTTEEVIAYLKANNISIYSATLQDSTEYHTQNYTTPTALVVGTEATGL 221

Query: 241 RPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
             K +  +T    + M G I ++NVS AAA+ L+  +   
Sbjct: 222 SEKWRIESTKNIIIPMQGEIDSMNVSVAAAILLFEAKRQR 261


>gi|166368966|ref|YP_001661239.1| tRNA/rRNA methyltransferase [Microcystis aeruginosa NIES-843]
 gi|166091339|dbj|BAG06047.1| probable tRNA/rRNA methyltransferase [Microcystis aeruginosa
           NIES-843]
          Length = 268

 Score =  144 bits (364), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 56/258 (21%), Positives = 107/258 (41%), Gaps = 6/258 (2%)

Query: 26  NHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDA 85
            +   K+++  + ++R   +     + G H +  AL      +  +  T+    R    A
Sbjct: 6   QNPLIKQIRKLH-RTRERQEQNLSLIEGTHLLETALALNC-SLETVCYTEKWQQRQAELA 63

Query: 86  NLPHP--FPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDHVND 143
                    V+ V P+ +  +         +A      L P        QL +VL+ + D
Sbjct: 64  EKFQNQAKRVEIVSPEVLASLATTVNPDGVIATIARDHLHPV--PQNPLQLGLVLERLQD 121

Query: 144 PHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMH 203
           P N+G I+R+AVA    GI  +      ++  + +S++G     P +  S+L+  ++K  
Sbjct: 122 PGNLGTIIRTAVATEVQGIWLSLDSVEIDNPKVIRSSAGEWFRSPLVVESDLSALVKKYQ 181

Query: 204 SWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKAL 263
           + G + I     + K   +        ++LG EG GL P+    A     + + G +++L
Sbjct: 182 AQGVKAIATLPTATKSHWEIDFTRPTLILLGNEGAGLSPQLAALADETVKIPLFGGVESL 241

Query: 264 NVSNAAAVALYITQNHFA 281
           NV+ A AV LY  +   +
Sbjct: 242 NVAIATAVILYEARRQLS 259


>gi|153009269|ref|YP_001370484.1| RNA methyltransferase [Ochrobactrum anthropi ATCC 49188]
 gi|151561157|gb|ABS14655.1| RNA methyltransferase, TrmH family, group 3 [Ochrobactrum anthropi
           ATCC 49188]
          Length = 286

 Score =  144 bits (364), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 140/288 (48%), Positives = 189/288 (65%), Gaps = 13/288 (4%)

Query: 1   MNLISKKKSEKIFSLKDSHYAKLRRNHRDYKKMQSFNQKSRHTS--------QPENLFLY 52
           M   +  ++ K     DSHYA+LRR HRD K +       +               + LY
Sbjct: 1   MTDQNSPRTPK-----DSHYARLRRQHRDQKAVTEGKSPRKPQRPSISAGAVTEGTVRLY 55

Query: 53  GVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQ 112
           G+HTV AA+ NP RKI ++ AT+N  ARL+       PFPV+ V P+ IDK  G EAVHQ
Sbjct: 56  GLHTVRAAVENPERKILRMRATRNGFARLEIGEAESLPFPVEIVDPRDIDKETGSEAVHQ 115

Query: 113 GLALETAPLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSE 172
           G+ +E  PL +  L  +++S LL+VLD V DPHN+GAI+RSAVAF    +ITT R+SP E
Sbjct: 116 GVMIEAEPLRARKLSELKDSPLLLVLDQVTDPHNVGAIMRSAVAFGAGALITTSRHSPQE 175

Query: 173 SAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALI 232
           + VLAK+ASGALE I +I + NL +A++++HS GFQTIGL S+  + +E  +   +IAL+
Sbjct: 176 TGVLAKAASGALEMISHIEVRNLAEAIEELHSLGFQTIGLDSEGPQEMEATLSGGRIALV 235

Query: 233 LGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
           LGAEGKGLR KT+ET T++A L MPG IK+LNVSNAAA++LY  + + 
Sbjct: 236 LGAEGKGLRQKTRETVTALARLDMPGEIKSLNVSNAAAISLYAAERYL 283


>gi|229823223|ref|ZP_04449292.1| hypothetical protein GCWU000282_00521 [Catonella morbi ATCC 51271]
 gi|229787389|gb|EEP23503.1| hypothetical protein GCWU000282_00521 [Catonella morbi ATCC 51271]
          Length = 255

 Score =  144 bits (363), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 63/278 (22%), Positives = 119/278 (42%), Gaps = 25/278 (8%)

Query: 1   MNLISKKKSEKIFSLKDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAA 60
           M +I  K++ KI + K    A                   +   +     + G H V  A
Sbjct: 1   MEVIQSKQNPKIKAWKKLATA-------------------KGRQKAGQYLIEGTHLVEEA 41

Query: 61  LNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAP 120
           L +  + +  L+AT +    L    +     P+  V P+ +  +           +    
Sbjct: 42  LKSG-QPVRHLVATLD--YDLSQLPDQALSLPLLLVSPELLKDLSETPTPQ--GIMAIID 96

Query: 121 LLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSA 180
           L S  LD   + Q  ++LD V DP N+G ++R+A A + DG+I  K      +  + +++
Sbjct: 97  LPSSPLDWQPSGQRYLILDAVQDPGNLGTLIRTADAAAYDGVILGKGTVDVYNDKVLRAS 156

Query: 181 SGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSK-KPLEQEIKNDKIALILGAEGKG 239
            G+L H+  + +  L +A     + G   +  +   + K  ++   N K+AL+LG EG+G
Sbjct: 157 QGSLWHLEVVSLDLLQEARPAFEAAGIPWLVTALHQEAKAYQEVPANQKLALVLGNEGQG 216

Query: 240 LRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQ 277
           +     + A    ++ MPG  ++LNV+ A  + ++  Q
Sbjct: 217 VSEAVIQVADQTIYIPMPGQAESLNVAVAGGILMFYFQ 254


>gi|253681905|ref|ZP_04862702.1| RNA methyltransferase, TrmH family, group 3 [Clostridium botulinum
           D str. 1873]
 gi|253561617|gb|EES91069.1| RNA methyltransferase, TrmH family, group 3 [Clostridium botulinum
           D str. 1873]
          Length = 263

 Score =  144 bits (363), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 54/244 (22%), Positives = 107/244 (43%), Gaps = 10/244 (4%)

Query: 45  QPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPH--PFPVKTVPPQTID 102
           +     + G + V  AL +     + ++A  +    ++    +       +K V  + +D
Sbjct: 18  EEREDLIEGRNAVIEALKSDRTVEYVMIAKGSVTGSINKVVAIAKDKGIVIKEVDRKKLD 77

Query: 103 KIVGKEAVHQGLALETAPLLSPTLDAVRNS-------QLLMVLDHVNDPHNIGAILRSAV 155
            +      HQG+     P     ++ +            +++LD + DPHN+G+I+R+A 
Sbjct: 78  SMS-ITGSHQGVIAIVTPYQYCEVEDILKCAEEKGEDPFILILDEIEDPHNLGSIMRTAE 136

Query: 156 AFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSD 215
                GII  KR +   +  + K+++GA E++   +++NL  A+  +   G    G    
Sbjct: 137 ICGVHGIIIPKRRNVGITPTVYKTSAGAAEYMKVAKVANLNRAIDNIKEKGIWVYGADMS 196

Query: 216 SKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYI 275
            +    Q      +AL++G+EG+G+   T+E    +  + M G I +LN S AA + +Y 
Sbjct: 197 GESYCFQTNFKGAVALVIGSEGRGVSKLTKEKCDVLVKIPMVGNITSLNASVAAGIMMYE 256

Query: 276 TQNH 279
               
Sbjct: 257 VLKQ 260


>gi|15672589|ref|NP_266763.1| tRNA/rRNA methyltransferase [Lactococcus lactis subsp. lactis
           Il1403]
 gi|12723502|gb|AAK04705.1|AE006293_11 tRNA/rRNA methyltransferase [Lactococcus lactis subsp. lactis
           Il1403]
 gi|326406108|gb|ADZ63179.1| 23S rRNA methyltransferase [Lactococcus lactis subsp. lactis CV56]
          Length = 252

 Score =  144 bits (362), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 61/277 (22%), Positives = 111/277 (40%), Gaps = 30/277 (10%)

Query: 1   MNLISKKKSEKIFSLKDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAA 60
           M +IS K ++KI   +     K R+N                     +  + G H +  A
Sbjct: 1   MEIISSKDNKKIKEARKLLTKKYRKN---------------------SYLIEGFHLLEEA 39

Query: 61  LNNPSRKIFQLLATKNALARLDWDA---NLPHPFPVKTVPPQTIDKIVGKEAVHQGLALE 117
           L    R I Q+   +N L +L        L     V  V  + +  +   E+    +A  
Sbjct: 40  LKAG-RSIKQIFVEENKLTKLTEMIGSEKLLTDLSVNLVSKEVLKSLADSESPQGLIAEV 98

Query: 118 TAPLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLA 177
           T         A +     ++L++V DP N+G ++R+A A     +I     +   S  + 
Sbjct: 99  TKIEEVIDFSAAK----FLLLENVQDPGNVGTMIRTADAAGFSAVILLGETADIYSPKVM 154

Query: 178 KSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEG 237
           +S  G+  H+P +R++      Q   +         S +    +   +    ALI+G EG
Sbjct: 155 RSMQGSNFHLPLVRMAKEDCFAQLKKAGISILTTTLSANSVSYKIINEPH-FALIMGNEG 213

Query: 238 KGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
            G+  +  + A  + H+ MPG  ++LNV+ AA + ++
Sbjct: 214 AGVSDEAVKAADKLVHIDMPGQAESLNVAVAAGILMF 250


>gi|281491073|ref|YP_003353053.1| 23S rRNA methyltransferase [Lactococcus lactis subsp. lactis KF147]
 gi|281374831|gb|ADA64351.1| 23S rRNA methyltransferase [Lactococcus lactis subsp. lactis KF147]
          Length = 252

 Score =  144 bits (362), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 60/277 (21%), Positives = 110/277 (39%), Gaps = 30/277 (10%)

Query: 1   MNLISKKKSEKIFSLKDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAA 60
           M +IS K ++KI   +     K R+N                     +  + G H +  A
Sbjct: 1   MEIISSKDNKKIKEARKLLTKKYRKN---------------------SYLIEGFHLLEEA 39

Query: 61  LNNPSRKIFQLLATKNALARLDWDANLPH---PFPVKTVPPQTIDKIVGKEAVHQGLALE 117
           L    R I Q+   +N L +L              V  V  + +  +   E+    +A  
Sbjct: 40  LKAG-RSIKQIFVEENKLTKLTEMIGAEKSLTDLSVNLVSKEVLKSLADSESPQGLIAEV 98

Query: 118 TAPLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLA 177
           T         A +     ++L++V DP N+G ++R+A A     +I     +   S  + 
Sbjct: 99  TKIEEVIDFSAAK----FLLLENVQDPGNVGTMIRTADAAGFSAVILLGETADIYSPKVM 154

Query: 178 KSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEG 237
           +S  G+  H+P +R++      Q   +         S +    +   +    ALI+G EG
Sbjct: 155 RSMQGSNFHLPLVRMAKEDCFAQLKKAGISILTTTLSANSVSYKIINEPH-FALIMGNEG 213

Query: 238 KGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
            G+  +  + A  + H+ MPG  ++LNV+ AA + ++
Sbjct: 214 AGVSDEAVKAADKLVHIDMPGQAESLNVAVAAGILMF 250


>gi|253580955|ref|ZP_04858217.1| conserved hypothetical protein [Ruminococcus sp. 5_1_39B_FAA]
 gi|251847797|gb|EES75765.1| conserved hypothetical protein [Ruminococcus sp. 5_1_39BFAA]
          Length = 257

 Score =  144 bits (362), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 49/255 (19%), Positives = 100/255 (39%), Gaps = 4/255 (1%)

Query: 26  NHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDA 85
           N+   K +   NQK++   +       G      A   P   I ++     AL+      
Sbjct: 6   NNGQVKNIIQLNQKTKARREQGLFVAEGRKMFGEA---PRDWISKVYV-SEALSGDAELM 61

Query: 86  NLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDHVNDPH 145
                 P + V      ++   +     + +   P           + L+M+L+ + DP 
Sbjct: 62  AQVEKLPYEIVTDSVFRQMSDTQTPQGIMTVLKKPSYIMEDILGGENPLVMILEDLQDPG 121

Query: 146 NIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSW 205
           N G ILR+       G++ TK      +  + +S  G++  +P++ + ++    Q++   
Sbjct: 122 NAGTILRTGEGAGVSGVLLTKTCVDITNPKVIRSTMGSVYRMPFLYVESVVSLAQELKDR 181

Query: 206 GFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNV 265
             +T       K   +QE      A ++G EGKGL  +  ++A  +  + M G +++LN 
Sbjct: 182 NIRTFAAHLHGKNSYDQESYTGGTAFLIGNEGKGLTDEAADSADCLIRIPMCGKVESLNA 241

Query: 266 SNAAAVALYITQNHF 280
           + A+ + +Y      
Sbjct: 242 AMASGILMYEAARQR 256


>gi|118443866|ref|YP_877180.1| RNA methyltransferase [Clostridium novyi NT]
 gi|118134322|gb|ABK61366.1| RNA methyltransferase, TrmH family, group 3 [Clostridium novyi NT]
          Length = 265

 Score =  144 bits (362), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 57/248 (22%), Positives = 110/248 (44%), Gaps = 10/248 (4%)

Query: 41  RHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDA--NLPHPFPVKTVPP 98
           R   +     + G + V  AL +     + ++A  N    ++            +K V  
Sbjct: 16  REEKEEREDLIEGRNAVIEALRSDRTIEYVMVAKGNVSGSINKVLGIAKDKGIIIKEVDR 75

Query: 99  QTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNS-------QLLMVLDHVNDPHNIGAIL 151
           + +D +      HQG+     P     ++ + N          ++VLD + DPHN+G+I+
Sbjct: 76  KKLDSMS-ITGAHQGVMAIVTPFKYSQIEDIFNYAKEKGEEPFILVLDEIEDPHNLGSIM 134

Query: 152 RSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIG 211
           R+A      GI+  KR +   +  + K+++GA E++   +++N+  A+ ++   G    G
Sbjct: 135 RTAEICGVHGIVIPKRRNVGVTPTVYKTSAGAAEYVKVAKVANINRAIDEIKERGIWVYG 194

Query: 212 LSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAV 271
              D +    Q      +AL++G+EGKG+   T++    +  + M G I +LN S AA +
Sbjct: 195 ADMDGENYCFQTNFKGAVALVIGSEGKGISKLTKQKCDVLIKIPMVGKITSLNASVAAGI 254

Query: 272 ALYITQNH 279
            +Y     
Sbjct: 255 MMYEVLKQ 262


>gi|284053061|ref|ZP_06383271.1| tRNA/rRNA methyltransferase (SpoU) [Arthrospira platensis str.
           Paraca]
 gi|291572137|dbj|BAI94409.1| probable tRNA/rRNA methyltransferase [Arthrospira platensis
           NIES-39]
          Length = 259

 Score =  144 bits (362), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 52/258 (20%), Positives = 97/258 (37%), Gaps = 6/258 (2%)

Query: 24  RRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLA-TKNALARLD 82
              +   K+++  +  ++   +     L G H V AA       +            R  
Sbjct: 4   SPQNPLVKQIRQLHT-AKGRREEGLFILEGTHLVEAACAVNWDIMAVCCTPQWEERHRDL 62

Query: 83  WDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDHVN 142
           W+  +      + V  + I  +              A         V  + L +VL+ V 
Sbjct: 63  WELAVKRADRTEQVSDRLIAAMT----TTVNPDGVVAIARRRDQTPVPITSLGLVLETVQ 118

Query: 143 DPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKM 202
           DP N+G ++R+A A   +G+  +          + ++++GA   +P    S+L   L  +
Sbjct: 119 DPGNLGTMIRTATAAGVEGLWLSSDSVDPTHPKVLRASAGAWFEVPIAVHSDLITQLSDI 178

Query: 203 HSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKA 262
              G Q +   +D+     +       A++LG EG GL P     A     + + G +++
Sbjct: 179 QKQGIQIVATRADASLSYWEIDLRPPTAIVLGNEGSGLSPDLTSLADYHIRVPLLGNVES 238

Query: 263 LNVSNAAAVALYITQNHF 280
           LNV+  AA+ LY  Q   
Sbjct: 239 LNVAICAALILYEAQRQR 256


>gi|294056009|ref|YP_003549667.1| tRNA/rRNA methyltransferase (SpoU) [Coraliomargarita akajimensis
           DSM 45221]
 gi|293615342|gb|ADE55497.1| tRNA/rRNA methyltransferase (SpoU) [Coraliomargarita akajimensis
           DSM 45221]
          Length = 269

 Score =  143 bits (361), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 50/262 (19%), Positives = 89/262 (33%), Gaps = 8/262 (3%)

Query: 24  RRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKN-----AL 78
            + +   K +    ++ +H  + E   + G+  +  A+ +    I  +          A 
Sbjct: 8   SKQNEQVKNLVKLRER-KHRDRQERFLVEGLRELEHAIGSGFE-IETIYFCPELFPSAAH 65

Query: 79  ARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVL 138
                        P+  +  +   K   +E     + +      S     +    LL+VL
Sbjct: 66  QATIDQLRRDGEVPLTRMSEEAFSKAAYREGPDGIVGIGKQQAHSLHELHLPKQPLLLVL 125

Query: 139 DHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDA 198
           + +  P N+GAILRSA     D II             A  +S  L     I  ++    
Sbjct: 126 EGIEKPGNLGAILRSADGAGADAIIL-TDCILDLYNPNAIRSSQGLIFALPIVNADREAL 184

Query: 199 LQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPG 258
              +    +QT+  +  + +   +       AL  G+E  GL             + M G
Sbjct: 185 ADWLQKGRYQTVAATPHTDQSHWEIDYTKPTALFFGSESDGLSDYWMNHLDQRICIPMKG 244

Query: 259 IIKALNVSNAAAVALYITQNHF 280
              +LNV+ AAAV LY  +   
Sbjct: 245 RADSLNVAAAAAVCLYEARRQR 266


>gi|158319524|ref|YP_001512031.1| RNA methyltransferase [Alkaliphilus oremlandii OhILAs]
 gi|158139723|gb|ABW18035.1| RNA methyltransferase, TrmH family, group 3 [Alkaliphilus
           oremlandii OhILAs]
          Length = 250

 Score =  143 bits (361), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 64/240 (26%), Positives = 111/240 (46%), Gaps = 10/240 (4%)

Query: 51  LYGVHTVSAALNNPSRKIFQLLATKNALARLDWDA--NLPHPFPVKTVPPQTIDKIVGKE 108
           + G + V  AL +       L+A       L            P++ V  Q ++++   +
Sbjct: 6   IAGRNPVMEALKSGREIDKILIAKGTEGGSLIKIIGKAKDRGIPIQYVERQKLNEMSSSD 65

Query: 109 AVHQGLALETAPLLSPTLDAV-------RNSQLLMVLDHVNDPHNIGAILRSAVAFSCDG 161
            VHQG+    A      ++ +            L++LD + DPHN+G+++R+A A   DG
Sbjct: 66  -VHQGIIATVAAYEYCEVEDILENAKSKGRDPFLLILDEIMDPHNLGSMMRTADAVGVDG 124

Query: 162 IITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLE 221
           II  KR S   ++ +AKS++GA+E++P  ++SN+   + K+   G    G      K   
Sbjct: 125 IIIPKRRSVGLTSTVAKSSAGAIEYVPVAKVSNIAQTIDKIKDMGIWVAGADMSGSKEHY 184

Query: 222 QEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHFA 281
                  +AL++G EG+G+    +E    +  L M G + +LN S AAAV +Y      +
Sbjct: 185 NMDLKGPLALVIGNEGEGISRLIKEKCDFLIKLPMVGQVSSLNASVAAAVLMYEVFRQRS 244


>gi|307150993|ref|YP_003886377.1| tRNA/rRNA methyltransferase SpoU [Cyanothece sp. PCC 7822]
 gi|306981221|gb|ADN13102.1| tRNA/rRNA methyltransferase (SpoU) [Cyanothece sp. PCC 7822]
          Length = 264

 Score =  143 bits (361), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 48/258 (18%), Positives = 101/258 (39%), Gaps = 6/258 (2%)

Query: 26  NHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARL--DW 83
            +   K+M+  + +++   +     + G H +  A       +  +  T +   R    W
Sbjct: 6   QNPLVKQMRKLH-RAKGRREQNLFLIEGTHLLETACKV-KSSLMVVCCTPDWQNRYPQLW 63

Query: 84  DANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDHVND 143
           +         + V P+ +  +         +A          L  +    L +VL+ + D
Sbjct: 64  ELASQKAQRAEIVTPEILAAMTTTVNPDGVVASAARISNPTEL--ISPLSLGLVLEQLQD 121

Query: 144 PHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMH 203
           P N+G I+R+AVA   +G+  +      ++  + ++++G    +P     NL   ++   
Sbjct: 122 PGNLGTIIRTAVATEVEGLWLSDDSVDVDNPKVLRASAGEWFRVPMRVSQNLPQVIEDYK 181

Query: 204 SWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKAL 263
           S   Q I       K   +        +++G EG GL  +    A    ++ + G +++L
Sbjct: 182 SQNVQVIATLPQGTKTYWEIDFTRPTLILMGNEGAGLSDELISLADIGVNIPLGGGVESL 241

Query: 264 NVSNAAAVALYITQNHFA 281
           NV+ A A+ LY  +   A
Sbjct: 242 NVAIATALLLYEAKRQRA 259


>gi|323704472|ref|ZP_08116050.1| RNA methyltransferase, TrmH family, group 3 [Thermoanaerobacterium
           xylanolyticum LX-11]
 gi|323535934|gb|EGB25707.1| RNA methyltransferase, TrmH family, group 3 [Thermoanaerobacterium
           xylanolyticum LX-11]
          Length = 256

 Score =  143 bits (361), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 56/257 (21%), Positives = 106/257 (41%), Gaps = 8/257 (3%)

Query: 24  RRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDW 83
              +   K ++    K ++  +    F+ G ++V  AL +    +  LL  ++       
Sbjct: 5   SEKNEFIKDVKKLADK-KYRYEKRLFFVEGKNSVFEALKSGFEIVH-LLVAEDFNIDFQI 62

Query: 84  DANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDHVND 143
           +        +  V  +   KI    A    +A+          D V+     ++LD V D
Sbjct: 63  EKE-----KIVFVDEKVFKKISDTVAPQMIMAV-VKMPKWEVNDIVKEGGFYVILDEVQD 116

Query: 144 PHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMH 203
           P N+G I+RSA AF+ DG+          +  + +S  G++ H+P +     +     + 
Sbjct: 117 PGNVGTIIRSADAFNVDGVFAINNTVDIYNPKVLRSTMGSIFHLPVVNDVEPSRLFHVLK 176

Query: 204 SWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKAL 263
             G + +  S  ++K +     +   ALI G E +G+     E   S   + M G+ ++L
Sbjct: 177 KHGIRILSTSLKAEKYIYDFDISKNAALIFGNESRGVNRLLDEFIDSSFKIPMDGMAESL 236

Query: 264 NVSNAAAVALYITQNHF 280
           NVS AA++ LY ++   
Sbjct: 237 NVSVAASICLYESERQR 253


>gi|86133430|ref|ZP_01052012.1| SpoU rRNA methylase family protein [Polaribacter sp. MED152]
 gi|85820293|gb|EAQ41440.1| SpoU rRNA methylase family protein [Polaribacter sp. MED152]
          Length = 264

 Score =  143 bits (361), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 45/281 (16%), Positives = 100/281 (35%), Gaps = 21/281 (7%)

Query: 1   MNLISKKKSEKIFSLKDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAA 60
           M  I+  ++  I                  K +    +KSR   +     + G+  ++ A
Sbjct: 1   MKQITSSQNTYI------------------KGLLKLQEKSRERKKLGLFIIEGLREINLA 42

Query: 61  LNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLAL-ETA 119
           L         +L   + + +   D  +     V  +  +  +K+  + +    +A+    
Sbjct: 43  LKANYT-FRTVLFCIDLIQKTAVDTLIDSSTEVIEISKEVYEKLAYRNSTEGIIAVANAK 101

Query: 120 PLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKS 179
                 +     + L+++ + +  P N+GA+LR+A A + D +I                
Sbjct: 102 SFSLGEISFSNKNPLILIAESLEKPGNVGALLRTADAANVDAVII-ANPKSDLYNSNIIR 160

Query: 180 ASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKG 239
           +S        I +    + +  +          +  +      E      A+++G E  G
Sbjct: 161 SSVGCVFTNQIAVGTSEEIITFLKENKISIYAATLQNSNKYHLEDYKKPSAIVVGTEATG 220

Query: 240 LRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
           L    ++ AT   ++ M G I ++NVS AAA+ ++  +   
Sbjct: 221 LSEIWRDKATQNINIPMQGKIDSMNVSVAAAIVIFEAKRQR 261


>gi|319783294|ref|YP_004142770.1| RNA methyltransferase, TrmH family, group 3 [Mesorhizobium ciceri
           biovar biserrulae WSM1271]
 gi|317169182|gb|ADV12720.1| RNA methyltransferase, TrmH family, group 3 [Mesorhizobium ciceri
           biovar biserrulae WSM1271]
          Length = 282

 Score =  143 bits (360), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 143/275 (52%), Positives = 191/275 (69%), Gaps = 6/275 (2%)

Query: 9   SEKIFSLKDSHYAKLRRNHRDYKKMQSFNQKSRHT------SQPENLFLYGVHTVSAALN 62
           S+K  + KD+HYAKLRR +RD K   +   + R        +    + LYG+HTV AAL+
Sbjct: 2   SDKTNTPKDTHYAKLRRAYRDEKSGGAPAFRPRQPVPPGENAADGLVRLYGLHTVRAALD 61

Query: 63  NPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLL 122
           NP RKI ++L T+NA  RL+       PF  + V P+ IDKI G +AVHQG+ +E  PL 
Sbjct: 62  NPRRKIRKMLVTRNAAERLEIADLAALPFKTELVEPRDIDKITGSDAVHQGVLIEAEPLK 121

Query: 123 SPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASG 182
           +  LDA+ +++L++VLD + DPHN+GAILRSAVAF    +ITT R+SP ES VLAKSASG
Sbjct: 122 AKRLDALGDAKLVLVLDQITDPHNVGAILRSAVAFGAGALITTARHSPQESGVLAKSASG 181

Query: 183 ALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRP 242
           ALEHI  I + NL +AL ++H  GF+T+GL SD+   LE+    +KIAL+LGAEGKGLR 
Sbjct: 182 ALEHIDQIEVKNLAEALGQLHEAGFRTMGLDSDAPAELEKSFAGEKIALVLGAEGKGLRQ 241

Query: 243 KTQETATSMAHLHMPGIIKALNVSNAAAVALYITQ 277
           KT+ET T++A L MPG I +LNVSNAAA++LY+ +
Sbjct: 242 KTRETVTTLARLDMPGAIHSLNVSNAAAISLYVAR 276


>gi|331268394|ref|YP_004394886.1| TrmH family RNA methyltransferase [Clostridium botulinum BKT015925]
 gi|329124944|gb|AEB74889.1| RNA methyltransferase, TrmH family, group 3 [Clostridium botulinum
           BKT015925]
          Length = 263

 Score =  143 bits (360), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 53/244 (21%), Positives = 107/244 (43%), Gaps = 10/244 (4%)

Query: 45  QPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPH--PFPVKTVPPQTID 102
           +     + G + V  AL +     + ++A  +    ++    +       +K V  + +D
Sbjct: 18  EEREDLIEGRNAVIEALKSDRTVEYVMIAKGSVTGSINKVVAIAKDKGIVIKEVDRKKLD 77

Query: 103 KIVGKEAVHQGLALETAPLLSPTLDAVRNS-------QLLMVLDHVNDPHNIGAILRSAV 155
            +      HQG+     P     ++ +            +++LD + DPHN+G+I+R+A 
Sbjct: 78  SMS-ITGSHQGVMAIVTPYQYCEVEDILKCAEEKGEDPFILILDEIEDPHNLGSIMRTAE 136

Query: 156 AFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSD 215
                GII  KR +   +  + K+++GA E++   +++NL  ++  +   G    G    
Sbjct: 137 ICGVHGIIIPKRRNVGITPTVYKTSAGATEYMKVAKVANLNRSIDDIKEKGIWVYGADMA 196

Query: 216 SKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYI 275
            +    Q      +AL++G+EG+G+   T+E    +  + M G I +LN S AA + +Y 
Sbjct: 197 GESYCFQTNFKGAVALVIGSEGRGISKLTKEKCDVLVKVPMVGNITSLNASVAAGIMMYE 256

Query: 276 TQNH 279
               
Sbjct: 257 VLKQ 260


>gi|251779338|ref|ZP_04822258.1| RNA methyltransferase, TrmH family, group 3 [Clostridium botulinum
           E1 str. 'BoNT E Beluga']
 gi|243083653|gb|EES49543.1| RNA methyltransferase, TrmH family, group 3 [Clostridium botulinum
           E1 str. 'BoNT E Beluga']
          Length = 290

 Score =  143 bits (360), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 73/291 (25%), Positives = 128/291 (43%), Gaps = 17/291 (5%)

Query: 7   KKSEKIFSLKDSHYAKLRRNHRDYKKM---QSFNQKSRHTS--QPENLFLYGVHTVSAAL 61
           +++ K  + ++S+  K R N+R  KK        + + + +  +     + G + V  AL
Sbjct: 2   RENTKAGNKRESNREKNRENNRGNKKEINKNRVVENNSYDNSFEEREDIIIGRNAVLEAL 61

Query: 62  NNPSRKIFQLLATKNAL---ARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALET 118
               R I  L  + + L                 +K V  + +D +    AVHQG+    
Sbjct: 62  KT-ERTIETLYISNSKLEGSINAIISKAKDKKILIKEVDKRKLDSMC-NNAVHQGVIARV 119

Query: 119 APLLSPTL-------DAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPS 171
            P     +       +    +  +++LD V DPHN+G+I+R+A  F   GII  KR S S
Sbjct: 120 TPYEYSEVSDILELAEKKGENPFIVILDEVEDPHNLGSIIRTAELFGVHGIIIPKRRSAS 179

Query: 172 ESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIAL 231
            + ++ KS+ GA+EH+   R++NL   + ++   G    G    +++   Q       A+
Sbjct: 180 VTTMVYKSSVGAIEHVKVARVTNLNSVIDELKEKGIWVYGTDIRAEEYSYQTDFGGPCAI 239

Query: 232 ILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHFAK 282
           I+G EGKG+   T +    +  + M G I +LN S A  + +Y       K
Sbjct: 240 IIGNEGKGISKLTLKKCDKLIKIPMVGKINSLNASVAGGIIMYEVLKGRLK 290


>gi|159030692|emb|CAO88365.1| unnamed protein product [Microcystis aeruginosa PCC 7806]
          Length = 264

 Score =  143 bits (360), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 53/258 (20%), Positives = 105/258 (40%), Gaps = 6/258 (2%)

Query: 26  NHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDA 85
            +   K+++  + ++R   +     + G H +  AL         +  T+    R    A
Sbjct: 6   QNPLIKQIRKLH-RTRERQEQNLSLIEGTHLLETALAVNCSP-ETVCYTEKWRQRQGQLA 63

Query: 86  NLPHP--FPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDHVND 143
                    V+ V P+ +  +        G+    +      +       L +VL+ + D
Sbjct: 64  EKLQNQAKRVEIVSPEVLASLAT-TVNPDGVIATISRTHLHPIPQNPLQ-LGLVLERLQD 121

Query: 144 PHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMH 203
           P N+G I+R+AVA    GI  +      ++  + +S++G     P +  S+L+  ++K  
Sbjct: 122 PGNLGTIIRTAVATEVQGIWLSLDSVEIDNPKVIRSSAGEWFRSPLVVESDLSALVKKYQ 181

Query: 204 SWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKAL 263
           + G + I     + K   +        ++LG EG GL P+    A     + + G +++L
Sbjct: 182 AQGVKAIATLPTATKNHWEIDFTRPTLILLGNEGAGLSPQLATLADETVKIPLFGGVESL 241

Query: 264 NVSNAAAVALYITQNHFA 281
           NV+ A AV LY  +   +
Sbjct: 242 NVAIATAVILYEARRQLS 259


>gi|304317237|ref|YP_003852382.1| tRNA/rRNA methyltransferase (SpoU) [Thermoanaerobacterium
           thermosaccharolyticum DSM 571]
 gi|302778739|gb|ADL69298.1| tRNA/rRNA methyltransferase (SpoU) [Thermoanaerobacterium
           thermosaccharolyticum DSM 571]
          Length = 256

 Score =  143 bits (360), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 55/257 (21%), Positives = 106/257 (41%), Gaps = 8/257 (3%)

Query: 24  RRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDW 83
              +   K ++  ++K ++  + +  F+ G ++V  AL +     + L+   +    +D 
Sbjct: 5   SEKNDLIKDIKKLSEK-KYRYEKKLFFVEGKNSVFEALKSSFEIKYVLV---SEDCDIDL 60

Query: 84  DANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDHVND 143
           D           V      KI       Q +            D ++   L ++LD V D
Sbjct: 61  DVEKDRLI---FVDKGIFKKISD-TVTPQMIMAVVKMPDYNVNDLIKEDGLYIILDEVQD 116

Query: 144 PHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMH 203
           P N+G I+RSA AF+ D + T        +    +S  G++ H+P +    +    + + 
Sbjct: 117 PGNLGTIIRSADAFNVDAVFTINNTVDVYNPKALRSTMGSIFHLPVVNDVPVDKLFEALK 176

Query: 204 SWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKAL 263
             G + +  +  ++K +     +  IALI G E +G+             + M G+ ++L
Sbjct: 177 RNGVRVLSTNLKAEKYIYDCDISKNIALIFGNESRGVNKSLDIYVDGSFKIPMDGMAESL 236

Query: 264 NVSNAAAVALYITQNHF 280
           NVS AA++ LY +Q   
Sbjct: 237 NVSVAASICLYESQRQR 253


>gi|150025910|ref|YP_001296736.1| tRNA/rRNA methyltransferase [Flavobacterium psychrophilum JIP02/86]
 gi|149772451|emb|CAL43933.1| Probable tRNA/rRNA methyltransferase [Flavobacterium psychrophilum
           JIP02/86]
          Length = 262

 Score =  143 bits (360), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 45/280 (16%), Positives = 95/280 (33%), Gaps = 20/280 (7%)

Query: 1   MNLISKKKSEKIFSLKDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAA 60
           M  I+  ++  I S                  +    +KS+   +     + G   +  A
Sbjct: 1   MKQITSSQNPYIKS------------------LVLLQEKSKARKKSGTFLIEGQREIELA 42

Query: 61  LNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAP 120
                  I  +L   + +++            +  +  +   K+  ++     LA+    
Sbjct: 43  -QKGGFVIETILFLPDLISQKQITQITNQAHDIIEISKEVYQKLAYRDTTEGILAVAKTK 101

Query: 121 LLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSA 180
               +   +  + L+++ +    P NIGA+LR+A A + D +I                +
Sbjct: 102 PFLLSDLKLSQTPLILIAEAPEKPGNIGALLRTADAANLDAVI-IANPKSDLYNPNIVRS 160

Query: 181 SGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGL 240
           S        I      + +  +          +  +  P   +      AL++G E  GL
Sbjct: 161 SVGCLFTTQIATGTTQEIITYLKENKINFYCATLQNATPYHTQDYTPPTALVVGTEATGL 220

Query: 241 RPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
             + +  AT    + M G I ++NVS AAA+ ++  +   
Sbjct: 221 TQEWRNNATQNIIIPMQGEIDSMNVSVAAAILIFEAKRQR 260


>gi|147676634|ref|YP_001210849.1| rRNA methylases [Pelotomaculum thermopropionicum SI]
 gi|146272731|dbj|BAF58480.1| rRNA methylases [Pelotomaculum thermopropionicum SI]
          Length = 261

 Score =  143 bits (359), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 80/257 (31%), Positives = 124/257 (48%), Gaps = 12/257 (4%)

Query: 35  SFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALA---RLDWDANLPHPF 91
           + N K +  ++ E   + G + V  AL    R I +LL  + AL    R  +D       
Sbjct: 5   NLNLKKKGRNRLE-DIIAGRNPVREALRAN-RPINKLLIAEGALTGSLREIYDLARERKI 62

Query: 92  PVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDA------VRNSQLLMVLDHVNDPH 145
           PV+ V  Q + K+V  EA HQG+    A      +D             L++LD V+DPH
Sbjct: 63  PVQRVERQHLSKLV-PEASHQGVVALAAVREYVDVDDILAGVAPGEDPFLILLDEVHDPH 121

Query: 146 NIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSW 205
           N+GAILR+A A    GII  +R S   S  +A+S++GA+E++P  R++N+   ++ +   
Sbjct: 122 NLGAILRTADAAGAHGIIIPRRRSAPLSRTVARSSAGAVEYVPVARVANIARTIELLKGK 181

Query: 206 GFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNV 265
           G    G   D ++       +  +AL++G EGKGL    +E    +  L M G + +LN 
Sbjct: 182 GLWVAGADPDGREVYWDARLDGPVALVIGGEGKGLGRLVKEKCDVLVRLPMSGRVNSLNA 241

Query: 266 SNAAAVALYITQNHFAK 282
           S AAA+  Y       K
Sbjct: 242 SVAAALLSYEVVRQRRK 258


>gi|261880182|ref|ZP_06006609.1| SpoU rRNA methylase [Prevotella bergensis DSM 17361]
 gi|270333154|gb|EFA43940.1| SpoU rRNA methylase [Prevotella bergensis DSM 17361]
          Length = 269

 Score =  143 bits (359), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 51/259 (19%), Positives = 100/259 (38%), Gaps = 5/259 (1%)

Query: 26  NHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDA 85
            +   K + +  QKS    +     + GV  +    +     I  L   ++ L +     
Sbjct: 11  QNAKVKNLVALQQKSSERRKQGLFVVEGVRELIHCAHAGYE-IENLFCCRDILDKNPEAW 69

Query: 86  NLPHPF---PVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDHVN 142
            L        +  V     +K+  + +    +A       +     +  S L++VL+ V 
Sbjct: 70  KLDSLIGQTTIYEVTQAVYEKMAYRGSTEGMMAEVKVKNRTLADLDLPESPLIVVLESVE 129

Query: 143 DPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKM 202
            P N+GA+LRSA A   D +I     +   +  L +S+ GA+  +P +  S+        
Sbjct: 130 KPGNLGAVLRSADASKADAVIVCNPLTDLFNPNLIRSSIGAIFTVPTVACSSQACMNFLK 189

Query: 203 HSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKA 262
                       DS    + ++     A+++G E  GL    ++ A +   + M G + +
Sbjct: 190 ERNIKILTAQLQDSAPYYDSDM-RGGTAIVMGTESTGLTDAWRKAADAHIRIPMLGQLDS 248

Query: 263 LNVSNAAAVALYITQNHFA 281
           LNVS +AA+ ++      +
Sbjct: 249 LNVSVSAAILMFEAVRQRS 267


>gi|303242604|ref|ZP_07329080.1| RNA methyltransferase, TrmH family, group 3 [Acetivibrio
           cellulolyticus CD2]
 gi|302589861|gb|EFL59633.1| RNA methyltransferase, TrmH family, group 3 [Acetivibrio
           cellulolyticus CD2]
          Length = 267

 Score =  143 bits (359), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 62/286 (21%), Positives = 104/286 (36%), Gaps = 24/286 (8%)

Query: 1   MNLISKKKSEKIFSLKDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAA 60
           MN IS  ++  I  +K                        ++  Q    F+ G+  V  A
Sbjct: 1   MNFISSSQNPVIKEIKALKEK-------------------KYRDQTGLFFIEGIRFVEEA 41

Query: 61  LNNPSRKIFQLLATKNALAR----LDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLAL 116
           L         L++ K A       +       +   V T+  + +   V      QG+  
Sbjct: 42  LKEKIEISKILVSDKLADVHGGKEILEQLENSNCCNVYTLTNK-LYMEVTDTENPQGILA 100

Query: 117 ETAPLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVL 176
                         N    +VLD + DP N+G I+R+A A    G+I +K      +  +
Sbjct: 101 ILNKKSISLESVYDNKNFFLVLDSLQDPGNMGTIIRTADAAGVTGVIVSKGCVDVYNPKV 160

Query: 177 AKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAE 236
            +S  G+L HIP     N+   L++M + G +         K   +    D IA+I+G E
Sbjct: 161 LRSTMGSLFHIPICYSENILQTLEEMKNKGIRLCAAHLSGSKNYFELDYKDNIAIIVGNE 220

Query: 237 GKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHFAK 282
             G+       +  +  + M G  ++LN S AA + +Y       K
Sbjct: 221 ANGISDSVAGISNELVRIPMAGKSESLNASVAAGLLMYEVLRLRMK 266


>gi|51894250|ref|YP_076941.1| rRNA methyltransferase [Symbiobacterium thermophilum IAM 14863]
 gi|51857939|dbj|BAD42097.1| rRNA methyltransferase [Symbiobacterium thermophilum IAM 14863]
          Length = 246

 Score =  143 bits (359), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 63/241 (26%), Positives = 114/241 (47%), Gaps = 12/241 (4%)

Query: 51  LYGVHTVSAALNNPSRKIFQLLATKNAL---ARLDWDANLPHPFPVKTVPPQTIDKIVGK 107
           + G + V  AL +  R I ++L  K A     R            V+ V  + +D +  +
Sbjct: 5   IEGRNPVLEALRSG-RTINRILVAKGAREGSIREVIALARSQGVIVQEVARERLDAMA-R 62

Query: 108 EAVHQGLALETAPLLSPTLDAV-------RNSQLLMVLDHVNDPHNIGAILRSAVAFSCD 160
              HQG+    A      LD V           LL+VLD + DP N+G++LR+A A    
Sbjct: 63  GRNHQGVIALAAAHRYYDLDEVLERAAASGEDGLLLVLDGIEDPQNLGSLLRTADAAGVH 122

Query: 161 GIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPL 220
           G+I  +R +   +  +AK ++GA+E++P  R++N+   L+ +   G+  +G   ++ +  
Sbjct: 123 GVIIPERRAVGLTETVAKVSAGAVEYVPVARVTNIARTLEMLKERGYWVVGTHQEADELY 182

Query: 221 EQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
            +      +A+++G+EG+G+     ET      L M G + +LN + A A+ LY  +   
Sbjct: 183 YEARLTGPLAVVIGSEGRGMSRLVAETCDFTVRLPMRGHVTSLNAAVAGAILLYEVRRQR 242

Query: 281 A 281
           +
Sbjct: 243 S 243


>gi|302390940|ref|YP_003826760.1| RNA methyltransferase, TrmH family, group 3 [Acetohalobium
           arabaticum DSM 5501]
 gi|302203017|gb|ADL11695.1| RNA methyltransferase, TrmH family, group 3 [Acetohalobium
           arabaticum DSM 5501]
          Length = 243

 Score =  143 bits (359), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 62/238 (26%), Positives = 110/238 (46%), Gaps = 8/238 (3%)

Query: 51  LYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAV 110
           + G + V  AL +  R    L+                    +K V  + +D +    + 
Sbjct: 4   IEGRNPVMEALKSERRIDEILIYQNAEGVNELLKKAKAEGIKLKRVAKEKLDNLADSYS- 62

Query: 111 HQGLALETAPLLSPTLDA-------VRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGII 163
           HQG+     P+   +LD          +  L ++LD + DPHN G+ILR+A A    G+I
Sbjct: 63  HQGVIAFGEPIKYLSLDQLIDKAYNKTDDPLFILLDEIKDPHNFGSILRTADAVGAQGVI 122

Query: 164 TTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQE 223
             KR S   ++ + K+++GA+EHIP  +++NL  A++++    F   G   +++    Q+
Sbjct: 123 IPKRRSVGLTSAVGKASAGAIEHIPVAQVTNLVRAMEELKENRFWIAGADMEAEGFCYQQ 182

Query: 224 IKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHFA 281
                + +++G+EG G+R   +E    +  L M G I +LN + A AV +Y       
Sbjct: 183 DLTGPLGIVIGSEGAGMRRLVKERCDFLIKLPMKGRINSLNAAVAGAVLMYEALRQRN 240


>gi|188588931|ref|YP_001919654.1| RNA methyltransferase, TrmH family, group 3 [Clostridium botulinum
           E3 str. Alaska E43]
 gi|188499212|gb|ACD52348.1| RNA methyltransferase, TrmH family, group 3 [Clostridium botulinum
           E3 str. Alaska E43]
          Length = 290

 Score =  142 bits (358), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 73/291 (25%), Positives = 128/291 (43%), Gaps = 17/291 (5%)

Query: 7   KKSEKIFSLKDSHYAKLRRNHRDYKKM---QSFNQKSRHTS--QPENLFLYGVHTVSAAL 61
           +++ K  + ++S+  K R N+R  KK        + + + +  +     + G + V  AL
Sbjct: 2   RENTKAGNKRESNREKNRENNRGNKKEINKNRVVENNSYDNSFEEREDIIIGRNAVLEAL 61

Query: 62  NNPSRKIFQLLATKNAL---ARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALET 118
               R I  L  + + L                 +K V  + +D +    AVHQG+    
Sbjct: 62  KT-ERTIETLYISNSKLEGSINAIISKAKDKKILIKEVDKRKLDSMC-NNAVHQGVIARV 119

Query: 119 APLLSPTLDAV-------RNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPS 171
            P     +  +         +  +++LD V DPHN+G+I+R+A  F   GII  KR S S
Sbjct: 120 TPYEYSEVSDILELAKKKGENPFIVILDEVEDPHNLGSIIRTAELFGVHGIIIPKRRSAS 179

Query: 172 ESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIAL 231
            + ++ KS+ GA+EH+   R++NL   + ++   G    G    +++   Q       A+
Sbjct: 180 VTTMVYKSSVGAIEHVKVARVTNLNSVIDELKEKGIWVYGTDIRAEEYSYQTDFGGPCAI 239

Query: 232 ILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHFAK 282
           I+G EGKG+   T +    +  + M G I +LN S A  + +Y       K
Sbjct: 240 IIGNEGKGISKLTLKKCDKLIKIPMVGKINSLNASVAGGIIMYEVLKGRLK 290


>gi|167464658|ref|ZP_02329747.1| tRNA/rRNA methyltransferase (SpoU) [Paenibacillus larvae subsp.
           larvae BRL-230010]
 gi|322381394|ref|ZP_08055393.1| RNA methylase-like protein [Paenibacillus larvae subsp. larvae
           B-3650]
 gi|321154621|gb|EFX46896.1| RNA methylase-like protein [Paenibacillus larvae subsp. larvae
           B-3650]
          Length = 272

 Score =  142 bits (358), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 53/268 (19%), Positives = 100/268 (37%), Gaps = 3/268 (1%)

Query: 15  LKDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLAT 74
           +++  Y      +   K+      + +  ++     + G+H V  AL++ +  +  ++ +
Sbjct: 1   MQNPTYEIRSIRNPKVKEWAGLLDR-KGRNRQGKFLIEGIHLVEEALHSNA-PVQTIVYS 58

Query: 75  KNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQL 134
                  +             V    + K    E      A+      S  L       L
Sbjct: 59  LEKEFPHELYKKFSSHADWIGVSRAVLQKCSDTETPQGIFAVVRKSEQSLELITAEEWDL 118

Query: 135 LMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISN 194
           ++V+D V DP N+G I+RSA A     I+  +      +    +S  G+L H+P I    
Sbjct: 119 VVVVDGVQDPGNLGTIIRSADAVGASAIVLGRGTVDIYNPKAIRSTMGSLFHLPVIEADL 178

Query: 195 LTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHL 254
                + + +     +     ++K   +        +I+G EGKG   +  E AT    +
Sbjct: 179 ADLLPKAVKAGIQV-LCTDLKAEKNCYEIDFTIPTWIIVGNEGKGTSREAGELATQSMII 237

Query: 255 HMPGIIKALNVSNAAAVALYITQNHFAK 282
            M G  ++LNV+ AA V L+       K
Sbjct: 238 PMKGHAESLNVAMAATVLLFEASRQRMK 265


>gi|220928862|ref|YP_002505771.1| RNA methyltransferase, TrmH family, group 3 [Clostridium
           cellulolyticum H10]
 gi|219999190|gb|ACL75791.1| RNA methyltransferase, TrmH family, group 3 [Clostridium
           cellulolyticum H10]
          Length = 269

 Score =  142 bits (358), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 59/282 (20%), Positives = 109/282 (38%), Gaps = 23/282 (8%)

Query: 1   MNLISKKKSEKIFSLKDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAA 60
           MN I   ++  I  +K  H                     ++       F+ G+  VS A
Sbjct: 1   MNYIQSSQNSTIKDIKSLHLK-------------------KNRDAHGLYFVEGIRFVSDA 41

Query: 61  LNNPSRKIFQLLATK-NALARLDWDANLPHPF--PVKTVPPQTIDKIVGKEAVHQGLALE 117
           ++N       +++ K   L                +  VP +   ++   +   QG+   
Sbjct: 42  IDNGQSIAKIIISEKLEGLNGGSELIEKVKGACSDISLVPEKIFREVSDTQ-TPQGILAV 100

Query: 118 TAPLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLA 177
                      +     +++LD + DP N G I+R+A A     ++ +K      S  + 
Sbjct: 101 IKKNKYSFDKVITEGSSVVILDCLQDPGNAGTIIRTADAAGISAVLMSKGCVDLYSPKVL 160

Query: 178 KSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEG 237
           +S  G++ HIP     N+T+ ++ +    ++ I      K    QE    + A+I+G E 
Sbjct: 161 RSTMGSVFHIPIFEGLNITEIIRVLKQNDYKVIASHLSGKNNYFQEDLTGRSAIIVGNEA 220

Query: 238 KGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNH 279
            G+  +T   A S+  + MPG  ++LN S AA+V +Y     
Sbjct: 221 NGISDETAYMADSLVKIPMPGKAESLNASVAASVMIYEIVRQ 262


>gi|253575250|ref|ZP_04852588.1| tRNA/rRNA methyltransferase [Paenibacillus sp. oral taxon 786 str.
           D14]
 gi|251845247|gb|EES73257.1| tRNA/rRNA methyltransferase [Paenibacillus sp. oral taxon 786 str.
           D14]
          Length = 263

 Score =  142 bits (358), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 57/260 (21%), Positives = 102/260 (39%), Gaps = 5/260 (1%)

Query: 23  LRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLD 82
           L   +   K+     +K ++  +     + G+H V  AL + +  +  +         ++
Sbjct: 4   LSAQNPRVKEWAGLLEK-KNRDKQGKYLIEGIHLVQEALQSRAD-VECVCYDLEHGIPVE 61

Query: 83  WDANLPHPFPVKT--VPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDH 140
             A       V    V    I K    ++     A+      +      +   L++VLD 
Sbjct: 62  LQAAASAGLDVDWIGVSAAVIAKCSDTKSPQPVFAVVRKDRGTVAPLLAKERSLVVVLDG 121

Query: 141 VNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQ 200
           V DP N+G I+RSA A + DG+I     +      + ++  G+L H+P +      + L 
Sbjct: 122 VQDPGNVGTIIRSADAVAADGVIVGAGCADIYGPKVLRATMGSLFHLPVVHADLA-EVLP 180

Query: 201 KMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGII 260
           +    G +  G S  +            + L+ G+EG GL P  +E       + M G  
Sbjct: 181 QAKQRGIRLAGTSLQAAANCFAYDFTQPVWLLFGSEGGGLSPAVRELMDDGLLIPMRGQA 240

Query: 261 KALNVSNAAAVALYITQNHF 280
           ++LNV+ AA+V LY      
Sbjct: 241 ESLNVAMAASVLLYEAMRQR 260


>gi|260752268|ref|YP_003225161.1| tRNA/rRNA methyltransferase (SpoU) [Zymomonas mobilis subsp.
           mobilis NCIMB 11163]
 gi|258551631|gb|ACV74577.1| tRNA/rRNA methyltransferase (SpoU) [Zymomonas mobilis subsp.
           mobilis NCIMB 11163]
          Length = 268

 Score =  142 bits (358), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 47/260 (18%), Positives = 93/260 (35%), Gaps = 5/260 (1%)

Query: 26  NHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDA 85
           ++   K+++S   K +H  +       G+  ++ A       ++   A  +A   L    
Sbjct: 9   SNPLIKRVRSLRDK-KHRREEGLFLAEGLRILTEAREAGFIPVYIFFAADSAAHPLVQQL 67

Query: 86  NLP---HPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDHVN 142
                             + K+ GK+     + +  +  L  +    R + + +V   + 
Sbjct: 68  IEAVEDKGGEAIETSRDILHKLSGKDNPQTVIGVFESFTLPLSSIDRRQAPIWLVAQSLR 127

Query: 143 DPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKM 202
           DP N+G +LR+  A    G+I         S    ++  GAL            D L  +
Sbjct: 128 DPGNLGTLLRTGDAVGAGGLILIDDCVDPFSVEAVRATMGALFTQKIATARWE-DFLVWL 186

Query: 203 HSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKA 262
                  IG S  + +  ++        +++G E +GL    ++    +  + M G   +
Sbjct: 187 RQGEGDLIGTSLRATQDYQEPRYQTPSFVLVGNEAQGLPDSYEDACDHLVKIPMMGRADS 246

Query: 263 LNVSNAAAVALYITQNHFAK 282
           LNV+ A A+  Y   N   K
Sbjct: 247 LNVAVAGAIMAYEVLNQQRK 266


>gi|219853507|ref|YP_002470629.1| hypothetical protein CKR_0164 [Clostridium kluyveri NBRC 12016]
 gi|219567231|dbj|BAH05215.1| hypothetical protein [Clostridium kluyveri NBRC 12016]
          Length = 256

 Score =  142 bits (358), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 65/252 (25%), Positives = 114/252 (45%), Gaps = 11/252 (4%)

Query: 41  RHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNAL---ARLDWDANLPHPFPVKTVP 97
           +   Q     + G ++V  ALN+ +  I Q+      +       +         VK V 
Sbjct: 2   KSEPQFREDLIEGRNSVMEALNSNNVTIEQIFVLDGNMSGSINTIFAIAKEKHIVVKKVD 61

Query: 98  PQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNS-------QLLMVLDHVNDPHNIGAI 150
            + +D+I  +  VHQG+  +  P     L+ + +          +++LD + DPHN GAI
Sbjct: 62  KRKLDRIS-QTGVHQGVIAKVIPYKYCELEDILDYASERGESPFIIILDEIQDPHNFGAI 120

Query: 151 LRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTI 210
           +R+A      GII  KR +   +  + KS++GA+E++   +++NL   ++K+        
Sbjct: 121 IRTAEVSGVHGIIIPKRRNVGITPTVYKSSAGAVEYMKICKVTNLNTIIEKLKKENIWIY 180

Query: 211 GLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAA 270
           G     +        N  IALI+G+EGKG+   T++    +  + M G I +LN S AA 
Sbjct: 181 GADMTGENYCFDVDFNSSIALIIGSEGKGISKLTKQKCDKLVKIPMMGNISSLNASVAAG 240

Query: 271 VALYITQNHFAK 282
           + +Y       K
Sbjct: 241 MLMYEILKQKIK 252


>gi|149177691|ref|ZP_01856292.1| YacO [Planctomyces maris DSM 8797]
 gi|148843509|gb|EDL57871.1| YacO [Planctomyces maris DSM 8797]
          Length = 261

 Score =  142 bits (358), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 51/259 (19%), Positives = 109/259 (42%), Gaps = 8/259 (3%)

Query: 30  YKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPH 89
             K     +        +  +++G + V   L      +++L  + +  +          
Sbjct: 2   VGKPSKLKKNKPLLGNHQKCWIWGRNAVRETLFAGFWPMYELHLSDHLKSEEIEQLEQQA 61

Query: 90  P---FPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNS----QLLMVLDHVN 142
                PV     + + +   + + HQG+  + AP    +++          L ++LD + 
Sbjct: 62  ARSTIPVFISTDKELTQKC-RASDHQGMIAKMAPFPYTSIELFNQQEITSPLFLILDRIQ 120

Query: 143 DPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKM 202
           DP N GAI+RSA     DGI +        ++++ ++++GA+ H+P ++ ++L    +  
Sbjct: 121 DPFNFGAIIRSAEIMGADGIFSGTHEQCEVTSLVCRTSAGAVNHVPLVQATDLVSLCRDW 180

Query: 203 HSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKA 262
              G   +G +  + + L         A+I+G EG G+ P+ Q   T +  +   G  ++
Sbjct: 181 KQNGINIVGTAMQASEKLNDYNFQQPTAVIVGNEGTGISPELQAECTHLVRIPQQGKTES 240

Query: 263 LNVSNAAAVALYITQNHFA 281
           LNV+ +A++ LY       
Sbjct: 241 LNVAVSASILLYEASRQRN 259


>gi|110633438|ref|YP_673646.1| tRNA/rRNA methyltransferase (SpoU) [Mesorhizobium sp. BNC1]
 gi|110284422|gb|ABG62481.1| tRNA/rRNA methyltransferase (SpoU) [Chelativorans sp. BNC1]
          Length = 276

 Score =  142 bits (358), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 135/276 (48%), Positives = 190/276 (68%), Gaps = 3/276 (1%)

Query: 7   KKSEKIFSLKDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSR 66
              +K  + KDSHYA+LRR HR   +  + N+++        + LYG+HTV AA++NP+R
Sbjct: 2   SDHKKTGTPKDSHYARLRRAHR---ERTAPNERAGADLPEGIVRLYGLHTVRAAIDNPAR 58

Query: 67  KIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTL 126
            I Q+L T+NA  RL        PFPV+ V P+ ID +VG +AVHQG+ +E         
Sbjct: 59  SIRQMLVTRNAAQRLGIADPSTLPFPVEIVEPKAIDALVGADAVHQGVLVEATARTPKPF 118

Query: 127 DAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEH 186
             + ++ L++VLD V DPHN+GAI+RSAVAF  D ++TT R+SP+ES VLAK+ASGALEH
Sbjct: 119 SGLEDASLVLVLDQVTDPHNVGAIMRSAVAFGADALVTTARHSPAESGVLAKAASGALEH 178

Query: 187 IPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQE 246
           I +I + NL +A++++H+ GF T+GL S+  + LE+ ++  KIAL+LG+EGKGLR KT+E
Sbjct: 179 IDHIEVRNLANAIEELHAAGFLTVGLDSEGPQRLEKTLQGKKIALVLGSEGKGLRQKTRE 238

Query: 247 TATSMAHLHMPGIIKALNVSNAAAVALYITQNHFAK 282
           T  ++A L MPG I +LNVSNAAAVALYI +   A+
Sbjct: 239 TVRALARLDMPGAIHSLNVSNAAAVALYIARRSLAE 274


>gi|28212189|ref|NP_783133.1| 23S rRNA methyltransferase [Clostridium tetani E88]
 gi|28204633|gb|AAO37070.1| 23S rRNA methyltransferase [Clostridium tetani E88]
          Length = 245

 Score =  142 bits (357), Expect = 6e-32,   Method: Composition-based stats.
 Identities = 61/240 (25%), Positives = 106/240 (44%), Gaps = 6/240 (2%)

Query: 47  ENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPH--PFPVKTVPPQTIDKI 104
               + G + V  AL +       L++  N    ++   +L      P+K V  + +D+I
Sbjct: 2   REDLIIGRNAVVEALESHKTLESILISKGNNKGTINKIISLAKENRIPIKNVDKKKLDEI 61

Query: 105 VGKEAVHQGLALETAPLLSPTLDA----VRNSQLLMVLDHVNDPHNIGAILRSAVAFSCD 160
              E      A  T        +        +  +++LD + DPHN GAI+R+A  F  D
Sbjct: 62  SEGENHQGVAAYTTPYKYYSVEEILESSKGKAPFILILDEIQDPHNFGAIIRTAEVFGVD 121

Query: 161 GIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPL 220
           GII  KR S   + ++ KS+ GA+EH+   +++N+   +  +        G    + + +
Sbjct: 122 GIIIPKRRSVGITPIVYKSSVGAVEHVKIAKVNNINSTIDFLKENNIWIYGADMATDRYI 181

Query: 221 EQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
             E     IAL++G+EGKG+   T+E    +  + M G I +LN S A  + +Y      
Sbjct: 182 YSENLKGPIALVVGSEGKGISKLTKEKCDILVKIPMSGQINSLNASVAGGIVMYEISRQR 241


>gi|150016448|ref|YP_001308702.1| tRNA/rRNA methyltransferase (SpoU) [Clostridium beijerinckii NCIMB
           8052]
 gi|149902913|gb|ABR33746.1| tRNA/rRNA methyltransferase (SpoU) [Clostridium beijerinckii NCIMB
           8052]
          Length = 260

 Score =  142 bits (357), Expect = 7e-32,   Method: Composition-based stats.
 Identities = 52/258 (20%), Positives = 105/258 (40%), Gaps = 8/258 (3%)

Query: 24  RRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDW 83
            + +  +K  +   ++ ++ ++     + G   V  A       +  L+ T++A  ++D 
Sbjct: 6   SKENNLFKNTKKLKER-KNRTKTSRYIIEGFRLVQEAFKA-KVDVDYLIVTEDAHDKVDE 63

Query: 84  DANL--PHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDHV 141
                      +  +      +++  E     LA+     +    D        ++ D V
Sbjct: 64  FLGKYINGEIKIYEISSNLFKELISTENPQGILAVIKMNTMESKFDGD----FYLLCDKV 119

Query: 142 NDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQK 201
            DP N+G I+R+A A     II TK      +    +S  G++ +IP          +++
Sbjct: 120 QDPGNLGTIIRTAHAAGVQEIILTKGTVDIYNEKTIRSTMGSIFYIPIYYDDENLSLVKE 179

Query: 202 MHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIK 261
           +   GF  +  S D+ K   Q     ++ L +G EG G+  +  E A +   + MPG  +
Sbjct: 180 LKGKGFNLVVTSLDTDKNFFQADLRGRVLLTVGNEGNGVSREVLEMADTKVKIPMPGNAE 239

Query: 262 ALNVSNAAAVALYITQNH 279
           +LNV+ A++V +Y     
Sbjct: 240 SLNVAVASSVIMYEKVRQ 257


>gi|325954534|ref|YP_004238194.1| tRNA/rRNA methyltransferase (SpoU) [Weeksella virosa DSM 16922]
 gi|323437152|gb|ADX67616.1| tRNA/rRNA methyltransferase (SpoU) [Weeksella virosa DSM 16922]
          Length = 257

 Score =  142 bits (357), Expect = 7e-32,   Method: Composition-based stats.
 Identities = 48/255 (18%), Positives = 94/255 (36%), Gaps = 5/255 (1%)

Query: 26  NHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDA 85
            +   K +    +KSR   +     + G+     A+    R + +    ++         
Sbjct: 7   QNPKIKNLLKLQEKSRERKKQNTFVVEGLQENRLAIEGGFRAL-EFYICEDIFDDNLPL- 64

Query: 86  NLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDHVNDPH 145
                  +  V     +KI  ++     + +      + +   +  + L++VL+ V  P 
Sbjct: 65  ---ENGKIYKVNKPVFEKIAYRKTTGGIVGVYATKENNLSGVELPENALILVLEAVEKPG 121

Query: 146 NIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSW 205
           N+GAILR+A     D +I         +  + +S+ G L        S         ++ 
Sbjct: 122 NLGAILRTADGAKVDAVIVCDETVDFYNPNVIRSSVGTLFTNQIASGSKEEVLNFLKNNN 181

Query: 206 GFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNV 265
                    D+ K L +   +   A++LG E  GL     + +  +  + M G + +LNV
Sbjct: 182 IQIVSTFLRDNTKSLYEMDFSSSSAIVLGTEATGLSDFWADESDVLIKIPMLGKVDSLNV 241

Query: 266 SNAAAVALYITQNHF 280
           SNAAA+ +Y      
Sbjct: 242 SNAAAICVYEAVRQR 256


>gi|296133375|ref|YP_003640622.1| RNA methyltransferase, TrmH family, group 3 [Thermincola sp. JR]
 gi|296031953|gb|ADG82721.1| RNA methyltransferase, TrmH family, group 3 [Thermincola potens JR]
          Length = 268

 Score =  142 bits (357), Expect = 7e-32,   Method: Composition-based stats.
 Identities = 56/281 (19%), Positives = 105/281 (37%), Gaps = 20/281 (7%)

Query: 2   NLISKKKSEKIFSLKDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAAL 61
             I+  K+ +I  L+                      + ++  +     + G+  V  AL
Sbjct: 3   ETITSAKNMRIMYLQSL-------------------LQKKYRDREGKFLVEGLRFVQEAL 43

Query: 62  NNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPL 121
            + +     +LA         + + +P   P+  +  Q   KI   E      AL     
Sbjct: 44  QSGADIEELILAAGVLEKNPSFQSIIPDKIPITIIADQLFKKITDTETPQGIAALVRKKE 103

Query: 122 LSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSAS 181
                  V  +  L+++D V DP N+G I+R+A A    G+   K  +   +    ++  
Sbjct: 104 FRAEDLFVVANPFLLIIDKVQDPGNLGTIIRTADAAGVTGVALVKGTADLYNPKTLRATM 163

Query: 182 GALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLE-QEIKNDKIALILGAEGKGL 240
           G++ H+P I   ++ +A       G + I                ++ +AL++G E +G 
Sbjct: 164 GSVFHVPIINFDSIEEACHLAKKHGLKLIVTDISKDSSSYLAVDYSEPVALVVGNEARGA 223

Query: 241 RPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHFA 281
                E +     + MPG  ++LNVS AA + L+      A
Sbjct: 224 SSFAIENSDYRVAIKMPGKAESLNVSVAAGIILFEAARQRA 264


>gi|309389950|gb|ADO77830.1| RNA methyltransferase, TrmH family, group 3 [Halanaerobium
           praevalens DSM 2228]
          Length = 246

 Score =  142 bits (357), Expect = 7e-32,   Method: Composition-based stats.
 Identities = 65/242 (26%), Positives = 116/242 (47%), Gaps = 12/242 (4%)

Query: 51  LYGVHTVSAALNNPSRKIFQLLATKNALARLDWD---ANLPHPFPVKTVPPQTIDKIVGK 107
           + G + V  AL    RKI ++   +   A++  D          P+  +  Q +++   +
Sbjct: 4   IEGRNPVYEALK-GKRKIHRIFIQEEITAKIIEDILELAAEKNIPISRISSQKLNE-SAQ 61

Query: 108 EAVHQGLALETAPLLSPTLD-------AVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCD 160
              HQG+  E   L S  L+             L+++LD + DPHN GAI+R+A A   D
Sbjct: 62  SHAHQGVIAEADALESYQLEDVIEIKAQKDGDSLVVILDEIKDPHNFGAIIRTAYAAGAD 121

Query: 161 GIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPL 220
            ++  +R +   + V+ K+A+GA EH+P +++SN+  A++ +    F   G  + + +  
Sbjct: 122 AVVYQERRAVGITPVVLKAAAGAAEHLPLVQVSNINYAIRDLKEANFWIAGADAAADQTH 181

Query: 221 EQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
            +      I L++G+EG GLR   +E    +  + M G + +LN S AA+V +Y      
Sbjct: 182 FEADFGGSIGLVIGSEGSGLRRLVRENCDFLVKIPMSGKLGSLNASVAASVIIYEIFRQR 241

Query: 281 AK 282
            K
Sbjct: 242 GK 243


>gi|302878484|ref|YP_003847048.1| RNA methyltransferase, TrmH family, group 3 [Gallionella
           capsiferriformans ES-2]
 gi|302581273|gb|ADL55284.1| RNA methyltransferase, TrmH family, group 3 [Gallionella
           capsiferriformans ES-2]
          Length = 247

 Score =  142 bits (357), Expect = 7e-32,   Method: Composition-based stats.
 Identities = 71/240 (29%), Positives = 117/240 (48%), Gaps = 9/240 (3%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLAT---KNALARLDWDANLPHPFPVKTVPPQTIDKIVG 106
            +YG H V++ +      + ++      ++   R            V  V    +D + G
Sbjct: 6   LIYGFHAVTSRIRQNPEGVMEIYLQSQRQDQRMRDLIALAELSGVRVIPVDSARLDGMAG 65

Query: 107 KEAVHQGLALETA-----PLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDG 161
             A HQG+A           LS  L+ +    LL+VLD + DPHN+GA LRSA AF    
Sbjct: 66  -GARHQGVAARVDAARRVQHLSDVLETLTEPPLLLVLDGIQDPHNLGACLRSADAFGVHA 124

Query: 162 IITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLE 221
           +I  K  +   +A + K A GA E +PYI ++NL   L+++   G   +G + ++K+ L 
Sbjct: 125 VIAPKDRAVGITATVEKVACGAAETVPYITVTNLARTLRELKDQGIWVVGAAGEAKQDLH 184

Query: 222 QEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHFA 281
                  +A++LGAEG+GLR  T ET   +  + M G +++LNVS +  + L+  +   +
Sbjct: 185 SFKHTGPLAIVLGAEGEGLRRLTMETCDELVRIPMLGSVESLNVSVSTGICLFEARRQRS 244


>gi|182420073|ref|ZP_02951307.1| RNA methyltransferase, TrmH family, group 3 [Clostridium butyricum
           5521]
 gi|237666689|ref|ZP_04526674.1| RNA methyltransferase, TrmH family, group 3 [Clostridium butyricum
           E4 str. BoNT E BL5262]
 gi|182376110|gb|EDT73697.1| RNA methyltransferase, TrmH family, group 3 [Clostridium butyricum
           5521]
 gi|237657888|gb|EEP55443.1| RNA methyltransferase, TrmH family, group 3 [Clostridium butyricum
           E4 str. BoNT E BL5262]
          Length = 277

 Score =  141 bits (356), Expect = 7e-32,   Method: Composition-based stats.
 Identities = 68/283 (24%), Positives = 118/283 (41%), Gaps = 18/283 (6%)

Query: 10  EKIFSLKDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIF 69
            K     +    K R+N    K       KS    +     + G + V  AL    R I 
Sbjct: 3   NKPKKTSNLTVKKDRKNEPLKKN------KSITCQEEREDIVIGRNAVMEALK-GDRTIE 55

Query: 70  QLLATKNALARLDWDA---NLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTL 126
            +  + N L                 +K V  + +D +   E  HQG+  +  P     +
Sbjct: 56  AIYVSNNKLEGSINAIMGMAKDQKILIKEVDKRKLDSMCDGE-THQGVIAKVTPFKYSEV 114

Query: 127 -------DAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKS 179
                  +    +  +++LD V DPHN+G+I R+A  F   GII  KR S S +A + KS
Sbjct: 115 SDIFELAEQKGEAPFIVILDEVEDPHNLGSIARTAELFGVHGIIIPKRRSASVTATVYKS 174

Query: 180 ASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKG 239
           + GA+EH+   +++N+   ++++   G    G    +++   +   +   AL++G EG+G
Sbjct: 175 SVGAIEHVKVAKVNNINSTIEELKEKGVWIYGADIRAEEYSHEVDYSGPCALVIGNEGRG 234

Query: 240 LRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHFAK 282
           +   T +    +  + M G I +LN S A  + +Y       K
Sbjct: 235 MSKLTVQKCDKLIKIPMVGKINSLNASVAGGIMMYEVLKGRFK 277


>gi|56552224|ref|YP_163063.1| tRNA/rRNA methyltransferase SpoU [Zymomonas mobilis subsp. mobilis
           ZM4]
 gi|241761703|ref|ZP_04759790.1| tRNA/rRNA methyltransferase (SpoU) [Zymomonas mobilis subsp.
           mobilis ATCC 10988]
 gi|56543798|gb|AAV89952.1| tRNA/rRNA methyltransferase (SpoU) [Zymomonas mobilis subsp.
           mobilis ZM4]
 gi|241374011|gb|EER63544.1| tRNA/rRNA methyltransferase (SpoU) [Zymomonas mobilis subsp.
           mobilis ATCC 10988]
          Length = 268

 Score =  141 bits (356), Expect = 7e-32,   Method: Composition-based stats.
 Identities = 47/260 (18%), Positives = 94/260 (36%), Gaps = 5/260 (1%)

Query: 26  NHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDA 85
           ++   K+++S   K +H  +       G+  ++ A       ++   A  +A   L    
Sbjct: 9   SNPLIKRVRSLRDK-KHRREEGLFLAEGLRILTEAREAGFIPVYIFFAADSAAHPLVQQL 67

Query: 86  NLP---HPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDHVN 142
                 +           + K+ GK+     + +  +  L  +    R + + +V   + 
Sbjct: 68  IEAVEDNGGEAIETSRDILHKLSGKDNPQTVIGVFESFTLPLSSIDRRQAPIWLVAQSLR 127

Query: 143 DPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKM 202
           DP N+G +LR+  A    G+I         S    ++  GAL            D L  +
Sbjct: 128 DPGNLGTLLRTGDAVGAGGLILIDDCVDPFSVEAVRATMGALFTQKIATARWE-DFLVWL 186

Query: 203 HSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKA 262
                  IG S  + +  ++        +++G E +GL    ++    +  + M G   +
Sbjct: 187 RQGEGDLIGTSLRATQDYQEPRYQTPSFVLVGNEAQGLPDSYEDACDHLVKIPMMGRADS 246

Query: 263 LNVSNAAAVALYITQNHFAK 282
           LNV+ A A+  Y   N   K
Sbjct: 247 LNVAVAGAIMAYEVLNQQRK 266


>gi|239832139|ref|ZP_04680468.1| RNA methyltransferase, TrmH family, group 3 [Ochrobactrum
           intermedium LMG 3301]
 gi|239824406|gb|EEQ95974.1| RNA methyltransferase, TrmH family, group 3 [Ochrobactrum
           intermedium LMG 3301]
          Length = 303

 Score =  141 bits (355), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 140/288 (48%), Positives = 188/288 (65%), Gaps = 13/288 (4%)

Query: 1   MNLISKKKSEKIFSLKDSHYAKLRRNHRDYKKMQSFNQKSRHTS--------QPENLFLY 52
           M   +  ++ K     DSHYA+LRR HRD K         +               + LY
Sbjct: 18  MTDQNSPRTPK-----DSHYARLRRQHRDQKAGTEGKSPRKPQRPSISASAVTEGTVRLY 72

Query: 53  GVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQ 112
           G+HTV AA+ NP R+I ++LAT+N  ARL+       PFPV+ V P+ IDK  G EAVHQ
Sbjct: 73  GLHTVRAAVENPERRILRMLATRNGFARLEIGEAESLPFPVEIVEPRDIDKETGSEAVHQ 132

Query: 113 GLALETAPLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSE 172
           G+ +E  PL +  L  +++S LL+VLD V DPHN+GAI+RSAVAF    +ITT R+SP E
Sbjct: 133 GVMIEAEPLRARKLSELKDSPLLLVLDQVTDPHNVGAIMRSAVAFGAGALITTSRHSPQE 192

Query: 173 SAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALI 232
           + VLAK+ASGALE I +I + NL +A++++HS GFQTIGL S+    +E  +   +IAL+
Sbjct: 193 TGVLAKAASGALELISHIEVRNLAEAIEELHSLGFQTIGLDSEGPLEMEATLSGGRIALV 252

Query: 233 LGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
           LGAEGKGLR KT+ET T++A L MPG IK+LNVSNAAA++LY  + + 
Sbjct: 253 LGAEGKGLRQKTRETVTALARLDMPGEIKSLNVSNAAAISLYAAERYL 300


>gi|304405638|ref|ZP_07387297.1| RNA methyltransferase, TrmH family, group 3 [Paenibacillus
           curdlanolyticus YK9]
 gi|304345677|gb|EFM11512.1| RNA methyltransferase, TrmH family, group 3 [Paenibacillus
           curdlanolyticus YK9]
          Length = 281

 Score =  141 bits (355), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 62/277 (22%), Positives = 117/277 (42%), Gaps = 21/277 (7%)

Query: 24  RRNHRDYKKMQSFNQKSRHTSQPEN-----------LFLYGVHTVSAALNNPSRKIFQLL 72
            RN+   ++ Q       + +  +              + G H V  AL +  R+I ++ 
Sbjct: 3   SRNNPYRQERQRERSSGGYRTTEQVQAEQATADNDGEIIAGKHPVLEALRSG-REINKVW 61

Query: 73  ATKNALARL---DWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDA- 128
             + +   L          H   V+    + +D + G+ A    +A   A       +  
Sbjct: 62  IAEGSQKHLTAPIVAEAKQHGIIVQFADKRKLDSMAGEVAHQGVIAQAAAYRYYEVEEIL 121

Query: 129 -----VRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGA 183
                   +  L++LD + DPHN+G+ILR+A      G+I  KR S   +A ++K ++GA
Sbjct: 122 AAAKAKGETPFLLLLDEIEDPHNLGSILRTAECTGVHGVIIPKRRSVGLTATVSKISAGA 181

Query: 184 LEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPK 243
            E++P  R++NL   ++ +   G    G    +++ + +   +  + L++G E KG+   
Sbjct: 182 AEYVPVARVTNLAQTIETLKEQGVWIAGADVAAEQDVYRTKFDMPLGLVIGNESKGMGRL 241

Query: 244 TQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
            +E    +  L M G + +LN S AA V +Y      
Sbjct: 242 IREKCDFLIKLPMAGQLNSLNASVAAGVLMYEVLRQR 278


>gi|315649427|ref|ZP_07902515.1| tRNA/rRNA methyltransferase (SpoU) [Paenibacillus vortex V453]
 gi|315275203|gb|EFU38573.1| tRNA/rRNA methyltransferase (SpoU) [Paenibacillus vortex V453]
          Length = 267

 Score =  141 bits (355), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 52/259 (20%), Positives = 100/259 (38%), Gaps = 3/259 (1%)

Query: 23  LRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALA-RL 81
           L   +   K      +K +H  +     + G+H V  AL++ +            +   L
Sbjct: 4   LSPQNARVKGWAQLQEK-KHRDKQNKYVVEGIHLVQEALSSGADIECIAYDMDKGIPLEL 62

Query: 82  DWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDHV 141
               +         V    I K+    +     A+            +R + L++VLD +
Sbjct: 63  RQIPDRGQGAEWIGVSHAVISKVSDTPSPQPVFAVVRKEARQWQDLIMRENGLVIVLDGL 122

Query: 142 NDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQK 201
            DP N+G I+R A A    G+I  +  +   +    +S  G+L H+P +    L   L +
Sbjct: 123 QDPGNVGTIIRGADAVGAAGVILGRGCADLYNPKTLRSTMGSLFHLPVLEGELL-SILPE 181

Query: 202 MHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIK 261
               G + +    + K+   +        +++G+EG+G+ P+          + MPG  +
Sbjct: 182 ARERGARLVTTMLEGKRSCFEYDFRGTSWIVIGSEGRGVSPEVAAIVDDAIRIPMPGQAE 241

Query: 262 ALNVSNAAAVALYITQNHF 280
           +LN + AA+V +Y      
Sbjct: 242 SLNAAMAASVLMYEALRQR 260


>gi|302039376|ref|YP_003799698.1| RNA methyltransferase, TrmH family, group 3 [Candidatus Nitrospira
           defluvii]
 gi|300607440|emb|CBK43773.1| RNA methyltransferase, TrmH family, group 3 [Candidatus Nitrospira
           defluvii]
          Length = 246

 Score =  141 bits (355), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 70/240 (29%), Positives = 120/240 (50%), Gaps = 9/240 (3%)

Query: 51  LYGVHTVSAALNNPSRKIFQLLA-TKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEA 109
           +YG+H V  AL    R I +LL    +               PV+  P   +D++V    
Sbjct: 2   IYGLHAVREALRAGVRPIQRLLVLGTDRQFGEISRLAREQRVPVRVEPRAALDRLV-PSG 60

Query: 110 VHQGLALETAPLLSPTLDAV-------RNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGI 162
            HQG+    A       D +         + LL++LD V DPHN+GAILR+A A    G+
Sbjct: 61  HHQGVVGVVAAKAYAEPDDILASAQVEGQTPLLVLLDGVEDPHNLGAILRTAEASGVQGV 120

Query: 163 ITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQ 222
              +R +   ++V+AK+++GA++++P  R+ NL+  ++++   G     L +++ K   +
Sbjct: 121 FIPERRAVGLTSVVAKASAGAVDYMPVGRVPNLSRLIERLQDAGIWVYALDAEAPKAYTE 180

Query: 223 EIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHFAK 282
              +  +AL+ G EG G+RP  ++     AH+ M G + +LNVS +AA+ LY       +
Sbjct: 181 LDFSGPVALVFGGEGTGVRPGVRDACDEAAHIPMLGKVSSLNVSASAAIVLYEALRQRRE 240


>gi|149372541|ref|ZP_01891653.1| putative rRNA methylase [unidentified eubacterium SCB49]
 gi|149354584|gb|EDM43148.1| putative rRNA methylase [unidentified eubacterium SCB49]
          Length = 263

 Score =  141 bits (355), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 54/256 (21%), Positives = 99/256 (38%), Gaps = 4/256 (1%)

Query: 26  NHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDA 85
           N+   KK+ +   KSR   +     + G   VS A+     +I  LL     +A L+   
Sbjct: 9   NNPLIKKINALTDKSRERKKQGVFIVEGAREVSLAIK-GHHEILTLLFCPE-IADLNALP 66

Query: 86  NLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPT-LDAVRNSQLLMVLDHVNDP 144
           N+       +V      KI  +      +A+      +   L   + + L+++ +    P
Sbjct: 67  NVADSVEKISVSLDVYQKIAYRATTEGVIAIVKNSKTTLDALVFPKQNPLILIAEAPEKP 126

Query: 145 HNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHS 204
            NIGA+LR+A A   D ++                +S        + +++  D +  +  
Sbjct: 127 GNIGALLRTADAAHVDAVLI-ANPRTDLYNPNIIRSSVGCVFTNQVAMASSEDIIAFLKK 185

Query: 205 WGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALN 264
                        +P   +      A+++G E  GL    ++ +T+  H+ M G I +LN
Sbjct: 186 NNISIYSAILQESQPYHTQDFTTGCAIVVGTEATGLSQAWRDASTANIHIPMQGEIDSLN 245

Query: 265 VSNAAAVALYITQNHF 280
           VS AAAV L+  +   
Sbjct: 246 VSVAAAVLLFEAKRQR 261


>gi|148559141|ref|YP_001259170.1| RNA methyltransferase [Brucella ovis ATCC 25840]
 gi|148370398|gb|ABQ60377.1| RNA methyltransferase, TrmH family, group 3 [Brucella ovis ATCC
           25840]
          Length = 303

 Score =  141 bits (355), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 140/288 (48%), Positives = 186/288 (64%), Gaps = 13/288 (4%)

Query: 1   MNLISKKKSEKIFSLKDSHYAKLRRNHRDYKKMQSFNQKSRHTS--------QPENLFLY 52
           M   +  ++ K     DSHYA+LRR HRD K         +               + LY
Sbjct: 18  MTDQNSPRTPK-----DSHYARLRRQHRDQKAGAEGKSPRKPQRPAIAASAVAEGTVRLY 72

Query: 53  GVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQ 112
           G+HTV AA+ NP RKI ++ AT+N  ARL+       PFPV+ V P+ IDK  G EAVHQ
Sbjct: 73  GLHTVRAAVENPQRKILRMRATRNGFARLEIGEADSLPFPVEIVDPRDIDKETGSEAVHQ 132

Query: 113 GLALETAPLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSE 172
           G+ +E  PL +  L  +R S LL+VLD V DPHN+GAI+RSAVAF    +ITT R+SP E
Sbjct: 133 GVMIEAEPLRTRKLSELRESPLLLVLDQVTDPHNVGAIMRSAVAFGAGALITTSRHSPQE 192

Query: 173 SAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALI 232
           + VLAK+ASGALE I +I + NL +A++++H+ GFQTIGL S     +E  +  ++IAL+
Sbjct: 193 TGVLAKAASGALELIAHIEVRNLAEAIEELHTLGFQTIGLDSQGPLEMEVTLSGNRIALV 252

Query: 233 LGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
           LGAEGKGLR KT+ET T++A L MPG IK+LNVSNAAA++LY  + + 
Sbjct: 253 LGAEGKGLRQKTRETVTALARLDMPGEIKSLNVSNAAAISLYAAERYL 300


>gi|251795157|ref|YP_003009888.1| tRNA/rRNA methyltransferase (SpoU) [Paenibacillus sp. JDR-2]
 gi|247542783|gb|ACS99801.1| tRNA/rRNA methyltransferase (SpoU) [Paenibacillus sp. JDR-2]
          Length = 264

 Score =  141 bits (355), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 57/256 (22%), Positives = 96/256 (37%), Gaps = 3/256 (1%)

Query: 26  NHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDA 85
            +   K+  S   K ++  +     + GVH V  A  + +     +  ++  +       
Sbjct: 10  QNERVKQWASLLDK-KYRDRTGLFIIEGVHLVQEAFKSSAAVQCVVYNSERGIPHELEQL 68

Query: 86  NLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDHVNDPH 145
                        Q + K  G +      A+    L        RN+ L++VLD V DP 
Sbjct: 69  AREGGAEWVQATTQVMAKCTGTDTPPPVFAV-LEKLKRDDTALFRNNSLVVVLDGVRDPG 127

Query: 146 NIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSW 205
           N+G I+RSA A   D ++  K      +    +S  G+L H+P I      + L +  S 
Sbjct: 128 NVGTIIRSADAVGADAVVLGKGSVDLYNPKTVRSTMGSLFHLPIIEADLA-ELLPEAQSK 186

Query: 206 GFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNV 265
           G + +G S  +              L++G E +GL    +        + M G  ++LNV
Sbjct: 187 GIKLVGTSLQATHTCYTYDWTAGTWLLMGNESEGLSDAVRLAVDESVIIPMQGEAESLNV 246

Query: 266 SNAAAVALYITQNHFA 281
           + AA V LY       
Sbjct: 247 AMAATVLLYEAVRQRK 262


>gi|260460674|ref|ZP_05808924.1| RNA methyltransferase, TrmH family, group 3 [Mesorhizobium
           opportunistum WSM2075]
 gi|259033251|gb|EEW34512.1| RNA methyltransferase, TrmH family, group 3 [Mesorhizobium
           opportunistum WSM2075]
          Length = 282

 Score =  141 bits (354), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 147/275 (53%), Positives = 186/275 (67%), Gaps = 6/275 (2%)

Query: 9   SEKIFSLKDSHYAKLRRNHRDYKKMQSFNQKSRHT------SQPENLFLYGVHTVSAALN 62
           S K  + KD+HYAKLRR  RD K   +   K R        +    + LYG+HTV AAL+
Sbjct: 2   SNKTNTPKDTHYAKLRRAFRDEKSGGAPAFKPRQPVPPGENAGDGLVRLYGLHTVRAALD 61

Query: 63  NPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLL 122
           NP R+I ++L T+NA  RL+       PF  + V P+ IDKI G +AVHQG+ +E  PL 
Sbjct: 62  NPRRRIKKMLVTRNAAERLEIADLAALPFSAELVEPRDIDKITGSDAVHQGVLIEAEPLK 121

Query: 123 SPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASG 182
              LDA+ +++L++VLD V DPHN+GAILRSAVAF    +ITT R+SP ES VLAKSASG
Sbjct: 122 PKRLDALGDTKLVLVLDQVTDPHNVGAILRSAVAFGAGALITTARHSPQESGVLAKSASG 181

Query: 183 ALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRP 242
           ALEHI  I + NL DAL ++H  GFQTIGL SD    LE     D++AL+LGAEGKGLR 
Sbjct: 182 ALEHIDQIEVKNLADALGQLHEAGFQTIGLDSDGPAELETSFAGDRVALVLGAEGKGLRQ 241

Query: 243 KTQETATSMAHLHMPGIIKALNVSNAAAVALYITQ 277
           KT+ET T++A L MPG I++LNVSNAAAV+LY  +
Sbjct: 242 KTRETVTTLARLDMPGAIRSLNVSNAAAVSLYAAR 276


>gi|326409274|gb|ADZ66339.1| TrmH family RNA methyltransferase [Brucella melitensis M28]
 gi|326538984|gb|ADZ87199.1| RNA methyltransferase, TrmH family, group 3 [Brucella melitensis
           M5-90]
          Length = 303

 Score =  141 bits (354), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 140/288 (48%), Positives = 186/288 (64%), Gaps = 13/288 (4%)

Query: 1   MNLISKKKSEKIFSLKDSHYAKLRRNHRDYKKMQSFNQKSRHTS--------QPENLFLY 52
           M   +  ++ K     DSHYA+LRR HRD K         +               + LY
Sbjct: 18  MTDQNSPRTPK-----DSHYARLRRQHRDQKAGAEGKSPRKPQRPAIAASAVAEGTVRLY 72

Query: 53  GVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQ 112
           G+HTV AA+ NP RKI ++ AT+N  ARL+       PFPV+ V P+ IDK  G EAVHQ
Sbjct: 73  GLHTVRAAVENPQRKILRMRATRNGFARLEIGEADSLPFPVEIVDPRDIDKETGSEAVHQ 132

Query: 113 GLALETAPLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSE 172
           G+ +E  PL +  L  +R S LL+VLD V DPHN+GAI+RSAVAF    +ITT R+SP E
Sbjct: 133 GVMIEAEPLRTRKLSELRESPLLLVLDQVTDPHNVGAIMRSAVAFGAGALITTSRHSPQE 192

Query: 173 SAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALI 232
           + VLAK+ASGALE I +I + NL +A++++H+ GFQTIGL S     +E  +  ++IAL+
Sbjct: 193 TGVLAKAASGALELIAHIEVRNLAEAIEELHTLGFQTIGLDSQGPLEMEATLSGNRIALV 252

Query: 233 LGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
           LGAEGKGLR KT+ET T++A L MPG IK+LNVSNAAA++LY  + + 
Sbjct: 253 LGAEGKGLRQKTRETVTALARLDMPGEIKSLNVSNAAAISLYAAERYL 300


>gi|306840281|ref|ZP_07473055.1| RNA methyltransferase, TrmH family, group 3 [Brucella sp. BO2]
 gi|306289808|gb|EFM60990.1| RNA methyltransferase, TrmH family, group 3 [Brucella sp. BO2]
          Length = 286

 Score =  141 bits (354), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 140/288 (48%), Positives = 186/288 (64%), Gaps = 13/288 (4%)

Query: 1   MNLISKKKSEKIFSLKDSHYAKLRRNHRDYKKMQSFNQKSRHTS--------QPENLFLY 52
           M   +  ++ K     DSHYA+LRR HRD K         +               + LY
Sbjct: 1   MTDQNSPRTPK-----DSHYARLRRQHRDQKAGAEGKSPRKPQRPTIAASAVAEGTVRLY 55

Query: 53  GVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQ 112
           G+HTV AA+ NP RKI ++ AT+N  ARL+       PFPV+ V P+ IDK  G EAVHQ
Sbjct: 56  GLHTVRAAVENPQRKILRMRATRNGFARLEIGEADSLPFPVEIVDPRDIDKETGSEAVHQ 115

Query: 113 GLALETAPLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSE 172
           G+ +E  PL +  L  +R S LL+VLD V DPHN+GAI+RSAVAF    +ITT R+SP E
Sbjct: 116 GVMIEAEPLRTRKLSELRESPLLLVLDQVTDPHNVGAIMRSAVAFGAGALITTSRHSPQE 175

Query: 173 SAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALI 232
           + VLAK+ASGALE I +I + NL +A++++H+ GFQTIGL S     +E  +  ++IAL+
Sbjct: 176 TGVLAKAASGALELIAHIEVRNLAEAIEELHTLGFQTIGLDSQGPLEMEATLSGNRIALV 235

Query: 233 LGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
           LGAEGKGLR KT+ET T++A L MPG IK+LNVSNAAA++LY  + + 
Sbjct: 236 LGAEGKGLRQKTRETVTALARLDMPGEIKSLNVSNAAAISLYAAERYL 283


>gi|317126837|ref|YP_004093119.1| RNA methyltransferase, TrmH family, group 3 [Bacillus
           cellulosilyticus DSM 2522]
 gi|315471785|gb|ADU28388.1| RNA methyltransferase, TrmH family, group 3 [Bacillus
           cellulosilyticus DSM 2522]
          Length = 252

 Score =  141 bits (354), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 61/245 (24%), Positives = 119/245 (48%), Gaps = 11/245 (4%)

Query: 46  PENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDW---DANLPHPFPVKTVPPQTID 102
            E  +++G + V  AL    R I ++   + +L        + +       + VP + +D
Sbjct: 3   QELEYIFGKNPVLEALR-GKRPINKIWIAEGSLRGPMIQVLELSKEKKINTQIVPKKKLD 61

Query: 103 KIVGKEAVHQGLALETAPLLSPTLD-------AVRNSQLLMVLDHVNDPHNIGAILRSAV 155
           ++V K+  HQG+  + A      +D               ++LD + DPHN+G+ILR+A 
Sbjct: 62  QMVPKDQQHQGVIAQVAAYEFQEIDVLFERARQKNEQPFFLLLDELEDPHNLGSILRTAD 121

Query: 156 AFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSD 215
           A    GII  KR S   +  +AK+++GA+EH+P  R++NL   + ++   G   +G  + 
Sbjct: 122 AVGAHGIIVPKRRSVGLTYTVAKASAGAIEHVPVTRVTNLARTMDELKKEGLWFVGTDAK 181

Query: 216 SKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYI 275
            ++   +   +  + L++G+EG+G+    +E    +  + + G + +LN S AA++ +Y 
Sbjct: 182 GEQDYREVDLDMPVVLVIGSEGRGISRLVKEKCDFLVQIPLAGKVTSLNASVAASLLMYE 241

Query: 276 TQNHF 280
                
Sbjct: 242 VYRRR 246


>gi|225627720|ref|ZP_03785757.1| RNA methyltransferase, TrmH family, group 3 [Brucella ceti str.
           Cudo]
 gi|225617725|gb|EEH14770.1| RNA methyltransferase, TrmH family, group 3 [Brucella ceti str.
           Cudo]
          Length = 303

 Score =  141 bits (354), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 140/288 (48%), Positives = 186/288 (64%), Gaps = 13/288 (4%)

Query: 1   MNLISKKKSEKIFSLKDSHYAKLRRNHRDYKKMQSFNQKSRHTS--------QPENLFLY 52
           M   +  ++ K     DSHYA+LRR HRD K         +               + LY
Sbjct: 18  MTDQNSPRTPK-----DSHYARLRRQHRDQKAGAEGKSPRKPQRPAIAASAVAEGTVRLY 72

Query: 53  GVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQ 112
           G+HTV AA+ NP RKI ++ AT+N  ARL+       PFPV+ V P+ IDK  G EAVHQ
Sbjct: 73  GLHTVRAAVENPQRKILRMRATRNGFARLEIGEADSLPFPVEIVDPRDIDKETGSEAVHQ 132

Query: 113 GLALETAPLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSE 172
           G+ +E  PL +  L  +R S LL+VLD V DPHN+GAI+RSAVAF    +ITT R+SP E
Sbjct: 133 GVMIEAEPLRTRKLSELRESPLLLVLDQVTDPHNVGAIMRSAVAFGAGALITTSRHSPQE 192

Query: 173 SAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALI 232
           + VLAK+ASGALE I +I + NL +A++++H+ GFQTIGL S     +E  +  ++IAL+
Sbjct: 193 TGVLAKAASGALELIAHIEVRNLAEAIEELHTLGFQTIGLDSQGPLEMEATLSGNRIALV 252

Query: 233 LGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
           LGAEGKGLR KT+ET T++A L MPG IK+LNVSNAAA++LY  + + 
Sbjct: 253 LGAEGKGLRQKTRETVTALARLDMPGEIKSLNVSNAAAISLYAAERYL 300


>gi|23502131|ref|NP_698258.1| RNA methyltransferase [Brucella suis 1330]
 gi|161619208|ref|YP_001593095.1| RNA methyltransferase [Brucella canis ATCC 23365]
 gi|225852749|ref|YP_002732982.1| TrmH family RNA methyltransferase [Brucella melitensis ATCC 23457]
 gi|254693953|ref|ZP_05155781.1| RNA methyltransferase, TrmH family, group 3 [Brucella abortus bv. 3
           str. Tulya]
 gi|254701991|ref|ZP_05163819.1| RNA methyltransferase, TrmH family, group 3 [Brucella suis bv. 5
           str. 513]
 gi|254704533|ref|ZP_05166361.1| RNA methyltransferase, TrmH family, group 3 [Brucella suis bv. 3
           str. 686]
 gi|254706572|ref|ZP_05168400.1| RNA methyltransferase, TrmH family, group 3 [Brucella pinnipedialis
           M163/99/10]
 gi|254710319|ref|ZP_05172130.1| RNA methyltransferase, TrmH family, group 3 [Brucella pinnipedialis
           B2/94]
 gi|254714316|ref|ZP_05176127.1| RNA methyltransferase, TrmH family, group 3 [Brucella ceti
           M644/93/1]
 gi|254717753|ref|ZP_05179564.1| RNA methyltransferase, TrmH family, group 3 [Brucella ceti
           M13/05/1]
 gi|256031813|ref|ZP_05445427.1| RNA methyltransferase, TrmH family, group 3 [Brucella pinnipedialis
           M292/94/1]
 gi|256061333|ref|ZP_05451477.1| RNA methyltransferase, TrmH family, group 3 [Brucella neotomae
           5K33]
 gi|256113812|ref|ZP_05454605.1| RNA methyltransferase, TrmH family, group 3 [Brucella melitensis
           bv. 3 str. Ether]
 gi|256159988|ref|ZP_05457701.1| RNA methyltransferase, TrmH family, group 3 [Brucella ceti
           M490/95/1]
 gi|256255213|ref|ZP_05460749.1| RNA methyltransferase, TrmH family, group 3 [Brucella ceti B1/94]
 gi|256263765|ref|ZP_05466297.1| RNA methyltransferase [Brucella melitensis bv. 2 str. 63/9]
 gi|256369676|ref|YP_003107186.1| RNA methyltransferase, TrmH family, group 3 [Brucella microti CCM
           4915]
 gi|260168947|ref|ZP_05755758.1| RNA methyltransferase, TrmH family, group 3 [Brucella sp. F5/99]
 gi|260566224|ref|ZP_05836694.1| RNA methyltransferase [Brucella suis bv. 4 str. 40]
 gi|261214245|ref|ZP_05928526.1| RNA methyltransferase [Brucella abortus bv. 3 str. Tulya]
 gi|261219597|ref|ZP_05933878.1| RNA methyltransferase [Brucella ceti M13/05/1]
 gi|261222409|ref|ZP_05936690.1| RNA methyltransferase [Brucella ceti B1/94]
 gi|261314030|ref|ZP_05953227.1| RNA methyltransferase [Brucella pinnipedialis M163/99/10]
 gi|261317883|ref|ZP_05957080.1| RNA methyltransferase [Brucella pinnipedialis B2/94]
 gi|261322092|ref|ZP_05961289.1| RNA methyltransferase [Brucella ceti M644/93/1]
 gi|261325334|ref|ZP_05964531.1| RNA methyltransferase [Brucella neotomae 5K33]
 gi|261752558|ref|ZP_05996267.1| RNA methyltransferase [Brucella suis bv. 5 str. 513]
 gi|261755216|ref|ZP_05998925.1| RNA methyltransferase [Brucella suis bv. 3 str. 686]
 gi|261758439|ref|ZP_06002148.1| RNA methyltransferase [Brucella sp. F5/99]
 gi|265988911|ref|ZP_06101468.1| RNA methyltransferase [Brucella pinnipedialis M292/94/1]
 gi|265995162|ref|ZP_06107719.1| RNA methyltransferase [Brucella melitensis bv. 3 str. Ether]
 gi|265998376|ref|ZP_06110933.1| RNA methyltransferase [Brucella ceti M490/95/1]
 gi|294852588|ref|ZP_06793261.1| RNA methyltransferase [Brucella sp. NVSL 07-0026]
 gi|306844157|ref|ZP_07476750.1| RNA methyltransferase, TrmH family, group 3 [Brucella sp. BO1]
 gi|23348093|gb|AAN30173.1| RNA methyltransferase, TrmH family, group 3 [Brucella suis 1330]
 gi|161336019|gb|ABX62324.1| RNA methyltransferase, TrmH family, group 3 [Brucella canis ATCC
           23365]
 gi|225641114|gb|ACO01028.1| RNA methyltransferase, TrmH family, group 3 [Brucella melitensis
           ATCC 23457]
 gi|255999838|gb|ACU48237.1| RNA methyltransferase, TrmH family, group 3 [Brucella microti CCM
           4915]
 gi|260155742|gb|EEW90822.1| RNA methyltransferase [Brucella suis bv. 4 str. 40]
 gi|260915852|gb|EEX82713.1| RNA methyltransferase [Brucella abortus bv. 3 str. Tulya]
 gi|260920993|gb|EEX87646.1| RNA methyltransferase [Brucella ceti B1/94]
 gi|260924686|gb|EEX91254.1| RNA methyltransferase [Brucella ceti M13/05/1]
 gi|261294782|gb|EEX98278.1| RNA methyltransferase [Brucella ceti M644/93/1]
 gi|261297106|gb|EEY00603.1| RNA methyltransferase [Brucella pinnipedialis B2/94]
 gi|261301314|gb|EEY04811.1| RNA methyltransferase [Brucella neotomae 5K33]
 gi|261303056|gb|EEY06553.1| RNA methyltransferase [Brucella pinnipedialis M163/99/10]
 gi|261738423|gb|EEY26419.1| RNA methyltransferase [Brucella sp. F5/99]
 gi|261742311|gb|EEY30237.1| RNA methyltransferase [Brucella suis bv. 5 str. 513]
 gi|261744969|gb|EEY32895.1| RNA methyltransferase [Brucella suis bv. 3 str. 686]
 gi|262552844|gb|EEZ08834.1| RNA methyltransferase [Brucella ceti M490/95/1]
 gi|262766275|gb|EEZ12064.1| RNA methyltransferase [Brucella melitensis bv. 3 str. Ether]
 gi|263093865|gb|EEZ17827.1| RNA methyltransferase [Brucella melitensis bv. 2 str. 63/9]
 gi|264661108|gb|EEZ31369.1| RNA methyltransferase [Brucella pinnipedialis M292/94/1]
 gi|294821177|gb|EFG38176.1| RNA methyltransferase [Brucella sp. NVSL 07-0026]
 gi|306275432|gb|EFM57169.1| RNA methyltransferase, TrmH family, group 3 [Brucella sp. BO1]
          Length = 286

 Score =  141 bits (354), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 140/288 (48%), Positives = 186/288 (64%), Gaps = 13/288 (4%)

Query: 1   MNLISKKKSEKIFSLKDSHYAKLRRNHRDYKKMQSFNQKSRHTS--------QPENLFLY 52
           M   +  ++ K     DSHYA+LRR HRD K         +               + LY
Sbjct: 1   MTDQNSPRTPK-----DSHYARLRRQHRDQKAGAEGKSPRKPQRPAIAASAVAEGTVRLY 55

Query: 53  GVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQ 112
           G+HTV AA+ NP RKI ++ AT+N  ARL+       PFPV+ V P+ IDK  G EAVHQ
Sbjct: 56  GLHTVRAAVENPQRKILRMRATRNGFARLEIGEADSLPFPVEIVDPRDIDKETGSEAVHQ 115

Query: 113 GLALETAPLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSE 172
           G+ +E  PL +  L  +R S LL+VLD V DPHN+GAI+RSAVAF    +ITT R+SP E
Sbjct: 116 GVMIEAEPLRTRKLSELRESPLLLVLDQVTDPHNVGAIMRSAVAFGAGALITTSRHSPQE 175

Query: 173 SAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALI 232
           + VLAK+ASGALE I +I + NL +A++++H+ GFQTIGL S     +E  +  ++IAL+
Sbjct: 176 TGVLAKAASGALELIAHIEVRNLAEAIEELHTLGFQTIGLDSQGPLEMEATLSGNRIALV 235

Query: 233 LGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
           LGAEGKGLR KT+ET T++A L MPG IK+LNVSNAAA++LY  + + 
Sbjct: 236 LGAEGKGLRQKTRETVTALARLDMPGEIKSLNVSNAAAISLYAAERYL 283


>gi|150392179|ref|YP_001322228.1| RNA methyltransferase [Alkaliphilus metalliredigens QYMF]
 gi|149952041|gb|ABR50569.1| RNA methyltransferase, TrmH family, group 3 [Alkaliphilus
           metalliredigens QYMF]
          Length = 248

 Score =  141 bits (354), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 65/240 (27%), Positives = 113/240 (47%), Gaps = 10/240 (4%)

Query: 51  LYGVHTVSAALNNPSRKIFQLLAT--KNALARLDWDANLPHPFPVKTVPPQTIDKIVGKE 108
           + G + V  AL         L+A   +    +            V+ V  Q +D+I    
Sbjct: 6   IEGRNPVLEALKAGREIDKLLIAKGAEEGSMKKIIGMAKDQNIIVQYVERQKLDQISESH 65

Query: 109 AVHQGLALETAPLLSPTLDAVRNS-------QLLMVLDHVNDPHNIGAILRSAVAFSCDG 161
           A HQG+  + A      ++ +  +         +++LD + DPHN+G+I+R+A A   DG
Sbjct: 66  A-HQGVIAQVAAYEYSDVETILENAQKKGKSPFILILDEIMDPHNLGSIIRTADAVGVDG 124

Query: 162 IITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLE 221
           II  KR +   +AV+AK+++GA+E++P  ++SN++  + K+   G    G     K+   
Sbjct: 125 IIIPKRRAVGLTAVVAKTSAGAIEYVPVAKVSNISQTIDKLKEKGVWVAGADMKGKQLHF 184

Query: 222 QEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHFA 281
           +      +AL++G EG G+    +E    +  L M G + +LN S AAAV +Y       
Sbjct: 185 EADFKGALALVIGGEGSGISRLVKEKCDFLVKLPMAGQVSSLNASVAAAVLMYEAYRQRI 244


>gi|256044897|ref|ZP_05447801.1| 23S ribosomal RNA methyltransferase [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|260565501|ref|ZP_05835985.1| RNA methyltransferase [Brucella melitensis bv. 1 str. 16M]
 gi|265991325|ref|ZP_06103882.1| RNA methyltransferase [Brucella melitensis bv. 1 str. Rev.1]
 gi|260151569|gb|EEW86663.1| RNA methyltransferase [Brucella melitensis bv. 1 str. 16M]
 gi|263002109|gb|EEZ14684.1| RNA methyltransferase [Brucella melitensis bv. 1 str. Rev.1]
          Length = 286

 Score =  141 bits (354), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 139/288 (48%), Positives = 185/288 (64%), Gaps = 13/288 (4%)

Query: 1   MNLISKKKSEKIFSLKDSHYAKLRRNHRDYKKMQSFNQKSRHTS--------QPENLFLY 52
           M   +  ++ K     DSHYA+LRR HRD K         +               + LY
Sbjct: 1   MTDQNSPRTPK-----DSHYARLRRQHRDQKAGAEGKSPRKPQRPAIAASAVAEGTVRLY 55

Query: 53  GVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQ 112
           G+HTV AA+ NP RKI ++ AT+N  ARL+       PFPV+ V P+ IDK  G EAVHQ
Sbjct: 56  GLHTVRAAVENPQRKILRMRATRNGFARLEIGEADSLPFPVEIVDPRDIDKETGSEAVHQ 115

Query: 113 GLALETAPLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSE 172
           G+ +E  PL +  L  +R S LL+VLD V DPHN+GAI+RSAVAF    +ITT  +SP E
Sbjct: 116 GVMIEAEPLRTRKLSELRESPLLLVLDQVTDPHNVGAIMRSAVAFGAGALITTSHHSPQE 175

Query: 173 SAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALI 232
           + VLAK+ASGALE I +I + NL +A++++H+ GFQTIGL S     +E  +  ++IAL+
Sbjct: 176 TGVLAKAASGALELIAHIEVRNLAEAIEELHTLGFQTIGLDSQGPLEMEATLSGNRIALV 235

Query: 233 LGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
           LGAEGKGLR KT+ET T++A L MPG IK+LNVSNAAA++LY  + + 
Sbjct: 236 LGAEGKGLRQKTRETVTALARLDMPGEIKSLNVSNAAAISLYAAERYL 283


>gi|17987024|ref|NP_539658.1| 23S ribosomal RNA methyltransferase [Brucella melitensis bv. 1 str.
           16M]
 gi|17982677|gb|AAL51922.1| 23S ribosomal RNA methyltransferase [Brucella melitensis bv. 1 str.
           16M]
          Length = 303

 Score =  141 bits (354), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 139/288 (48%), Positives = 185/288 (64%), Gaps = 13/288 (4%)

Query: 1   MNLISKKKSEKIFSLKDSHYAKLRRNHRDYKKMQSFNQKSRHTS--------QPENLFLY 52
           M   +  ++ K     DSHYA+LRR HRD K         +               + LY
Sbjct: 18  MTDQNSPRTPK-----DSHYARLRRQHRDQKAGAEGKSPRKPQRPAIAASAVAEGTVRLY 72

Query: 53  GVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQ 112
           G+HTV AA+ NP RKI ++ AT+N  ARL+       PFPV+ V P+ IDK  G EAVHQ
Sbjct: 73  GLHTVRAAVENPQRKILRMRATRNGFARLEIGEADSLPFPVEIVDPRDIDKETGSEAVHQ 132

Query: 113 GLALETAPLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSE 172
           G+ +E  PL +  L  +R S LL+VLD V DPHN+GAI+RSAVAF    +ITT  +SP E
Sbjct: 133 GVMIEAEPLRTRKLSELRESPLLLVLDQVTDPHNVGAIMRSAVAFGAGALITTSHHSPQE 192

Query: 173 SAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALI 232
           + VLAK+ASGALE I +I + NL +A++++H+ GFQTIGL S     +E  +  ++IAL+
Sbjct: 193 TGVLAKAASGALELIAHIEVRNLAEAIEELHTLGFQTIGLDSQGPLEMEATLSGNRIALV 252

Query: 233 LGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
           LGAEGKGLR KT+ET T++A L MPG IK+LNVSNAAA++LY  + + 
Sbjct: 253 LGAEGKGLRQKTRETVTALARLDMPGEIKSLNVSNAAAISLYAAERYL 300


>gi|258512689|ref|YP_003186123.1| RNA methyltransferase, TrmH family, group 3 [Alicyclobacillus
           acidocaldarius subsp. acidocaldarius DSM 446]
 gi|257479415|gb|ACV59734.1| RNA methyltransferase, TrmH family, group 3 [Alicyclobacillus
           acidocaldarius subsp. acidocaldarius DSM 446]
          Length = 255

 Score =  141 bits (354), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 73/255 (28%), Positives = 125/255 (49%), Gaps = 10/255 (3%)

Query: 33  MQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNAL-ARLDWDANLPHPF 91
           M+   ++     +     + G H V AAL +  R + ++   + A               
Sbjct: 5   MRDGARRRSAQGEEAADLVKGRHAVLAALES-ERPVNKVWVAEGASGMDAIVAKARSRGV 63

Query: 92  PVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDA-----VRNSQLLMVLDHVNDPHN 146
            V+ VP   +D++    + HQG+  + AP     LD         + L++VLD + DPHN
Sbjct: 64  VVQFVPRSRLDEMA---SAHQGVIAQVAPYAYVDLDDVIRRDTGFAPLVVVLDEIADPHN 120

Query: 147 IGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWG 206
            GAILR+A A    G++  KR     + V+AK+A+GALE +P  R++N+  ALQ++   G
Sbjct: 121 FGAILRTAEASGAQGVVIGKRRQAQVTDVVAKAAAGALETLPVARVANVAQALQRLKQAG 180

Query: 207 FQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVS 266
           +  +G   ++K P  +       A+++G+EG+G+R   +E    +  + + G +++LN S
Sbjct: 181 YWIVGADVEAKVPYTEVDYRGPTAVVIGSEGQGMRRWVREQCDFLVSIPILGRVQSLNAS 240

Query: 267 NAAAVALYITQNHFA 281
            AA V LY      A
Sbjct: 241 VAAGVLLYEAVRQRA 255


>gi|193212230|ref|YP_001998183.1| RNA methyltransferase, TrmH family, group 3 [Chlorobaculum parvum
           NCIB 8327]
 gi|193085707|gb|ACF10983.1| RNA methyltransferase, TrmH family, group 3 [Chlorobaculum parvum
           NCIB 8327]
          Length = 257

 Score =  141 bits (354), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 61/243 (25%), Positives = 106/243 (43%), Gaps = 7/243 (2%)

Query: 45  QPENLFLYGVHTVSAALNNPSRKIFQLLATKNALA-RLDWDANLPH--PFPVKTVPPQTI 101
           +P    +YG + V   L +    + ++    N    +L            P      + +
Sbjct: 13  EPREQVVYGRNAVIELLQSKPESVEKIYLQFNTSHPKLKEIVITARRLKIPCGKARMEKL 72

Query: 102 DKIVGKEAVHQGLALETAPLLSPTLD----AVRNSQLLMVLDHVNDPHNIGAILRSAVAF 157
             I G        AL T+       +       +S LL++L  + DPHN+GAI+R+A A 
Sbjct: 73  TLISGTAKNQGVCALLTSVTFYTLDEVLAAPRNSSPLLVILQGLEDPHNVGAIIRTAEAV 132

Query: 158 SCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSK 217
           + D +I  +      SA + K+++GAL H+   ++ +L   L  +H  GF  +    +++
Sbjct: 133 AADSVIMIEGKGAPISATVHKASAGALSHMRVCKVKSLVKTLDLLHERGFSIVAADMEAE 192

Query: 218 KPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQ 277
                        L++GAEGKGL  +T++    +  + M G +++LNVS AA V LY   
Sbjct: 193 HNHTDIDWKRPTVLVMGAEGKGLGSETRKRCDQIVRIPMAGCVESLNVSVAAGVMLYEAM 252

Query: 278 NHF 280
              
Sbjct: 253 RQR 255


>gi|291613895|ref|YP_003524052.1| RNA methyltransferase, TrmH family, group 3 [Sideroxydans
           lithotrophicus ES-1]
 gi|291584007|gb|ADE11665.1| RNA methyltransferase, TrmH family, group 3 [Sideroxydans
           lithotrophicus ES-1]
          Length = 247

 Score =  141 bits (354), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 71/239 (29%), Positives = 116/239 (48%), Gaps = 9/239 (3%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLA---TKNALARLDWDANLPHPFPVKTVPPQTIDKIVG 106
            ++G H V+A +   +  + ++      K+  AR        +   +  V  + +D + G
Sbjct: 6   IIHGFHAVTARIRQNADSVLEMYVDTQRKDPRARDLLKLAESNGVRIIQVDGKRLDGMAG 65

Query: 107 KEAVHQGLALETA-----PLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDG 161
             + HQG+            L   LD +    LL+VLD V DPHN+GA LRSA AF    
Sbjct: 66  -NSRHQGVVARVDAAQKVQHLDDVLDTLTEPALLLVLDGVQDPHNLGACLRSADAFGVHA 124

Query: 162 IITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLE 221
           +I  K  +   +A + K A GA + +PYI ++NL   L+++       IG+  +++  L 
Sbjct: 125 VIAPKDRAVGINATVEKVACGAAQTVPYITVTNLARTLRELQERDIWVIGMDGEAETNLY 184

Query: 222 QEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
                  +A +LGAEG+GLR  T+ET   +  + M G +++LNVS +  V LY  +   
Sbjct: 185 DVQHQGAVAWVLGAEGEGLRRLTRETCDQLVRIPMQGSVESLNVSVSTGVCLYEARRQR 243


>gi|169831538|ref|YP_001717520.1| tRNA/rRNA methyltransferase SpoU [Candidatus Desulforudis
           audaxviator MP104C]
 gi|169638382|gb|ACA59888.1| tRNA/rRNA methyltransferase (SpoU) [Candidatus Desulforudis
           audaxviator MP104C]
          Length = 272

 Score =  141 bits (354), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 64/287 (22%), Positives = 104/287 (36%), Gaps = 26/287 (9%)

Query: 1   MNLISKKKSEKIFSLKDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAA 60
           M  I+ + +E+I  LK  H                     +H          G+  +  A
Sbjct: 1   MK-ITSRSNERIKYLKKFHEK-------------------KHRDLENGFLAEGLKVIEEA 40

Query: 61  LNNPSRKIFQLLATKNALARL----DWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLAL 116
           L      +  LL T + L         D        +     Q +  +   +     LAL
Sbjct: 41  LQAGWE-VRMLLYTSDVLRHPRGVALLDKARATGTELWECEKQVLAVVTDTKTPQGALAL 99

Query: 117 ETAPLLSPT-LDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAV 175
              P  S   L   R + L++VLD + DP N+G I+R+A A    G+IT +         
Sbjct: 100 IAKPEHSLDVLLQGRGTPLVVVLDGLQDPGNLGTIIRTADACELQGVITLEGTVDLFHPK 159

Query: 176 LAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGA 235
           + ++++GAL H+P          L+     G Q           L +   +   AL +G 
Sbjct: 160 VVRASAGALFHLPAFGDLPAPAVLEFFTGAGVQKFVADPRGDYSLYECDFSRPTALFMGN 219

Query: 236 EGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHFAK 282
           E +G        A  +  + MPG  ++LNV  AA++ +Y       K
Sbjct: 220 EARGCGEMLHAAADRVVAIPMPGQAESLNVGVAASLFIYEAVRQRLK 266


>gi|41406577|ref|NP_959413.1| hypothetical protein MAP0479 [Mycobacterium avium subsp.
           paratuberculosis K-10]
 gi|81414895|sp|Q743W2|Y479_MYCPA RecName: Full=Uncharacterized tRNA/rRNA methyltransferase MAP_0479
 gi|41394926|gb|AAS02796.1| hypothetical protein MAP_0479 [Mycobacterium avium subsp.
           paratuberculosis K-10]
          Length = 309

 Score =  141 bits (354), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 77/269 (28%), Positives = 123/269 (45%), Gaps = 11/269 (4%)

Query: 21  AKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNP-SRKIFQLLATKNALA 79
           A LR NH   K+ QS  ++    ++     L G + V   L          +     A  
Sbjct: 41  AHLRPNHPAAKRAQSPPRRPAKRTEETETVL-GRNPVLECLRAGVPATALYVALGTEADE 99

Query: 80  RLDWDANLPH--PFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDA------VRN 131
           RL    +        +  VP   +D++ G   +HQG+AL+  P +    D          
Sbjct: 100 RLTESVSRAADSGISILEVPRADLDRMTGNH-LHQGIALQVPPYIYAHPDDLLEAAAGSL 158

Query: 132 SQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIR 191
             LL+ LD+++DP N+GAI+RS  AF   G++  +R S S +AV  ++++GA   IP  R
Sbjct: 159 PALLVALDNISDPRNLGAIVRSVAAFGGHGVLIPQRRSASVTAVAWRTSAGAAARIPVAR 218

Query: 192 ISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSM 251
            +NLT  LQ     G + IGL +     L+    +D + +++G+EGKGL    ++    +
Sbjct: 219 ATNLTRTLQDWADRGLRVIGLDAGGDTMLDDLDGSDPLVVVVGSEGKGLSRLVRQNCDEV 278

Query: 252 AHLHMPGIIKALNVSNAAAVALYITQNHF 280
             + M G  ++LN S AA V L       
Sbjct: 279 VSIPMAGSAESLNASVAAGVVLAEISRQR 307


>gi|260599471|ref|YP_003212042.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Cronobacter
           turicensis z3032]
 gi|260218648|emb|CBA33967.1| 23S rRNA (guanosine-2'-O-)-methyltransferase rlmB [Cronobacter
           turicensis z3032]
          Length = 243

 Score =  141 bits (354), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 70/243 (28%), Positives = 110/243 (45%), Gaps = 10/243 (4%)

Query: 48  NLFLYGVHTVSAALNNPSRKIFQLLATKNALARLD---WDANLPHPFPVKTVPPQTIDKI 104
           +  +YG+H V A L +   +  ++   K    +       A      PV+    Q +D+ 
Sbjct: 2   SEMIYGIHAVQALLESAPERFQEVFILKGREDKRLLPLIHALEAQGVPVQVANRQWLDEK 61

Query: 105 VGKEAVHQGLALETAPLLSP------TLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFS 158
               AVHQG+     P           L A      L++LD V DPHN+GA LRSA A  
Sbjct: 62  AD-GAVHQGIVARVKPGRQYGENDLPDLLAAHAQPFLLILDGVTDPHNLGACLRSADAAG 120

Query: 159 CDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKK 218
              +I  K  S   +A   K A GA E +P IR++NL   ++ +       +G + ++  
Sbjct: 121 VHAVIVPKDRSAQLNATAKKVACGAAESVPLIRVTNLARTMRLLQEENVWIVGTAGEADH 180

Query: 219 PLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQN 278
            L Q      +AL++GAEG+G+R  T+E    +  + M G + +LNVS A  + L+    
Sbjct: 181 TLFQSKMTGPLALVMGAEGEGMRRLTREHCDELISIPMAGSVSSLNVSVATGICLFEAVR 240

Query: 279 HFA 281
             +
Sbjct: 241 QRS 243


>gi|153952842|ref|YP_001393607.1| methyltransferase [Clostridium kluyveri DSM 555]
 gi|146345723|gb|EDK32259.1| Predicted methyltransferase [Clostridium kluyveri DSM 555]
          Length = 280

 Score =  141 bits (354), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 66/271 (24%), Positives = 122/271 (45%), Gaps = 11/271 (4%)

Query: 22  KLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNAL--- 78
           +  +N  +  + ++  +  +   Q     + G ++V  ALN+ +  I Q+      +   
Sbjct: 7   RDMKNKYNVLRHKNKIENLKSEPQFREDLIEGRNSVMEALNSNNVTIEQIFVLDGNMSGS 66

Query: 79  ARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNS------ 132
               +         VK V  + +D+I  +  VHQG+  +  P     L+ + +       
Sbjct: 67  INTIFAIAKEKHIVVKKVDKRKLDRIS-QTGVHQGVIAKVIPYKYCELEDILDYASERGE 125

Query: 133 -QLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIR 191
              +++LD + DPHN GAI+R+A      GII  KR +   +  + KS++GA+E++   +
Sbjct: 126 SPFIIILDEIQDPHNFGAIIRTAEVSGVHGIIIPKRRNVGITPTVYKSSAGAVEYMKICK 185

Query: 192 ISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSM 251
           ++NL   ++K+        G     +        N  IALI+G+EGKG+   T++    +
Sbjct: 186 VTNLNTIIEKLKKENIWIYGADMTGENYCFDVDFNSSIALIIGSEGKGISKLTKQKCDKL 245

Query: 252 AHLHMPGIIKALNVSNAAAVALYITQNHFAK 282
             + M G I +LN S AA + +Y       K
Sbjct: 246 VKIPMMGNISSLNASVAAGMLMYEILKQKIK 276


>gi|296166634|ref|ZP_06849061.1| RNA methyltransferase [Mycobacterium parascrofulaceum ATCC BAA-614]
 gi|295898006|gb|EFG77585.1| RNA methyltransferase [Mycobacterium parascrofulaceum ATCC BAA-614]
          Length = 310

 Score =  141 bits (354), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 73/269 (27%), Positives = 120/269 (44%), Gaps = 10/269 (3%)

Query: 21  AKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNP--SRKIFQLLATK-NA 77
           A LR NH   K+ QS  ++       E   + G + V   L     +  ++  L T  + 
Sbjct: 41  AHLRPNHPAAKRAQSPPRRPAKRPTDETETVLGRNPVLECLRAGVPATALYVALGTDTDE 100

Query: 78  LARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDA------VRN 131
                          +  VP   +D++     +HQG+AL+  P      D          
Sbjct: 101 RVTESVARAADSGISILEVPRADLDRMTSNH-LHQGIALQVPPYSYAHPDDLLATALGSP 159

Query: 132 SQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIR 191
             LL+ LD+++DP N+GAI+RS  AF   G++  +R S S +AV  ++++GA   IP  R
Sbjct: 160 PPLLVALDNISDPRNLGAIVRSVAAFGGHGVLIPQRRSASVTAVAWRTSAGAAARIPVAR 219

Query: 192 ISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSM 251
            +NLT  L+     G + IGL +     ++     D + +++G+EGKGL    ++    +
Sbjct: 220 ATNLTRTLKDWADRGIRVIGLDAGGDTVVDDLDGADPLVVVVGSEGKGLSRLVRQNCDEV 279

Query: 252 AHLHMPGIIKALNVSNAAAVALYITQNHF 280
             + M G  ++LN S AA V L       
Sbjct: 280 VSIPMAGQAESLNASVAAGVVLAEIARQR 308


>gi|326201776|ref|ZP_08191647.1| RNA methyltransferase, TrmH family, group 3 [Clostridium
           papyrosolvens DSM 2782]
 gi|325988376|gb|EGD49201.1| RNA methyltransferase, TrmH family, group 3 [Clostridium
           papyrosolvens DSM 2782]
          Length = 265

 Score =  141 bits (354), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 57/282 (20%), Positives = 111/282 (39%), Gaps = 23/282 (8%)

Query: 1   MNLISKKKSEKIFSLKDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAA 60
           MN I   ++  +  +K  H                     ++       F+ G+  V+ A
Sbjct: 1   MNYIQSSQNSTLKEIKALHLK-------------------KNRDSQGLYFVEGIRFVNDA 41

Query: 61  LNNPSRKIFQLLATK-NALARLDWDANLPHPF--PVKTVPPQTIDKIVGKEAVHQGLALE 117
           ++N       +++ K   L                +  VP +   ++   +   QG+   
Sbjct: 42  IDNGQVISKVIVSDKLEGLNGGSELIEKVKGVCSDISLVPEKLFKEVSDTQ-TPQGILAV 100

Query: 118 TAPLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLA 177
                    + +     +++LD + DP N G I+R+A A     ++ +K      S  + 
Sbjct: 101 LEKNQFDFQEVIEKGNSVVILDCLQDPGNAGTIIRTADAAGISAVLMSKGCVDLYSPKVL 160

Query: 178 KSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEG 237
           +S  G++ H+P     N+T+ +Q +   G++ I      K    QE    + A+I+G E 
Sbjct: 161 RSTMGSVFHVPIFEGLNITETIQLLKQKGYKVIASHLSGKNNYFQEDLTGRSAIIVGNEA 220

Query: 238 KGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNH 279
            G+  +T   A S+  + MPG  ++LN S AA++ +Y     
Sbjct: 221 NGISDETANMADSLVKIPMPGKAESLNASVAASIMIYEIVRQ 262


>gi|291547784|emb|CBL20892.1| rRNA methylases [Ruminococcus sp. SR1/5]
          Length = 258

 Score =  140 bits (353), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 50/257 (19%), Positives = 102/257 (39%), Gaps = 4/257 (1%)

Query: 26  NHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDA 85
           ++   K +   NQK++   +       G      A   P   + Q+      ++R     
Sbjct: 6   SNAKIKNVMQLNQKAKARREQGLFVAEGRKMFLEA---PESWVSQVFV-SETVSRDGELM 61

Query: 86  NLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDHVNDPH 145
           +    +P + V      ++   +     L +   P  S        + L+MVL+ + DP 
Sbjct: 62  SQAEKYPCEIVKDSVFRQMCDTKTPQGILTVLKLPSWSEEEVLAGKNPLVMVLEDLQDPG 121

Query: 146 NIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSW 205
           N G ILR+       G+  TK      +  + +S  G++  +P++ + ++    +K+   
Sbjct: 122 NAGTILRTGEGAGVSGVFLTKTCVDITNPKVIRSTMGSIYRMPFLYVEDVVSLEKKLKEK 181

Query: 206 GFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNV 265
           G ++       +   +QE      A  +G EGKGL  +  E A  +  + M G +++LN 
Sbjct: 182 GIRSFAAHLKGENSYDQESYKGGTAFFIGNEGKGLTDQAAEAADCLIRIPMCGKVESLNA 241

Query: 266 SNAAAVALYITQNHFAK 282
           + A+ + +Y       +
Sbjct: 242 AMASGILMYEAARQRRE 258


>gi|158338300|ref|YP_001519477.1| RNA methyltransferase [Acaryochloris marina MBIC11017]
 gi|158308541|gb|ABW30158.1| RNA methyltransferase, TrmH family, group 3 [Acaryochloris marina
           MBIC11017]
          Length = 309

 Score =  140 bits (353), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 68/289 (23%), Positives = 130/289 (44%), Gaps = 15/289 (5%)

Query: 5   SKKKSEKIF--SLKDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALN 62
           SK +  +    S K  H            +++S +++   + + +   +YG H+V +AL 
Sbjct: 14  SKPRKPQRSYSSAKKPHRQSTSSRPPQKPRIRSKDKEPAQSEEEQGDLIYGRHSVLSALE 73

Query: 63  NPSRKIFQLLA----TKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALET 118
           +  R + ++        +       +        +  V  + ++++  ++A HQG+A + 
Sbjct: 74  H-QRSLNRVWVVSRLRYDPRFHSLLNQAKSQGTIIDEVDHRRLNQLT-QQATHQGIAAQV 131

Query: 119 APLLSPTLDA-------VRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPS 171
           A      +              +++  D + DPHN+GA++R+A A    G+I  +R +  
Sbjct: 132 AAYEYLDISTLIEQANAATPKPVIIAADSITDPHNLGAMIRTAEALGAQGVIIPQRRAAG 191

Query: 172 ESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIAL 231
            ++V+AK A+GALE +   R+ NL   L+++   GF   GLS+ + + +      +   L
Sbjct: 192 ITSVVAKVATGALETLAIARVVNLNQGLEQLKKAGFWIYGLSTSAPQSIHTVTFTEPTVL 251

Query: 232 ILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
           ++GAEG GL   TQ     M  + + G   +LN S A  +ALY      
Sbjct: 252 VIGAEGPGLSVSTQHHCDQMVSIPLQGKTASLNASVATGMALYEVYRQR 300


>gi|254719306|ref|ZP_05181117.1| RNA methyltransferase, TrmH family, group 3 [Brucella sp. 83/13]
 gi|265984307|ref|ZP_06097042.1| RNA methyltransferase [Brucella sp. 83/13]
 gi|306839077|ref|ZP_07471894.1| RNA methyltransferase, TrmH family, group 3 [Brucella sp. NF 2653]
 gi|264662899|gb|EEZ33160.1| RNA methyltransferase [Brucella sp. 83/13]
 gi|306405624|gb|EFM61886.1| RNA methyltransferase, TrmH family, group 3 [Brucella sp. NF 2653]
          Length = 286

 Score =  140 bits (353), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 141/288 (48%), Positives = 186/288 (64%), Gaps = 13/288 (4%)

Query: 1   MNLISKKKSEKIFSLKDSHYAKLRRNHRDYKKMQSFNQKSRHTS--------QPENLFLY 52
           M   +  ++ K     DSHYA+LRR HRD K         +               + LY
Sbjct: 1   MTDQNSPRTPK-----DSHYARLRRQHRDQKAGAEGKSPRKPQRPAIAASAVAEGTVRLY 55

Query: 53  GVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQ 112
           G+HTV AA+ NP RKI ++ AT+N  ARL+       PFPV+ V P+ IDK  G EAVHQ
Sbjct: 56  GLHTVRAAVENPQRKILRMRATRNGFARLEIGEADSLPFPVEIVDPRDIDKETGSEAVHQ 115

Query: 113 GLALETAPLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSE 172
           G+ +E  PL +  L  +R S LL+VLD V DPHN+GAI+RSAVAF    +ITT R+SP E
Sbjct: 116 GVMIEAEPLRARKLSELRESPLLLVLDQVTDPHNVGAIMRSAVAFGAGALITTSRHSPQE 175

Query: 173 SAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALI 232
           S VLAK+ASGALE I +I + NL +A++++H+ GFQTIGL S     +E  +  ++IAL+
Sbjct: 176 SGVLAKAASGALELIAHIEVRNLAEAIEELHTLGFQTIGLDSQGPLEMEATLSGNRIALV 235

Query: 233 LGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
           LGAEGKGLR KT+ET T++A L MPG IK+LNVSNAAA++LY  + + 
Sbjct: 236 LGAEGKGLRQKTRETVTALARLDMPGEIKSLNVSNAAAISLYAAERYL 283


>gi|153813024|ref|ZP_01965692.1| hypothetical protein RUMOBE_03432 [Ruminococcus obeum ATCC 29174]
 gi|149830826|gb|EDM85916.1| hypothetical protein RUMOBE_03432 [Ruminococcus obeum ATCC 29174]
          Length = 258

 Score =  140 bits (353), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 51/255 (20%), Positives = 98/255 (38%), Gaps = 4/255 (1%)

Query: 26  NHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDA 85
            +   K +   NQK++   +       G      A   P   I ++   ++ L   +   
Sbjct: 6   QNTQVKNIIKLNQKAKARREQGLFIAEGRKMFLEA---PDDWIEKIYVAESMLEDEEVMK 62

Query: 86  NLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDHVNDPH 145
            +   F    V      ++   +     L +   P             LLMVL+ + DP 
Sbjct: 63  KV-RRFSWDAVENGVFRQMCDTQTPQGILTVLRQPSYELEDLLKEEKPLLMVLEDLQDPG 121

Query: 146 NIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSW 205
           N G I+R+       G+  TK      +  + ++  G++  IP+  + ++    QK+   
Sbjct: 122 NAGTIIRTGEGAGVSGVFLTKTCVDITNPKVIRATMGSVYRIPFFYVEDVVSLKQKLQGR 181

Query: 206 GFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNV 265
           G + +      K   ++E   D  A ++G EGKGL  +  + A  +  + M G +++LN 
Sbjct: 182 GIRFLAAHLQGKNSYDRESYEDGTAFLIGNEGKGLTDQAADAADCLIRIPMCGQVESLNA 241

Query: 266 SNAAAVALYITQNHF 280
           + AA + +Y      
Sbjct: 242 AMAAGILMYEAARQR 256


>gi|118465233|ref|YP_879854.1| RNA methyltransferase, TrmH family protein, group 3 [Mycobacterium
           avium 104]
 gi|254773532|ref|ZP_05215048.1| RNA methyltransferase, TrmH family protein, group 3 [Mycobacterium
           avium subsp. avium ATCC 25291]
 gi|254806514|sp|A0QAB6|Y574_MYCA1 RecName: Full=Uncharacterized tRNA/rRNA methyltransferase MAV_0574
 gi|118166520|gb|ABK67417.1| RNA methyltransferase, TrmH family protein, group 3 [Mycobacterium
           avium 104]
          Length = 309

 Score =  140 bits (353), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 77/269 (28%), Positives = 123/269 (45%), Gaps = 11/269 (4%)

Query: 21  AKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNP-SRKIFQLLATKNALA 79
           A LR NH   K+ QS  ++    ++     L G + V   L          +     A  
Sbjct: 41  AHLRPNHPAAKRAQSPPRRPAKRTEETETVL-GRNPVLECLRAGVPATALYVALGTEADE 99

Query: 80  RLDWDANLPH--PFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDA------VRN 131
           RL    +        +  VP   +D++ G   +HQG+AL+  P +    D          
Sbjct: 100 RLTESVSRAADSGISILEVPRADLDRMTGNH-LHQGIALQVPPYIYAHPDDLLEAAAGSP 158

Query: 132 SQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIR 191
             LL+ LD+++DP N+GAI+RS  AF   G++  +R S S +AV  ++++GA   IP  R
Sbjct: 159 PALLVALDNISDPRNLGAIVRSVAAFGGHGVLIPQRRSASVTAVAWRTSAGAAARIPVAR 218

Query: 192 ISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSM 251
            +NLT  LQ     G + IGL +     L+    +D + +++G+EGKGL    ++    +
Sbjct: 219 ATNLTRTLQDWADRGLRVIGLDAGGDTTLDDLDGSDPLVVVVGSEGKGLSRLVRQNCDEV 278

Query: 252 AHLHMPGIIKALNVSNAAAVALYITQNHF 280
             + M G  ++LN S AA V L       
Sbjct: 279 VSIPMAGSAESLNASVAAGVVLAEISRQR 307


>gi|284799730|ref|ZP_05984713.2| RNA methyltransferase, TrmH family [Neisseria subflava NJ9703]
 gi|284796977|gb|EFC52324.1| RNA methyltransferase, TrmH family [Neisseria subflava NJ9703]
          Length = 263

 Score =  140 bits (353), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 51/282 (18%), Positives = 93/282 (32%), Gaps = 25/282 (8%)

Query: 1   MNLISKKKSEKIFSLKDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAA 60
           M LI+  ++E++                  K +     +++   +     L GVH +   
Sbjct: 1   MKLITSAQNEQL------------------KHLFRLLTQAKARRESGETVLEGVHLLQTY 42

Query: 61  LNNPSRKIFQLLATKNALARLDWDA-NLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETA 119
           L +        L  K        +         +  V  + + KI         +     
Sbjct: 43  LQSGGTPKQVYLPEKKQQHIEIQEITAQLDEGLITWVGNEALSKITS-LTDADDVMTWID 101

Query: 120 PLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKS 179
                 L +  +    +VL+ V DP N G ILRSA A     I+ +       S  + ++
Sbjct: 102 IPQQAGLPSDGDC---VVLERVQDPGNAGTILRSAAAAGVRQIVCSNDSVDIWSPKVLRA 158

Query: 180 ASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKG 239
             GA   +       L+  ++      + T     +          +   A + G EG G
Sbjct: 159 GMGAHFLLSIFSRVELSAWMETYQHQIWATALGGRNIGLYEMD--LSQPCAWVFGNEGSG 216

Query: 240 LRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHFA 281
           +    +E A +   + M G  ++LNV+ AA V L+       
Sbjct: 217 VSETVKEKADACVKIPMLGQTESLNVAMAATVCLFEQMRQRI 258


>gi|89094562|ref|ZP_01167500.1| hypothetical protein MED92_00984 [Oceanospirillum sp. MED92]
 gi|89081161|gb|EAR60395.1| hypothetical protein MED92_00984 [Oceanospirillum sp. MED92]
          Length = 245

 Score =  140 bits (353), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 69/239 (28%), Positives = 116/239 (48%), Gaps = 9/239 (3%)

Query: 51  LYGVHTVSAALNNPSRKIFQLLATK---NALARLDWDANLPHPFPVKTVPPQTIDKIVGK 107
           L+G+H V+ AL   +++I ++L  K   +A  +   D  L     ++ V  + ++++V  
Sbjct: 6   LFGIHAVNTALKRDAQRIHKILIMKGRQDAKMQRLIDTALDLRIRIEQVSKRELEELVKG 65

Query: 108 EAVHQGLALETAPLLSPT------LDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDG 161
                 +AL               LD +     L++LD V DPHN+GA LR+A A     
Sbjct: 66  AVHQGVVALCKPIQTYNEQYLDKLLDQLEEPPFLLILDGVTDPHNLGACLRTADAAGVQA 125

Query: 162 IITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLE 221
           ++  K  S   +A  AK A GA E +PY+ ++NL   L+ +   G  T G + ++   + 
Sbjct: 126 VVAPKDKSAPLNATAAKVACGAAESVPYVLVTNLARTLKSLQERGVWTTGTAGETDLDIY 185

Query: 222 QEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
           Q      +ALI+GAEG+G+R  T+E    +  + M G + +LNVS A  + L+      
Sbjct: 186 QANLKGPMALIMGAEGQGMRRLTREHCDQLVKIPMAGEVSSLNVSVATGICLFEAVRQR 244


>gi|312622555|ref|YP_004024168.1| tRNA/rRNA methyltransferase (SpoU) [Caldicellulosiruptor
           kronotskyensis 2002]
 gi|312203022|gb|ADQ46349.1| tRNA/rRNA methyltransferase (SpoU) [Caldicellulosiruptor
           kronotskyensis 2002]
          Length = 270

 Score =  140 bits (353), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 49/285 (17%), Positives = 111/285 (38%), Gaps = 28/285 (9%)

Query: 2   NLISKKKSEKIFSLKDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAAL 61
             IS +++E I  +K  H                     ++  +  +  + G+  V  A+
Sbjct: 7   EFISSRENECIKRVKKLHDK-------------------KYREEFRSFIIEGLKLVKEAI 47

Query: 62  NNPSRKIFQLLATKNALARLDWDANLPHPF-------PVKTVPPQTIDKIVGKEAVHQGL 114
                 I  ++ ++ A  +                   V  VP +  + I         L
Sbjct: 48  EYQIECINLVIFSQQAKEKYQEFFEECKYLLQDGKIKRVIEVPDKLFEYITTTSTPQGIL 107

Query: 115 ALETAPLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESA 174
           A          ++ ++N + +++ D++ DP N+G ++R A AF  D ++TTK      + 
Sbjct: 108 AECIFVDK--DINFIKNLRRVVIADNLQDPGNLGTLIRCADAFGFDAVVTTKGTVDIYNP 165

Query: 175 VLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILG 234
              ++  G+L H+  +R +     ++ +    F     +      + + + + +  +++G
Sbjct: 166 KTTRATMGSLFHLQIMREAEEGKLIKILKDNSFAVYVATPYGDIEISKIVPDKRFCIVIG 225

Query: 235 AEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNH 279
            E +G+     + AT    + M G  ++LN + AA++ LY  +  
Sbjct: 226 NESEGVSDSFAKVATRKIKIPMVGKTESLNAAVAASIVLYELRKR 270


>gi|239827986|ref|YP_002950610.1| tRNA/rRNA methyltransferase (SpoU) [Geobacillus sp. WCH70]
 gi|239808279|gb|ACS25344.1| tRNA/rRNA methyltransferase (SpoU) [Geobacillus sp. WCH70]
          Length = 254

 Score =  140 bits (353), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 57/277 (20%), Positives = 105/277 (37%), Gaps = 27/277 (9%)

Query: 1   MNLISKKKSEKIFSLKDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAA 60
           M  I   K+ ++   K                        +   +     + G H V  A
Sbjct: 1   MKRIQSTKNPQVKEWKKLLTK-------------------KGQEKMGLFLIEGFHLVEEA 41

Query: 61  LNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAP 120
           L + +  + +L+  +       W+       PV  V  + +  I   E   QG+A     
Sbjct: 42  LKSHA-PLVELIVDEKKEIPPSWN---AGHLPVTIVTEEVMKAISDTE-TPQGIAAVCEQ 96

Query: 121 LLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSA 180
                +D  + + LL+  D V DP NIG ++R+A A   D +I  +  +   +  + ++ 
Sbjct: 97  FSYGDIDWTQANVLLI--DAVQDPGNIGTMIRTADAAGIDAVILGEGCADLYNPKVIRAT 154

Query: 181 SGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGL 240
            G+L H+P IR +      +              ++ +           AL++G EG G+
Sbjct: 155 QGSLFHLPIIRGNLREWIERLCEKNVAIYGTA-LENGEDYRHIKPARPFALLVGNEGSGV 213

Query: 241 RPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQ 277
             K  +  T   ++ + G  ++LNV+ AA + LY  Q
Sbjct: 214 HKKLLQMTTKNLYIPIYGQAESLNVAVAAGILLYHLQ 250


>gi|258515609|ref|YP_003191831.1| tRNA/rRNA methyltransferase (SpoU) [Desulfotomaculum acetoxidans
           DSM 771]
 gi|257779314|gb|ACV63208.1| tRNA/rRNA methyltransferase (SpoU) [Desulfotomaculum acetoxidans
           DSM 771]
          Length = 266

 Score =  140 bits (353), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 50/261 (19%), Positives = 103/261 (39%), Gaps = 7/261 (2%)

Query: 26  NHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNP---SRKIFQLLATKNALARLD 82
           ++   + ++    K R         + GV  V  AL +       I+     +N   +  
Sbjct: 7   DNPRIRYLKHLA-KRRFRETEGKFIIEGVRFVEEALASAMSVEAVIYSAKLFQNNRGKEL 65

Query: 83  WDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLS--PTLDAVRNSQLLMVLDH 140
            +       P   V    ++ +    A  QG+      + +    +      QLL+++D 
Sbjct: 66  LECIYKSNVPFWEVTEPILESLSD-TATPQGVVAVIKSVPTGLQEILTRVKKQLLVLVDG 124

Query: 141 VNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQ 200
           + DP N+G I+R++ A   D +I ++      +    ++  G+L H+P I       A +
Sbjct: 125 IQDPGNLGTIIRTSDAAGVDAVILSRGTVDLYNPKTLRATMGSLFHLPVIMAGEPVQAAE 184

Query: 201 KMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGII 260
            +   G + +       +P+        +AL++G+E  G+    +       ++ MPG  
Sbjct: 185 LLLQAGIRLVVGMPQDCQPVYSVDLTGPVALVVGSEANGVSEGLKRLPAIPVNIPMPGHA 244

Query: 261 KALNVSNAAAVALYITQNHFA 281
           ++LN + AAA+ LY      +
Sbjct: 245 ESLNAAIAAAIMLYEAVRQRS 265


>gi|254449207|ref|ZP_05062656.1| RNA methyltransferase, TrmH family, group 3 [gamma proteobacterium
           HTCC5015]
 gi|198261184|gb|EDY85480.1| RNA methyltransferase, TrmH family, group 3 [gamma proteobacterium
           HTCC5015]
          Length = 264

 Score =  140 bits (353), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 81/258 (31%), Positives = 122/258 (47%), Gaps = 9/258 (3%)

Query: 31  KKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPH- 89
           ++ +  +  S+  ++      +G+H V A +     ++FQL   K A  RL     L   
Sbjct: 3   RRGKQRSSGSKRGTKSPQFL-FGLHAVEAFIQRRPEEVFQLYWQKGADQRLGKLQALATQ 61

Query: 90  -PFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPT------LDAVRNSQLLMVLDHVN 142
              P + V  Q +D  V        +A   +  L         LD V N  L++VLD V 
Sbjct: 62  LGLPTQYVERQQLDDWVDGARHQGVIAQVRSSELWREADLEGILDGVENVPLVLVLDGVT 121

Query: 143 DPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKM 202
           DPHN+GA LRSA     D +I  K  S   +AV  K A GA E  P+I+++NL   L+ +
Sbjct: 122 DPHNLGACLRSANGAGVDVVIAPKDKSAGLTAVSRKVACGAAEETPFIQVTNLARTLKGL 181

Query: 203 HSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKA 262
              G   +GL+    + L +   +  +AL++GAEG GLR  T+E+   +  + M G + +
Sbjct: 182 AERGLWIVGLADGEDRSLYEGRLDGPMALVMGAEGDGLRRLTRESCDEIVAIPMGGSVSS 241

Query: 263 LNVSNAAAVALYITQNHF 280
           LNVS AA V LY      
Sbjct: 242 LNVSVAAGVCLYEVVRQR 259


>gi|147678286|ref|YP_001212501.1| rRNA methylases [Pelotomaculum thermopropionicum SI]
 gi|146274383|dbj|BAF60132.1| rRNA methylases [Pelotomaculum thermopropionicum SI]
          Length = 270

 Score =  140 bits (353), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 55/263 (20%), Positives = 98/263 (37%), Gaps = 7/263 (2%)

Query: 23  LRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLAT---KNALA 79
           L R +   K ++    + R   +     + GV  V  ALN+       +      +    
Sbjct: 2   LSRQNSRIKYLRRLGSR-RFREKEGKFLIEGVRFVEEALNSAWPVEMLVYCRRITETRRG 60

Query: 80  RLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLS--PTLDAVRNSQLLMV 137
               +       P+  V      ++ G     QG              L A     LL++
Sbjct: 61  EALLEKASFQGVPLVEVDESLFGELAG-TTTPQGALAVVKKGKVSLEDLQAGGEPALLVI 119

Query: 138 LDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTD 197
           +D V DP N+G I+RSA A    G+I  K  +   +A   ++  GA+ ++P ++     +
Sbjct: 120 VDGVQDPGNLGTIVRSAGAAGAGGVILLKGTADIFNAKALRATMGAIFYVPVVQDVTSVE 179

Query: 198 ALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMP 257
           A+  +   G + +       K +         AL+LG+E  G              + MP
Sbjct: 180 AMTYLKQLGIKAVAGDPRGDKLIYDCDLTVPCALVLGSEAAGAGEPVLRMVAERVRIPMP 239

Query: 258 GIIKALNVSNAAAVALYITQNHF 280
           G  ++LNV+ ++AV L+      
Sbjct: 240 GRAESLNVAVSSAVLLFEAVRQR 262


>gi|240850284|ref|YP_002971677.1| tRNA/rRNA methyltransferase [Bartonella grahamii as4aup]
 gi|240267407|gb|ACS50995.1| tRNA/rRNA methyltransferase [Bartonella grahamii as4aup]
          Length = 276

 Score =  140 bits (352), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 135/274 (49%), Positives = 182/274 (66%), Gaps = 5/274 (1%)

Query: 11  KIFSLKDSHYAKLRRNHRDYKKMQSFN----QKSRHTSQPENLFLYGVHTVSAALNNPSR 66
           K  + ++SHYA+LRR +RD K   S +    +K   + Q   + LYG+H+V AAL NP R
Sbjct: 2   KEKTSQNSHYARLRRRYRDTKGSPSRSFTHLKKKAASLQQGIIHLYGIHSVQAALENPKR 61

Query: 67  KIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTL 126
            +  L  T+NAL RL+   +  +P  V    P+ +D +VG EAVHQG+ LET PL    L
Sbjct: 62  ILKCLYVTQNALKRLNISES-DYPCSVTLCTPKYLDSLVGSEAVHQGIVLETLPLKPCKL 120

Query: 127 DAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEH 186
             + N+ L++V+D + DPHN+GAI+RSAVA     +ITT R+SP ES VLAK+ASGALE 
Sbjct: 121 SELTNTDLVIVMDQITDPHNVGAIMRSAVALKAKALITTCRHSPHESGVLAKAASGALEM 180

Query: 187 IPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQE 246
           I YI + NL +ALQ++H  GF + GL S+  KPLE  +  +KIAL+LGAEGKGLR KT+E
Sbjct: 181 IHYITVRNLAEALQELHQTGFSSFGLDSEGDKPLETALTGNKIALVLGAEGKGLRKKTRE 240

Query: 247 TATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
           T  ++  L MPG IK+LNVSNAA +ALY+   + 
Sbjct: 241 TVCALTRLDMPGNIKSLNVSNAATIALYVAHKYL 274


>gi|50122542|ref|YP_051709.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Pectobacterium
           atrosepticum SCRI1043]
 gi|52783288|sp|Q6D127|RLMB_ERWCT RecName: Full=23S rRNA (guanosine-2'-O-)-methyltransferase RlmB;
           AltName: Full=23S rRNA Gm2251 2'-O-methyltransferase
 gi|49613068|emb|CAG76519.1| probable tRNA/rRNA methyltransferase [Pectobacterium atrosepticum
           SCRI1043]
          Length = 244

 Score =  140 bits (352), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 61/241 (25%), Positives = 100/241 (41%), Gaps = 8/241 (3%)

Query: 48  NLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDW---DANLPHPFPVKTVPPQTIDKI 104
           +  +YG+H V A L    ++  ++   K    R               ++    Q +DK 
Sbjct: 2   SEIIYGIHAVKALLERDPQRFLEVFILKGRDDRRLQPVIAELEAQGIVIQVASRQWLDKQ 61

Query: 105 VGKEAVHQGLALETAPLLSPTLDAVRN-----SQLLMVLDHVNDPHNIGAILRSAVAFSC 159
                    +A           D            L++LD V DPHN+GA LR+A     
Sbjct: 62  AEDAVHQGIVAKVKEGRKYQENDLPAMLDNLEMPFLLILDGVTDPHNLGACLRNADGAGV 121

Query: 160 DGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKP 219
             +I  +  S   +A + K A GA E IP I ++NL   ++ +       +G + ++   
Sbjct: 122 HAVIVPRDRSAQLNATVKKVACGAAETIPVISVTNLARTMRLLQERNIWIVGTAGEADHT 181

Query: 220 LEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNH 279
           L Q      +AL++GAEG+G+R  T+E    +  + M G + +LNVS A  V L+     
Sbjct: 182 LYQSKLTGPLALVMGAEGEGMRRLTREHCDELISIPMAGSVSSLNVSVATGVCLFEAVRQ 241

Query: 280 F 280
            
Sbjct: 242 R 242


>gi|150015025|ref|YP_001307279.1| RNA methyltransferase [Clostridium beijerinckii NCIMB 8052]
 gi|149901490|gb|ABR32323.1| RNA methyltransferase, TrmH family, group 3 [Clostridium
           beijerinckii NCIMB 8052]
          Length = 300

 Score =  140 bits (352), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 77/294 (26%), Positives = 129/294 (43%), Gaps = 17/294 (5%)

Query: 4   ISKKK--SEKIFSLKDSHYAKLRRN---HRDYKKMQSFNQKSRHTSQPENLFLYGVHTVS 58
           IS  K   +K  S+ +S       N   +++ K     N KS    +     + G + V 
Sbjct: 9   ISSGKFMEDKDKSVTESKGKAKSYNQVKNKNKKDNMVGNDKSTSAIEEREDIVIGRNAVI 68

Query: 59  AALNNPSRKIFQLLATKNAL---ARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLA 115
            AL    R I  L  + + L    +        +   +K V  + +D + G E VHQG+ 
Sbjct: 69  EALR-GERTIEALYISNSKLEGSIKTIVGLAKENKILIKEVDKRKLDSMCGGE-VHQGVI 126

Query: 116 LETAPLLSPTL-------DAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRY 168
            +  P     +       +    +  +++LD V DPHN+G+I+R+A  F   GII  KR 
Sbjct: 127 AKVTPYKYSEVSDILDLAEKRGEAPFIVILDEVEDPHNLGSIVRTAELFGVHGIILPKRR 186

Query: 169 SPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDK 228
           S S S  + KS+ GA+EH+   +++NL   ++++   G    G    +++   Q      
Sbjct: 187 SASVSTTVYKSSVGAIEHVKIAKVTNLNSTIEELKEKGIWIYGADIRAEEYSYQVDFGGP 246

Query: 229 IALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHFAK 282
            A+I+G EG+G+   T E    +  + M G I +LN S A  + +Y       K
Sbjct: 247 CAVIIGNEGRGISKLTVEKCDKLIKIPMVGKINSLNASVAGGIIMYEVLKGRLK 300


>gi|237815670|ref|ZP_04594667.1| RNA methyltransferase, TrmH family, group 3 [Brucella abortus str.
           2308 A]
 gi|297248557|ref|ZP_06932275.1| TrmH family RNA methyltransferase [Brucella abortus bv. 5 str.
           B3196]
 gi|237788968|gb|EEP63179.1| RNA methyltransferase, TrmH family, group 3 [Brucella abortus str.
           2308 A]
 gi|297175726|gb|EFH35073.1| TrmH family RNA methyltransferase [Brucella abortus bv. 5 str.
           B3196]
          Length = 303

 Score =  140 bits (352), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 140/288 (48%), Positives = 187/288 (64%), Gaps = 13/288 (4%)

Query: 1   MNLISKKKSEKIFSLKDSHYAKLRRNHRDYKKMQSFNQKSRHTS--------QPENLFLY 52
           M   +  ++ K     DSHYA+LRR HRD K         +               + LY
Sbjct: 18  MTDQNSPRTPK-----DSHYARLRRQHRDQKAGAEGKSPRKPQRPAIAASAVAEGTVRLY 72

Query: 53  GVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQ 112
           G+HTV AA+ NP RKI ++ AT+N  ARL+   +   PFPV+ V P+ IDK  G EAVHQ
Sbjct: 73  GLHTVRAAVENPQRKILRMRATRNGFARLEIGESDSLPFPVEIVDPRDIDKETGSEAVHQ 132

Query: 113 GLALETAPLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSE 172
           G+ +E  PL +  L  +R S LL+VLD V DPHN+GAI+RSAVAF    +ITT R+SP E
Sbjct: 133 GVMIEAEPLRTRKLSELRESPLLLVLDQVTDPHNVGAIMRSAVAFGAGALITTSRHSPQE 192

Query: 173 SAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALI 232
           + VLAK+ASGALE I +I + NL +A++++H+ GFQTIGL S     +E  +  ++IAL+
Sbjct: 193 TGVLAKAASGALELIAHIEVRNLAEAIEELHTLGFQTIGLDSQGPLEMEATLSGNRIALV 252

Query: 233 LGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
           LGAEGKGLR KT+ET T++A L MPG IK+LNVSNAAA++LY  + + 
Sbjct: 253 LGAEGKGLRQKTRETVTALARLDMPGEIKSLNVSNAAAISLYAAERYL 300


>gi|62290163|ref|YP_221956.1| RNA methyltransferase [Brucella abortus bv. 1 str. 9-941]
 gi|189024398|ref|YP_001935166.1| RNA methyltransferase, TrmH family, group 3 [Brucella abortus S19]
 gi|254689467|ref|ZP_05152721.1| RNA methyltransferase, TrmH family, group 3 [Brucella abortus bv. 6
           str. 870]
 gi|254697605|ref|ZP_05159433.1| RNA methyltransferase, TrmH family, group 3 [Brucella abortus bv. 2
           str. 86/8/59]
 gi|254730496|ref|ZP_05189074.1| RNA methyltransferase, TrmH family, group 3 [Brucella abortus bv. 4
           str. 292]
 gi|256257714|ref|ZP_05463250.1| RNA methyltransferase, TrmH family, group 3 [Brucella abortus bv. 9
           str. C68]
 gi|260546707|ref|ZP_05822446.1| RNA methyltransferase [Brucella abortus NCTC 8038]
 gi|260754991|ref|ZP_05867339.1| RNA methyltransferase [Brucella abortus bv. 6 str. 870]
 gi|260758207|ref|ZP_05870555.1| RNA methyltransferase [Brucella abortus bv. 4 str. 292]
 gi|260762034|ref|ZP_05874377.1| RNA methyltransferase [Brucella abortus bv. 2 str. 86/8/59]
 gi|260884001|ref|ZP_05895615.1| RNA methyltransferase [Brucella abortus bv. 9 str. C68]
 gi|62196295|gb|AAX74595.1| RNA methyltransferase, TrmH family, group 3 [Brucella abortus bv. 1
           str. 9-941]
 gi|189019970|gb|ACD72692.1| RNA methyltransferase, TrmH family, group 3 [Brucella abortus S19]
 gi|260095757|gb|EEW79634.1| RNA methyltransferase [Brucella abortus NCTC 8038]
 gi|260668525|gb|EEX55465.1| RNA methyltransferase [Brucella abortus bv. 4 str. 292]
 gi|260672466|gb|EEX59287.1| RNA methyltransferase [Brucella abortus bv. 2 str. 86/8/59]
 gi|260675099|gb|EEX61920.1| RNA methyltransferase [Brucella abortus bv. 6 str. 870]
 gi|260873529|gb|EEX80598.1| RNA methyltransferase [Brucella abortus bv. 9 str. C68]
          Length = 286

 Score =  140 bits (352), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 140/288 (48%), Positives = 187/288 (64%), Gaps = 13/288 (4%)

Query: 1   MNLISKKKSEKIFSLKDSHYAKLRRNHRDYKKMQSFNQKSRHTS--------QPENLFLY 52
           M   +  ++ K     DSHYA+LRR HRD K         +               + LY
Sbjct: 1   MTDQNSPRTPK-----DSHYARLRRQHRDQKAGAEGKSPRKPQRPAIAASAVAEGTVRLY 55

Query: 53  GVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQ 112
           G+HTV AA+ NP RKI ++ AT+N  ARL+   +   PFPV+ V P+ IDK  G EAVHQ
Sbjct: 56  GLHTVRAAVENPQRKILRMRATRNGFARLEIGESDSLPFPVEIVDPRDIDKETGSEAVHQ 115

Query: 113 GLALETAPLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSE 172
           G+ +E  PL +  L  +R S LL+VLD V DPHN+GAI+RSAVAF    +ITT R+SP E
Sbjct: 116 GVMIEAEPLRTRKLSELRESPLLLVLDQVTDPHNVGAIMRSAVAFGAGALITTSRHSPQE 175

Query: 173 SAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALI 232
           + VLAK+ASGALE I +I + NL +A++++H+ GFQTIGL S     +E  +  ++IAL+
Sbjct: 176 TGVLAKAASGALELIAHIEVRNLAEAIEELHTLGFQTIGLDSQGPLEMEATLSGNRIALV 235

Query: 233 LGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
           LGAEGKGLR KT+ET T++A L MPG IK+LNVSNAAA++LY  + + 
Sbjct: 236 LGAEGKGLRQKTRETVTALARLDMPGEIKSLNVSNAAAISLYAAERYL 283


>gi|332978195|gb|EGK14927.1| TrmH family RNA methyltransferase [Desmospora sp. 8437]
          Length = 263

 Score =  140 bits (352), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 50/281 (17%), Positives = 106/281 (37%), Gaps = 25/281 (8%)

Query: 1   MNL--ISKKKSEKIFSLKDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVS 58
           M +  I+  ++EK+                  K+ +  + + +   +  ++ + G   + 
Sbjct: 1   MEIHQITSARNEKV------------------KRWRKLSTR-KGREEFGSILIEGEKLLK 41

Query: 59  AALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALET 118
            A     +    +++ +    R   D +      V  + P T  ++V  +   QG+A E 
Sbjct: 42  EAARAGWQVRSVIVSDEG--IRGLEDLSYLDGVSVYALYPSTFAQLVDTQ-TPQGIAAEV 98

Query: 119 APLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAK 178
               +     +R  + +++LD + DP N+G ILR+A A     +          +  + +
Sbjct: 99  VVPENKEGYRIRGEEPVLLLDAIRDPGNLGTILRTAEAAGVGDVWLGAGTVDPFNPKVVR 158

Query: 179 SASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGK 238
           SA G+L      R+       +      +         +   +      + A++LG EGK
Sbjct: 159 SAMGSLFRTRIRRVDLREAIPELKKQGYWVVGTSPRAERAHFDC-HYPKQTAILLGNEGK 217

Query: 239 GLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNH 279
           G+  +          + MPG +++LNVS  A + L+     
Sbjct: 218 GISAEIDSLVDDRVKIPMPGQVESLNVSVTAGILLFELLRQ 258


>gi|331091980|ref|ZP_08340812.1| hypothetical protein HMPREF9477_01455 [Lachnospiraceae bacterium
           2_1_46FAA]
 gi|330402879|gb|EGG82446.1| hypothetical protein HMPREF9477_01455 [Lachnospiraceae bacterium
           2_1_46FAA]
          Length = 257

 Score =  140 bits (352), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 47/254 (18%), Positives = 107/254 (42%), Gaps = 4/254 (1%)

Query: 27  HRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDAN 86
           +   K++    +KS+  ++     + G+     A   P  +I ++  ++    R   + N
Sbjct: 7   NAQVKELLQLQKKSKVRNERNIFLVEGIKMFFEA---PRNRIEKVFISETLFDRKKQELN 63

Query: 87  LPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDHVNDPHN 146
           L     V+ +  +    +   +     L +             +  + LM+LD++ DP N
Sbjct: 64  LD-GLKVEILSDKVFSHVSDTKTPQGILCIMRQKKTKLEEIFAQKPEHLMILDNLQDPGN 122

Query: 147 IGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWG 206
           +G I+R+A      GII +K      +    +S  G++  +P++ + +L + ++++    
Sbjct: 123 LGTIVRTAEGAGVSGIILSKDCVDIYNPKTIRSTMGSIYRMPFLYVEDLENTIEEVKKQD 182

Query: 207 FQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVS 266
            +        K   ++E      A ++G EG GLR +  E A     + M G +++LN +
Sbjct: 183 IKVYAAHLQGKNNYDEENYKTGCAFLIGNEGNGLRDEIAEKADIWVKIKMHGEVESLNAA 242

Query: 267 NAAAVALYITQNHF 280
            A+++ ++      
Sbjct: 243 IASSILMFEVCRQR 256


>gi|325662834|ref|ZP_08151403.1| RNA methyltransferase [Lachnospiraceae bacterium 4_1_37FAA]
 gi|325470886|gb|EGC74115.1| RNA methyltransferase [Lachnospiraceae bacterium 4_1_37FAA]
          Length = 262

 Score =  139 bits (351), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 54/257 (21%), Positives = 111/257 (43%), Gaps = 6/257 (2%)

Query: 26  NHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDA 85
           ++   K++    +KS+  ++     + GV         P  ++ ++  ++    +   + 
Sbjct: 6   SNARVKELVQLQKKSKVRNEQGVFLVEGVKMYQEI---PQEQLVKVYVSETFADKQKEEI 62

Query: 86  NLPHPF-PVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDA-VRNSQLLMVLDHVND 143
           N       ++ +      + V      QG+            D        L+VLD++ D
Sbjct: 63  NRLKDRRKLEYLSDHVF-QYVSDTKTPQGILCVVRQSAYCLEDILEAEDAHLLVLDNLQD 121

Query: 144 PHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMH 203
           P N+G ILR+A      GII +K      +  + +S  G++  +P++ + +L +A+ K+ 
Sbjct: 122 PGNLGTILRTAEGAGVTGIIISKESVDIYNPKVIRSTMGSIYRVPFVYVEDLKEAIAKVK 181

Query: 204 SWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKAL 263
           + G  T     D K   ++E    K A ++G EG GLR +  + A +   + M G +++L
Sbjct: 182 AHGIFTYAAHLDGKNSYDKEDYTKKTAFLIGNEGNGLRKEIADLADTWIRIPMQGQVESL 241

Query: 264 NVSNAAAVALYITQNHF 280
           N + A +V ++ T    
Sbjct: 242 NAAIATSVLMFETARQR 258


>gi|23099587|ref|NP_693053.1| rRNA methylase [Oceanobacillus iheyensis HTE831]
 gi|22777817|dbj|BAC14088.1| rRNA methylase [Oceanobacillus iheyensis HTE831]
          Length = 246

 Score =  139 bits (351), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 55/276 (19%), Positives = 110/276 (39%), Gaps = 30/276 (10%)

Query: 3   LISKKKSEKIFSLKDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALN 62
           +I+  K+EK+ S K  H                   + +   +     + G+H +  AL 
Sbjct: 1   MITSIKNEKVKSWKKLH-------------------RRKERLKTNTFLIDGIHLIQEALK 41

Query: 63  NPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLL 122
           +    I +L+  +          N     PV  V    + +I   +     +A+    + 
Sbjct: 42  SNW-VIQELIVVEGY-----ELPNDAKDVPVAYVSENVLKEISQTQTPQGVIAVVEMNIP 95

Query: 123 SPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASG 182
               D    + L+++LD + DP N+G I+R+A A   D ++         +  + ++  G
Sbjct: 96  KVQED----NNLIILLDAIQDPGNMGTIIRTADAAGVDAVVLGDGCVDIFNDKVIRATQG 151

Query: 183 ALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRP 242
           ++ HIP    +   +    + + GF  +  +        +   ++K+ LILG EG G+ P
Sbjct: 152 SIFHIPIYTATLEQEIH-MLQTQGFTILATALHDAVEYTEVSVHNKVGLILGNEGAGIAP 210

Query: 243 KTQETATSMAHLHMPGIIKALNVSNAAAVALYITQN 278
                A    ++ + G  ++LNV  AA + +Y  + 
Sbjct: 211 SLLNKANQRINIPIYGKAESLNVGIAAGILMYHLKK 246


>gi|261822838|ref|YP_003260944.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Pectobacterium
           wasabiae WPP163]
 gi|261606851|gb|ACX89337.1| RNA methyltransferase, TrmH family, group 3 [Pectobacterium
           wasabiae WPP163]
          Length = 243

 Score =  139 bits (351), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 60/242 (24%), Positives = 101/242 (41%), Gaps = 8/242 (3%)

Query: 48  NLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDW---DANLPHPFPVKTVPPQTIDKI 104
           +  +YG+H V A L    ++  ++   K    R               ++    Q +DK 
Sbjct: 2   SEIIYGIHAVKALLERDPQRFLEVFVLKGRDDRRLQPVIAELEAQGIVIQVASRQWLDKQ 61

Query: 105 VGKEAVHQGLALETAPLLSPTLDAVRN-----SQLLMVLDHVNDPHNIGAILRSAVAFSC 159
                    +            D         +  L++LD V DPHN+GA LR+A     
Sbjct: 62  AEDAVHQGIVVKVKEGRKYQENDLPAMLDNIETPFLLILDGVTDPHNLGACLRNADGAGV 121

Query: 160 DGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKP 219
             +I  +  S   +A + K A GA E +P I ++NL   ++ +       +G + ++   
Sbjct: 122 HAVIVPRDRSAQLNATVKKVACGAAETVPVISVTNLARTMRLLQERNIWIVGTAGEADHT 181

Query: 220 LEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNH 279
           L Q      +AL++GAEG+G+R  T+E    +  + M G + +LNVS A  V L+     
Sbjct: 182 LYQSKLTGPLALVMGAEGEGMRRLTREHCDELISIPMAGSVSSLNVSVATGVCLFEAVRQ 241

Query: 280 FA 281
            A
Sbjct: 242 RA 243


>gi|225569865|ref|ZP_03778890.1| hypothetical protein CLOHYLEM_05959 [Clostridium hylemonae DSM
           15053]
 gi|225161335|gb|EEG73954.1| hypothetical protein CLOHYLEM_05959 [Clostridium hylemonae DSM
           15053]
          Length = 263

 Score =  139 bits (351), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 46/257 (17%), Positives = 102/257 (39%), Gaps = 6/257 (2%)

Query: 27  HRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLD---W 83
           ++  K++ +  +K +   + +   + G+         P+ ++ +   +++   R      
Sbjct: 7   NQKVKRLVNLRKKRKARDEEKVFLVEGIRMFREV---PAERLLEAYVSESFYKREGGTVS 63

Query: 84  DANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDHVND 143
                     + +     D +   +     L +      +    A      ++VLD++ D
Sbjct: 64  RVLEGCAVRPEILSDTVYDYVSDTKTPQGVLCVVRQKEYTFAEAAGGERAHILVLDNLQD 123

Query: 144 PHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMH 203
           P N+G ++R+A      GI+ +       +    +S  G++  +P  R  +LT+A+++M 
Sbjct: 124 PGNMGTVIRTAEGAGVTGIVMSSECVDVYNPKTIRSTMGSVYRMPLYRAKDLTEAVRRMK 183

Query: 204 SWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKAL 263
             G  T     D     ++       A  +G EG GLR +    A +   + M G +++L
Sbjct: 184 ESGIHTYAAHLDGVLSYDEADLTKPCAFFIGNEGSGLREEVAALADTYIRIPMEGEVESL 243

Query: 264 NVSNAAAVALYITQNHF 280
           N + AAAV ++      
Sbjct: 244 NAATAAAVLMFEAARQR 260


>gi|167464999|ref|ZP_02330088.1| 23S rRNA methyltransferase [Paenibacillus larvae subsp. larvae
           BRL-230010]
 gi|322381143|ref|ZP_08055146.1| 23S rRNA methyltransferase-like protein [Paenibacillus larvae
           subsp. larvae B-3650]
 gi|321154719|gb|EFX46990.1| 23S rRNA methyltransferase-like protein [Paenibacillus larvae
           subsp. larvae B-3650]
          Length = 245

 Score =  139 bits (351), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 65/244 (26%), Positives = 117/244 (47%), Gaps = 12/244 (4%)

Query: 48  NLFLYGVHTVSAALNNPSRKIFQLLATKNALARLD---WDANLPHPFPVKTVPPQTIDKI 104
             F+ G H+V  AL +  R I ++   +NA  +           H   V+TV  + +D++
Sbjct: 2   EEFIGGKHSVLEALRSG-RTINKIWIAENAGKQQAGSVLSEAKKHGIIVQTVDRRKLDQM 60

Query: 105 VGKEAVHQGLALETAPLLSPTLD-------AVRNSQLLMVLDHVNDPHNIGAILRSAVAF 157
                 HQG+  + A     +++              +++LD + DPHN+G+ILR+A   
Sbjct: 61  AEGI-QHQGIVAQVAAYEYASVEDILNKATQKGEDPFILILDEIEDPHNLGSILRTADCT 119

Query: 158 SCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSK 217
              G+I  KR S   +A ++K+++GA+E++P  R++NL   ++++   G    G   +  
Sbjct: 120 GVHGVIIPKRRSAGLTATVSKTSAGAVEYVPVARVTNLAQTIEQLKEKGIWVAGTDVNQA 179

Query: 218 KPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQ 277
           + + +      IAL++G E KG+    +E    +  L M G I +LN S AA V +Y   
Sbjct: 180 EDVYRSNFRMPIALVIGNENKGVGRLVKEKCDFLVKLPMHGQINSLNASVAAGVLMYEVA 239

Query: 278 NHFA 281
              +
Sbjct: 240 RQRS 243


>gi|218290034|ref|ZP_03494201.1| RNA methyltransferase, TrmH family, group 3 [Alicyclobacillus
           acidocaldarius LAA1]
 gi|218239868|gb|EED07056.1| RNA methyltransferase, TrmH family, group 3 [Alicyclobacillus
           acidocaldarius LAA1]
          Length = 255

 Score =  139 bits (351), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 74/255 (29%), Positives = 125/255 (49%), Gaps = 10/255 (3%)

Query: 33  MQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNAL-ARLDWDANLPHPF 91
           M+   ++     +     + G H V AAL +  R + ++   + A               
Sbjct: 5   MRDGARRRSAQGEEAVDLVKGRHAVLAALES-ERPVNKVWVAEGASGMDAIVAKARSRGV 63

Query: 92  PVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNS-----QLLMVLDHVNDPHN 146
            V+ VP   +D++    + HQG+  + AP     LD V         L++VLD + DPHN
Sbjct: 64  VVQFVPRSRLDEMA---SAHQGVIAQVAPYAYVDLDDVTRRDTGFSPLVVVLDEIADPHN 120

Query: 147 IGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWG 206
            GAILR+A A    G++  KR     + V+AK+A+GALE +P  R++N+  ALQ++   G
Sbjct: 121 FGAILRTAEAAGAQGVVIGKRRQAQVTDVVAKAAAGALEALPVARVANVAQALQRLKQAG 180

Query: 207 FQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVS 266
           +  +G   ++K P  +       A+++G+EG+G+R   +E    +  + + G +++LN S
Sbjct: 181 YWIVGADVEAKVPYTEVDYRGPTAVVIGSEGQGMRRWVREQCDFLVSIPILGRVQSLNAS 240

Query: 267 NAAAVALYITQNHFA 281
            AA V LY      A
Sbjct: 241 VAAGVLLYEAVRQRA 255


>gi|255066800|ref|ZP_05318655.1| RNA methyltransferase, TrmH family [Neisseria sicca ATCC 29256]
 gi|255048875|gb|EET44339.1| RNA methyltransferase, TrmH family [Neisseria sicca ATCC 29256]
          Length = 263

 Score =  139 bits (351), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 52/282 (18%), Positives = 87/282 (30%), Gaps = 24/282 (8%)

Query: 1   MNLISKKKSEKIFSLKDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAA 60
           M LI+  ++E++                  K +     +S+   +     L GVH +   
Sbjct: 4   MKLITSAQNEQL------------------KHLSKLLTQSKARREYGQTVLEGVHLLQVY 45

Query: 61  LNNPSRKIFQLLATKNALARLDWDANLPHPFP-VKTVPPQTIDKIVGKEAVHQGLALETA 119
           L          L           +         +  V  + + KI         +     
Sbjct: 46  LEAGYTPKQVYLPESKNTHPEIRNLISSLDEDGITWVGNEALSKITS-LNDADDVMTWIE 104

Query: 120 PLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKS 179
                 L    +    +VLD + DP N+G +LRSA A     I+         S  + ++
Sbjct: 105 IPPQGDLPLSGDC---VVLDRLQDPGNVGTVLRSAAASGIRQIVLGNDCVDIWSPKVLRA 161

Query: 180 ASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKG 239
             GA   +  I            +        L   +   L Q   N   A + G EG G
Sbjct: 162 GMGAHF-LLDIYSRVFLPHWLDAYQDKIWATALDGRNPSDLYQLDLNAPCAWVFGNEGSG 220

Query: 240 LRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHFA 281
           +  +  E       + M G  ++LNV+ AA V L+       
Sbjct: 221 VSREILEKVDGSVRIPMLGQTESLNVAMAATVCLFEQMRQRI 262


>gi|308389631|gb|ADO31951.1| RNA methyltransferase [Neisseria meningitidis alpha710]
          Length = 261

 Score =  139 bits (351), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 72/238 (30%), Positives = 112/238 (47%), Gaps = 9/238 (3%)

Query: 51  LYGVHTVSAALNNPSRKIFQLLATK---NALARLDWDANLPHPFPVKTVPPQTIDKIVGK 107
           +YG H V+A L    + I +L   +   +A  R   +        V  V    +D I  K
Sbjct: 18  IYGFHAVNARLWQNPKSIVELYIQEGKNDARTREVLEKAANENIRVYFVDTTRLDAIS-K 76

Query: 108 EAVHQGLALET-----APLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGI 162
            A HQG+A           L   L+ +    LL++LD + DPHN+GA LR+A A     +
Sbjct: 77  GARHQGVAGFIDASKNHVHLEDVLENLSEPPLLLILDGITDPHNLGACLRTANAMGVHAV 136

Query: 163 ITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQ 222
           I  K  S   +A ++K A GA E +PYI ++NL   L+++  +G   IG        L  
Sbjct: 137 IAPKDKSAGLNATVSKVACGAAETVPYITVTNLARTLRELKEYGIWIIGTDMGGDADLYH 196

Query: 223 EIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
               D  A ++G EG G+R  T+E    +  + M G ++++NVS +A + L  T+   
Sbjct: 197 CNLPDSTAWVMGNEGDGMRRLTREHCDMLVSIPMFGTVESMNVSVSAGMVLSETRRQR 254


>gi|261409276|ref|YP_003245517.1| tRNA/rRNA methyltransferase SpoU [Paenibacillus sp. Y412MC10]
 gi|261285739|gb|ACX67710.1| tRNA/rRNA methyltransferase (SpoU) [Paenibacillus sp. Y412MC10]
          Length = 266

 Score =  139 bits (351), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 52/259 (20%), Positives = 102/259 (39%), Gaps = 3/259 (1%)

Query: 23  LRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLL-ATKNALARL 81
           L   +   K      +K +H  +     + G+H V  AL++ +          K     L
Sbjct: 4   LSPQNARVKGWAQLQEK-KHRDKQNKYVVEGIHLVQEALSSGADIECVAYDVDKGIPQEL 62

Query: 82  DWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDHV 141
               +         V    I K+    +  Q  A+            +R + +++VLD +
Sbjct: 63  RHITDTGQGAEWIGVSHAVISKVSDTPSPQQVFAVIRKEARQWQDLILRENGMVVVLDGL 122

Query: 142 NDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQK 201
            DP N+G I+RSA A    G++  +  +   +    +S  G+L H+P +    L   L +
Sbjct: 123 QDPGNVGTIIRSADAVGAAGVVLGRGCADLYNPKTLRSTMGSLFHLPVLEGDLL-SILPE 181

Query: 202 MHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIK 261
               G + +    + ++   +        +++G+EG+G+ P+          + MPG  +
Sbjct: 182 ARERGARLVTTMLEGQRSCFEYDFKGTSWIVIGSEGRGVSPEVAALVDDAIRIPMPGRAE 241

Query: 262 ALNVSNAAAVALYITQNHF 280
           +LN + AA+V +Y      
Sbjct: 242 SLNAAMAASVLMYEALRQR 260


>gi|227112377|ref|ZP_03826033.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Pectobacterium
           carotovorum subsp. brasiliensis PBR1692]
          Length = 243

 Score =  139 bits (351), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 61/242 (25%), Positives = 102/242 (42%), Gaps = 8/242 (3%)

Query: 48  NLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDW---DANLPHPFPVKTVPPQTIDKI 104
           +  +YG+H V A L    ++  ++   K    R               ++    Q +DK 
Sbjct: 2   SEIIYGIHAVKALLERDPQRFLEVFVLKGRDDRRLQPVIAELEAQGIVIQVANRQWLDKQ 61

Query: 105 VGKEAVHQGLALETAPLLSPTLDAVRN-----SQLLMVLDHVNDPHNIGAILRSAVAFSC 159
                    +A           D         +  L++LD V DPHN+GA LR+A     
Sbjct: 62  ADDAVHQGIVAKVKEGRKYQENDLPAMLDNLETPFLLILDGVTDPHNLGACLRNADGAGV 121

Query: 160 DGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKP 219
             +I  +  S   +A + K A GA E +P I ++NL   ++ +       +G + ++   
Sbjct: 122 HAVIVPRDRSAQLNATVKKVACGAAETVPVISVTNLARTMRLLQERNIWIVGTAGEADHT 181

Query: 220 LEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNH 279
           L Q      +AL++GAEG+G+R  T+E    +  + M G + +LNVS A  V L+     
Sbjct: 182 LYQSKLTGPLALVMGAEGEGMRRLTREHCDELISIPMAGSVSSLNVSVATGVCLFEAVRQ 241

Query: 280 FA 281
            A
Sbjct: 242 RA 243


>gi|156932411|ref|YP_001436327.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Cronobacter sakazakii
           ATCC BAA-894]
 gi|156530665|gb|ABU75491.1| hypothetical protein ESA_00190 [Cronobacter sakazakii ATCC BAA-894]
          Length = 243

 Score =  139 bits (351), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 70/243 (28%), Positives = 109/243 (44%), Gaps = 10/243 (4%)

Query: 48  NLFLYGVHTVSAALNNPSRKIFQLLATKNALARLD---WDANLPHPFPVKTVPPQTIDKI 104
           +  +YG+H V A L     +  ++   K    +       A      PV+    Q +D+ 
Sbjct: 2   SEMIYGIHAVQALLERAPERFQEVFILKGREDKRLLPLIHALEAQGVPVQVANRQWLDEK 61

Query: 105 VGKEAVHQGLALETAPLLSP------TLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFS 158
               AVHQG+     P           L A      L++LD V DPHN+GA LRSA A  
Sbjct: 62  AD-GAVHQGIVARVKPGRQYGENDLPDLLAAHAQPFLLILDGVTDPHNLGACLRSADAAG 120

Query: 159 CDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKK 218
              +I  K  S   +A   K A GA E +P IR++NL   ++ +       +G + ++  
Sbjct: 121 VHAVIVPKDRSAQLNATAKKVACGAAESVPLIRVTNLARTMRLLQEENVWIVGTAGEADH 180

Query: 219 PLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQN 278
            L Q      +AL++GAEG+G+R  T+E    +  + M G + +LNVS A  + L+    
Sbjct: 181 TLYQSKMTGPLALVMGAEGEGMRRLTREHCDELISIPMAGSVSSLNVSVATGICLFEAVR 240

Query: 279 HFA 281
             +
Sbjct: 241 QRS 243


>gi|295110727|emb|CBL24680.1| rRNA methylases [Ruminococcus obeum A2-162]
          Length = 258

 Score =  139 bits (351), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 49/255 (19%), Positives = 97/255 (38%), Gaps = 4/255 (1%)

Query: 26  NHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDA 85
            +   K +   NQK++   +       G      A   P   I ++   ++ L       
Sbjct: 6   QNTQVKNVIKLNQKAKARREQGLFIAEGRKMFLEA---PDDWIEKVYVAESLLDDE-EIM 61

Query: 86  NLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDHVNDPH 145
                F    V      ++   +     L +   P         + + LLMVL+ + DP 
Sbjct: 62  QKAGRFSWDAVENSVFRQMSDTQTPQGVLTVLRQPSYQLEDLLKQEAPLLMVLEDLQDPG 121

Query: 146 NIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSW 205
           N G I+R+       G+  TK      +  + ++  G++  IP+  + ++    QK+ + 
Sbjct: 122 NAGTIIRTGEGAGIGGVFLTKTCVDITNPKVIRATMGSIYRIPFFYVEDVVLLKQKLQNC 181

Query: 206 GFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNV 265
           G +        K   ++E   +  A ++G EGKGL  +  + A  +  + M G +++LN 
Sbjct: 182 GIRFFAAHLQGKNAYDRESYQEGTAFLIGNEGKGLTDRAADAADCLIRIPMCGHVESLNA 241

Query: 266 SNAAAVALYITQNHF 280
           + A  + +Y      
Sbjct: 242 AMAGGILMYEAARQR 256


>gi|225075264|ref|ZP_03718463.1| hypothetical protein NEIFLAOT_00267 [Neisseria flavescens
           NRL30031/H210]
 gi|224953439|gb|EEG34648.1| hypothetical protein NEIFLAOT_00267 [Neisseria flavescens
           NRL30031/H210]
          Length = 263

 Score =  139 bits (351), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 51/282 (18%), Positives = 94/282 (33%), Gaps = 25/282 (8%)

Query: 1   MNLISKKKSEKIFSLKDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAA 60
           M LI+  ++E++                  K +     +++   +     L GVH + + 
Sbjct: 1   MKLITSAQNEQL------------------KHLFRLLTQAKARRESGETVLEGVHLLQSY 42

Query: 61  LNNPSRKIFQLLATKNALARLDWDA-NLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETA 119
           L +        L  K        +         +  V  + + KI    +    +     
Sbjct: 43  LQSGGTPKQVYLPEKKQQHPEIQEITAQLDEGLITWVGNEALSKITS-LSDADDVMTWID 101

Query: 120 PLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKS 179
                 L +  +    +VL+ V DP N G ILRSA A     I+         S  + ++
Sbjct: 102 IPKQAGLPSDGDC---VVLERVQDPGNAGTILRSAAAAGVRQIVCGNDSVDIWSPKVLRA 158

Query: 180 ASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKG 239
             GA   +       L+  ++      + T     +          +   A + G EG G
Sbjct: 159 GMGAHFLLSIFSRVELSAWMETYQHQIWATALGGRNIGLYEMD--LSQTCAWVFGNEGSG 216

Query: 240 LRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHFA 281
           +    +E A +   + M G  ++LNV+ AA V L+       
Sbjct: 217 VSETVKEKADACVKIPMLGQTESLNVAMAATVCLFEQMRQRI 258


>gi|22002552|gb|AAM82703.1| rRNA methylase-like protein [Synechococcus elongatus PCC 7942]
          Length = 258

 Score =  139 bits (351), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 50/257 (19%), Positives = 96/257 (37%), Gaps = 4/257 (1%)

Query: 24  RRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDW 83
            R +   K+++  +Q ++   Q     L G H +  A+      +         +   + 
Sbjct: 4   SRQNPLTKQIRQLHQ-AKGRRQMGAFLLEGTHLLQEAIATNWPLLQVCATPACRINTRNS 62

Query: 84  DANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDHVND 143
            +      P +TV    +  +           +      +        S L   ++ + D
Sbjct: 63  GSRAIQAAPEQTVSDDLLAYLCTTVNP---DGVVANRSTAAPASTAHFSLLADAVETLQD 119

Query: 144 PHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMH 203
           P N+G I+R+A A   DG+  T      +   + ++++G    +P    ++L   L+   
Sbjct: 120 PGNLGTIIRTAAAAGADGLWLTADGVDPDHPKVLRASAGQWFRLPIAIATDLGQTLRSWQ 179

Query: 204 SWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKAL 263
             G+Q +     +   L Q        L+LG EG GL P     A S   +     +++L
Sbjct: 180 QQGYQIVSTLPRATTTLWQADLTRPTVLLLGNEGAGLSPDLAAIADSAVTIPQAAGVESL 239

Query: 264 NVSNAAAVALYITQNHF 280
           NV+ AAA+ LY  +   
Sbjct: 240 NVAIAAALLLYEARRQR 256


>gi|209523883|ref|ZP_03272435.1| tRNA/rRNA methyltransferase (SpoU) [Arthrospira maxima CS-328]
 gi|209495555|gb|EDZ95858.1| tRNA/rRNA methyltransferase (SpoU) [Arthrospira maxima CS-328]
          Length = 259

 Score =  139 bits (350), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 54/255 (21%), Positives = 97/255 (38%), Gaps = 4/255 (1%)

Query: 26  NHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDA 85
            +   K+++  +  ++   +     L G H + AA       I  L  T     R     
Sbjct: 6   QNPLVKQIRQLHT-AKARREEGLFILEGTHLIEAACAVNWE-IITLCCTPQWQERHPELW 63

Query: 86  NLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDHVNDPH 145
            L      +    Q  D+++             A         V  + L +VL+ V DP 
Sbjct: 64  ELAAKTADR--TEQVSDRLIVAMTTTVNPDGVVAIARRQDQTPVPITSLGLVLETVQDPG 121

Query: 146 NIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSW 205
           N+G ++R+A A   +G+  +          + ++++GA   +P    S+L   L      
Sbjct: 122 NLGTMIRTATAAGVEGLWLSSDSVDPTHPKVLRASAGAWFEVPIAVHSDLITQLSNSQKQ 181

Query: 206 GFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNV 265
           G Q +   +D+     +       A++LG EG GL P     A     + + G +++LNV
Sbjct: 182 GIQVVATRADASLSYWEIDLRQPTAIVLGNEGSGLSPDLNSLADYHIRVPLLGNVESLNV 241

Query: 266 SNAAAVALYITQNHF 280
           +  AA+ LY  Q   
Sbjct: 242 AICAALILYEAQRQR 256


>gi|153815882|ref|ZP_01968550.1| hypothetical protein RUMTOR_02127 [Ruminococcus torques ATCC 27756]
 gi|317500638|ref|ZP_07958857.1| RNA methyltransferase [Lachnospiraceae bacterium 8_1_57FAA]
 gi|331089882|ref|ZP_08338775.1| hypothetical protein HMPREF1025_02358 [Lachnospiraceae bacterium
           3_1_46FAA]
 gi|145846701|gb|EDK23619.1| hypothetical protein RUMTOR_02127 [Ruminococcus torques ATCC 27756]
 gi|316897956|gb|EFV20008.1| RNA methyltransferase [Lachnospiraceae bacterium 8_1_57FAA]
 gi|330403579|gb|EGG83137.1| hypothetical protein HMPREF1025_02358 [Lachnospiraceae bacterium
           3_1_46FAA]
          Length = 261

 Score =  139 bits (350), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 53/255 (20%), Positives = 102/255 (40%), Gaps = 4/255 (1%)

Query: 26  NHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDA 85
           ++   K++    +KSR   +     + G          P  +I +L  +++  A+   + 
Sbjct: 6   SNIQVKELLRLQKKSREREKEGVFIVEGPRMAEEI---PRERIVKLYVSESFQAKCVKEK 62

Query: 86  NLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDHVNDPH 145
           N         V   T+   V      QG+      +     D +  +  ++VL+++ DP 
Sbjct: 63  N-DRFIQEAEVMSDTVFAHVSDTKTPQGILAVVRRMEYTAEDILGETPHVLVLENIQDPG 121

Query: 146 NIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSW 205
           N+G I R+A A    GI+ +K      +  + +S  GA+  IP+I   +L   + ++   
Sbjct: 122 NLGTIFRTAEAAGATGIVLSKDCVDLYNPKVIRSTMGAIFRIPFIYTDDLKGTIDELKRE 181

Query: 206 GFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNV 265
           G          +   + E      A ++G EG GL  +T   A     + M G  ++LN 
Sbjct: 182 GITVYAAHLKGENSYDMEDYKTACAFLIGNEGNGLTEETAACADRKILIPMEGGAESLNA 241

Query: 266 SNAAAVALYITQNHF 280
           + A+AV ++      
Sbjct: 242 AVASAVLMFEAGRQR 256


>gi|119474664|ref|ZP_01615017.1| RNA methyltransferase, TrmH family, group 3 [marine gamma
           proteobacterium HTCC2143]
 gi|119450867|gb|EAW32100.1| RNA methyltransferase, TrmH family, group 3 [marine gamma
           proteobacterium HTCC2143]
          Length = 247

 Score =  139 bits (350), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 76/243 (31%), Positives = 120/243 (49%), Gaps = 8/243 (3%)

Query: 46  PENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPH---PFPVKTVPPQTID 102
            E  +++G+H V A L   S +I +L   +    +   +  L         KTVP + +D
Sbjct: 2   SEEHWVFGIHAVEALLQGQSNRIEELWLQQGRNDKRINELQLHARQVGVKCKTVPREELD 61

Query: 103 KIV-----GKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAF 157
           K V     G  A  +         L   LD + +  LL++LD V DPHN+GA LR+A A 
Sbjct: 62  KQVDGRHQGVVAFTKPAQTLRDRDLKEMLDGLDHPPLLLILDGVTDPHNLGACLRTADAA 121

Query: 158 SCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSK 217
             D +I  K  S   +A + K A GA E +PYI+++NL   ++ +   G    G + +++
Sbjct: 122 GVDAVIAPKDSSAPLNATVRKVACGAAEVVPYIQVTNLARTMKDIQGRGIWITGTAGEAE 181

Query: 218 KPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQ 277
           + + Q      +AL++GAEGKG+R  T+E    + +L M G + +LNVS A  V L+   
Sbjct: 182 QSVYQANLTGPVALVMGAEGKGMRRLTRENCDYLINLPMAGSVSSLNVSVATGVCLFEAV 241

Query: 278 NHF 280
              
Sbjct: 242 RQR 244


>gi|253689806|ref|YP_003018996.1| RNA methyltransferase, TrmH family, group 3 [Pectobacterium
           carotovorum subsp. carotovorum PC1]
 gi|251756384|gb|ACT14460.1| RNA methyltransferase, TrmH family, group 3 [Pectobacterium
           carotovorum subsp. carotovorum PC1]
          Length = 243

 Score =  139 bits (350), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 61/242 (25%), Positives = 102/242 (42%), Gaps = 8/242 (3%)

Query: 48  NLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDW---DANLPHPFPVKTVPPQTIDKI 104
           +  +YG+H V A L    ++  ++   K    R               ++    Q +DK 
Sbjct: 2   SEIIYGIHAVKALLERDPQRFLEVFVLKGRDDRRLQPVIAELEAQGIVIQVANRQWLDKQ 61

Query: 105 VGKEAVHQGLALETAPLLSPTLD-----AVRNSQLLMVLDHVNDPHNIGAILRSAVAFSC 159
                    +A           D         +  L++LD V DPHN+GA LR+A     
Sbjct: 62  ADDAVHQGIVAKVKEGRKYQENDLPALLDNLETPFLLILDGVTDPHNLGACLRNADGAGV 121

Query: 160 DGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKP 219
             +I  +  S   +A + K A GA E +P I ++NL   ++ +       +G + ++   
Sbjct: 122 HAVIVPRDRSAQLNATVKKVACGAAETVPVISVTNLARTMRLLQERNIWIVGTAGEADHT 181

Query: 220 LEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNH 279
           L Q      +AL++GAEG+G+R  T+E    +  + M G + +LNVS A  V L+     
Sbjct: 182 LYQSKLTGPLALVMGAEGEGMRRLTREHCDELISIPMAGSVSSLNVSVATGVCLFEAVRQ 241

Query: 280 FA 281
            A
Sbjct: 242 RA 243


>gi|241758743|ref|ZP_04756856.1| RNA methyltransferase, TrmH family [Neisseria flavescens SK114]
 gi|241320951|gb|EER57164.1| RNA methyltransferase, TrmH family [Neisseria flavescens SK114]
          Length = 263

 Score =  139 bits (350), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 51/283 (18%), Positives = 94/283 (33%), Gaps = 27/283 (9%)

Query: 1   MNLISKKKSEKIFSLKDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAA 60
           M LI+  ++E++                  K +     +++   +     L GVH +   
Sbjct: 4   MKLITSAQNEQL------------------KHLFRLLTQAKARRESGETVLEGVHLLQTY 45

Query: 61  LNNPSRKIFQLLATKNALARLDWDANLPHPFP--VKTVPPQTIDKIVGKEAVHQGLALET 118
           L +      Q+   +     L+            +  V  + + KI         +    
Sbjct: 46  LQSGGTP-KQVYLPEKKQQHLEIQEITAQLDEGLITWVGNEALSKITS-LTDADDVMTWI 103

Query: 119 APLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAK 178
                  L +  +    +VL+ V DP N G ILRSA A     I+         S  + +
Sbjct: 104 DIPQQAGLPSDGDC---VVLERVQDPGNAGTILRSAAAAGIRQIVCGNDSVDIWSPKVLR 160

Query: 179 SASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGK 238
           +  GA   +       L+  ++      + T     +          +   A + G EG 
Sbjct: 161 AGMGAHFLLSIFNRVELSAWMETYQHQIWATALGGRNIGLYEMD--LSQSCAWVFGNEGS 218

Query: 239 GLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHFA 281
           G+    +E A +   + M G  ++LNV+ AA V L+       
Sbjct: 219 GVSETVKEKADACVKIPMLGQTESLNVAMAATVCLFEQMRQRI 261


>gi|22299511|ref|NP_682758.1| putative tRNA/rRNA methyltransferase [Thermosynechococcus elongatus
           BP-1]
 gi|22295694|dbj|BAC09520.1| tll1968 [Thermosynechococcus elongatus BP-1]
          Length = 259

 Score =  139 bits (350), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 50/280 (17%), Positives = 103/280 (36%), Gaps = 27/280 (9%)

Query: 3   LISKKKSEKIFSLKDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALN 62
           +I+ ++++ + S++  H+ K R                       +L L G H +  AL 
Sbjct: 2   IITSRQNQLVRSIRKLHHRKYR---------------------QGHLLLEGTHLIQEALA 40

Query: 63  NPSRKIFQLL--ATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAP 120
           +           A +   +   W   L        V  + +  +              A 
Sbjct: 41  SGYHLSVVCYTSAWQAKQSPTFWQRLLHRSDRAVEVSEEVLAALC----TTTTPDGVVAV 96

Query: 121 LLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSA 180
                L  +    L + L  + DP N+G I+R+A A   +G++ +          + +++
Sbjct: 97  ADYTPLPTLPLQSLGLCLVTLQDPGNLGTIIRTAAAVGVEGLLLSADCVDMTHPKVLRAS 156

Query: 181 SGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGL 240
           +G    +P   +++    L+   + G+Q +     +     Q        L++G EG+GL
Sbjct: 157 AGQWFRLPMQTVTDGLATLKTYQAQGWQIVVTRPTAPLIYWQADFCQPTLLVMGNEGQGL 216

Query: 241 RPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
            P  Q+ + +   +     +++LNV+ A AV LY      
Sbjct: 217 PPAYQDASFTALRIPQEPNVESLNVAIATAVLLYEVYRQR 256


>gi|227325971|ref|ZP_03829995.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Pectobacterium
           carotovorum subsp. carotovorum WPP14]
          Length = 243

 Score =  139 bits (350), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 62/242 (25%), Positives = 103/242 (42%), Gaps = 8/242 (3%)

Query: 48  NLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDW---DANLPHPFPVKTVPPQTIDKI 104
           +  +YG+H V A L    ++  ++   K    R           H   ++    Q +DK 
Sbjct: 2   SEIIYGIHAVKALLERDPQRFLEVFVLKGRDDRRLQPVIAELEAHGIVIQVANRQWLDKQ 61

Query: 105 VGKEAVHQGLALETAPLLSPTLDAVRN-----SQLLMVLDHVNDPHNIGAILRSAVAFSC 159
                    +A           D         +  L++LD V DPHN+GA LR+A     
Sbjct: 62  AEDAVHQGIVAKVKEGRKYQENDLPAMLDNLETPFLLILDGVTDPHNLGACLRNADGAGV 121

Query: 160 DGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKP 219
             +I  +  S   +A + K A GA E +P I ++NL   ++ +       +G + ++   
Sbjct: 122 HAVIVPRDRSAQLNATVKKVACGAAETVPVISVTNLARTMRLLQERNIWIVGTAGEADHT 181

Query: 220 LEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNH 279
           L Q      +AL++GAEG+G+R  T+E    +  + M G + +LNVS A  V L+     
Sbjct: 182 LYQSKLTGPLALVMGAEGEGMRRLTREHCDELISIPMAGSVSSLNVSVATGVCLFEAVRQ 241

Query: 280 FA 281
            A
Sbjct: 242 RA 243


>gi|159900340|ref|YP_001546587.1| tRNA/rRNA methyltransferase SpoU [Herpetosiphon aurantiacus ATCC
           23779]
 gi|159893379|gb|ABX06459.1| tRNA/rRNA methyltransferase (SpoU) [Herpetosiphon aurantiacus ATCC
           23779]
          Length = 261

 Score =  139 bits (349), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 47/261 (18%), Positives = 98/261 (37%), Gaps = 7/261 (2%)

Query: 24  RRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKN----ALA 79
            +++   K++++  Q+ R        F+ G+  V+ A+   +  I QL+   +      A
Sbjct: 4   SKHNPAIKQIRALRQR-REREATGLFFIEGIRNVTEAVQAQA-PIEQLIVAPDLLRSQFA 61

Query: 80  RLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLD 139
           +   +       P+  V  +    +  K+      A+      S            + L+
Sbjct: 62  QDLVEQQRQQAIPILEVSGEVFASLSSKDGPQGLAAVVRQQWASLADVRPDQGLCWIALN 121

Query: 140 HVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDAL 199
            ++DP N+G ILR+  A    G+I     +        +++ G L     +  +   +  
Sbjct: 122 AISDPGNLGTILRTGDAVGAAGVILLGDCTDPYDPATGRASMGTLF-SQRLVKATWAEFS 180

Query: 200 QKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGI 259
           Q     GF  +G +  +            + L++G+E +GL  + Q    ++  + M G 
Sbjct: 181 QWFGQSGFNLVGAADSASSHYRDYAYPQPLILLMGSEREGLDAEQQAQCQALVSIPMRGQ 240

Query: 260 IKALNVSNAAAVALYITQNHF 280
             +LN++ A  V LY      
Sbjct: 241 ADSLNLAVATGVLLYEILAQR 261


>gi|253681735|ref|ZP_04862532.1| rRNA methylase [Clostridium botulinum D str. 1873]
 gi|253561447|gb|EES90899.1| rRNA methylase [Clostridium botulinum D str. 1873]
          Length = 260

 Score =  139 bits (349), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 57/281 (20%), Positives = 106/281 (37%), Gaps = 26/281 (9%)

Query: 1   MNLISKKKSEKIFSLKDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAA 60
           MN I  K +  I  ++                      K ++ +Q     + G   V  A
Sbjct: 1   MNKIESKDNSLIKDIRKL-------------------SKKKYRTQEGKFLVEGFRFVQEA 41

Query: 61  LNNPSRKIFQLLATKNALARLDWDA--NLPHPFPVKTVPPQTIDKIVGKEAVHQGLALET 118
           L +     + L++  +      ++    +     V  V    + ++         LA+  
Sbjct: 42  LKSTFEVPYVLISENSNEKCESFNIYDLIQENTKVYLVRDDILKELCDTNNPQGILAVV- 100

Query: 119 APLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAK 178
               +  ++        +++D + DP N+G I+RSA A    G+ITTK      +    +
Sbjct: 101 ---NNKVMEIEDQKGFYVLVDRIQDPGNMGTIIRSANASGALGVITTKGTVDVYNDKTLR 157

Query: 179 SASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGK 238
           S  G++  IP I  +N    L+ + S GF+ +  S D++          K  + +G EG 
Sbjct: 158 STMGSIFKIPIIEDNNF-QILKILKSKGFKLVVSSLDTENNFYDIDLTGKSIICVGNEGN 216

Query: 239 GLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNH 279
           G+     E       + MPG  ++LN   AA++ +Y     
Sbjct: 217 GVSDYIYELGDEKVKIPMPGDAESLNAGVAASIMMYEVVRQ 257


>gi|325128109|gb|EGC51004.1| RNA methyltransferase, TrmH family, group 3 [Neisseria meningitidis
           N1568]
          Length = 250

 Score =  139 bits (349), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 72/238 (30%), Positives = 114/238 (47%), Gaps = 9/238 (3%)

Query: 51  LYGVHTVSAALNNPSRKIFQLLATK---NALARLDWDANLPHPFPVKTVPPQTIDKIVGK 107
           +YG H V+A L    + I +L   +   +A  R   +        V  V    +D I  K
Sbjct: 7   IYGFHAVNARLWQNPKSIVELYIQEGKSDARTREVLEKAANENIRVYFVDTTRLDAIS-K 65

Query: 108 EAVHQGLALET-----APLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGI 162
            A HQG+A           L   L+ +    LL++LD + DPHN+GA LR+A A     +
Sbjct: 66  GARHQGVAGFIDASKNHVHLEDVLENLSEPPLLLILDGITDPHNLGACLRTADAMGVHAV 125

Query: 163 ITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQ 222
           I+ K  S   +A ++K A GA E +PYI ++NL   L+++  +G   IG     +  L  
Sbjct: 126 ISPKDKSAGLNATVSKVACGAAETVPYITVTNLARTLRELKEYGIWIIGTDMGGESDLYH 185

Query: 223 EIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
               D  A ++G EG G+R  T+E    +  + M G ++++NVS +A + L  T+   
Sbjct: 186 CDLPDSAAWVMGNEGDGMRRLTREHCDMLVSIPMFGTVESMNVSVSAGMVLSETRRQR 243


>gi|167758621|ref|ZP_02430748.1| hypothetical protein CLOSCI_00961 [Clostridium scindens ATCC 35704]
 gi|167663817|gb|EDS07947.1| hypothetical protein CLOSCI_00961 [Clostridium scindens ATCC 35704]
          Length = 263

 Score =  139 bits (349), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 44/257 (17%), Positives = 99/257 (38%), Gaps = 6/257 (2%)

Query: 27  HRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDW--D 84
           +   K + +  +K +   +     + G+         P   + ++ A+++   +     D
Sbjct: 7   NAKVKHLANLKRKRKLRDEEGVFLVEGIRMFRE---TPKMLLKEVYASESFYKKERRMTD 63

Query: 85  ANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQ-LLMVLDHVND 143
             L        +   T+   V      QG+      L     +A       L+VL+ + D
Sbjct: 64  EALKGSGAYLEILSDTVFGYVSDTKTPQGILCVVKQLDYRLEEAAAGRAAHLIVLNRLQD 123

Query: 144 PHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMH 203
           P N+G ILR+A      GI+  +      +    +S  G++  +P+    +L   + ++ 
Sbjct: 124 PGNLGTILRTAEGAGVTGILLDQECVDIYNPKTIRSTMGSIYRMPFYYSQDLKKDIGRLK 183

Query: 204 SWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKAL 263
             G        + ++  ++       A ++G EG GL  +  + A +   + M G +++L
Sbjct: 184 DKGICIYAAHLNGRQDYDEADYTKPCAFLIGNEGNGLDEEIAQQADTYIKIPMKGRVESL 243

Query: 264 NVSNAAAVALYITQNHF 280
           N + A++V ++      
Sbjct: 244 NAAIASSVLMFEAARQR 260


>gi|326796398|ref|YP_004314218.1| RNA methyltransferase, TrmH family, group 3 [Marinomonas
           mediterranea MMB-1]
 gi|326547162|gb|ADZ92382.1| RNA methyltransferase, TrmH family, group 3 [Marinomonas
           mediterranea MMB-1]
          Length = 253

 Score =  139 bits (349), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 63/249 (25%), Positives = 112/249 (44%), Gaps = 13/249 (5%)

Query: 46  PENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDW---DANLPHPFPVKTVPPQTID 102
               ++YG+H V  AL     ++  +   +    +           +    + VP + +D
Sbjct: 2   SNLEWVYGIHAVENALTQQPERVKDVRFQEGRDDKKTQRLMQLCKKNGVRFQVVPRKVLD 61

Query: 103 KI---VGKEAVHQGLALETAPLLSPTL-------DAVRNSQLLMVLDHVNDPHNIGAILR 152
           ++     +  VHQG+  +     +          +A+  + L+++LD + DPHN+GA LR
Sbjct: 62  QLFAKSKERVVHQGVVAQATMTKAKDEAELHKHVEALEETPLIIILDGITDPHNLGACLR 121

Query: 153 SAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGL 212
           SA A     ++  K  S   +A ++K A GA E +P   ++NL   ++K+   G    G 
Sbjct: 122 SADAAGAHAVVMPKDKSAPLNATVSKVACGAAESMPVFAVTNLARTMKKLQDQGVWIFGT 181

Query: 213 SSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVA 272
           + ++   L         A+++GAEG G+R  T+E    +  L M G++ +LNVS A  V 
Sbjct: 182 AGEATDMLYDHDLTIPTAIVMGAEGDGMRRLTREQCDYLVKLPMAGVVSSLNVSVATGVC 241

Query: 273 LYITQNHFA 281
           LY       
Sbjct: 242 LYEAVRQRT 250


>gi|331086557|ref|ZP_08335635.1| RNA methyltransferase [Lachnospiraceae bacterium 9_1_43BFAA]
 gi|330410390|gb|EGG89822.1| RNA methyltransferase [Lachnospiraceae bacterium 9_1_43BFAA]
          Length = 262

 Score =  139 bits (349), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 54/257 (21%), Positives = 110/257 (42%), Gaps = 6/257 (2%)

Query: 26  NHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDA 85
           ++   K++    +KS+  ++     + GV         P  ++ ++  ++    +   + 
Sbjct: 6   SNARVKELVQLQKKSKVRNEQGVFLVEGVKMYQEI---PQEQLVKVYVSETFADKQKEEI 62

Query: 86  NLPHPF-PVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDA-VRNSQLLMVLDHVND 143
           N       ++ +      + V      QG+            D        L+VLD++ D
Sbjct: 63  NRLKDRRKLEYLSDHVF-QYVSDTKTPQGILCVVRQSAYCLEDILEAEDAHLLVLDNLQD 121

Query: 144 PHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMH 203
           P N+G ILR+A      GII +K      +  + +S  G++  +P++ + +L +A+ K+ 
Sbjct: 122 PGNLGTILRTAEGAGVTGIIISKESVDIYNPKVIRSTMGSIYRVPFVYVEDLKEAIAKVK 181

Query: 204 SWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKAL 263
           + G  T     D K   ++E    K A ++G EG GLR    + A +   + M G +++L
Sbjct: 182 AHGIFTYAAHLDGKNSYDKEDYTKKTAFLIGNEGNGLRKDIADLADTWIRIPMQGQVESL 241

Query: 264 NVSNAAAVALYITQNHF 280
           N + A +V ++ T    
Sbjct: 242 NAAIATSVLMFETARQR 258


>gi|329924982|ref|ZP_08279928.1| RNA methyltransferase, TrmH family [Paenibacillus sp. HGF5]
 gi|328940271|gb|EGG36601.1| RNA methyltransferase, TrmH family [Paenibacillus sp. HGF5]
          Length = 266

 Score =  139 bits (349), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 53/259 (20%), Positives = 102/259 (39%), Gaps = 3/259 (1%)

Query: 23  LRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLL-ATKNALARL 81
           L   +   K      +K +H  +     + G+H V  AL++ +          K     L
Sbjct: 4   LSPQNARAKGWAQLQEK-KHRDKQNKYVVEGIHLVQEALSSGADIECLAYDVDKGIPQEL 62

Query: 82  DWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDHV 141
               +         V    I K+    +  Q  A+            +R + L++VLD +
Sbjct: 63  RHITDTGQGAEWIGVSHAVISKVSDTPSPQQVFAVIRKEARQWQDLILRENGLVVVLDGL 122

Query: 142 NDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQK 201
            DP N+G I+RSA A    G++  +  +   +    +S  G+L H+P +    L   L +
Sbjct: 123 QDPGNVGTIIRSADAVGAAGVVLGRGCADLYNPKTLRSTMGSLFHLPVLEGDLL-SILPE 181

Query: 202 MHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIK 261
               G + +    + ++   +        +++G+EG+G+ P+          + MPG  +
Sbjct: 182 ARERGARLVTTMLEGQRSCFEYDFKGTSWIVIGSEGRGVSPEVAALVDDAIRIPMPGRAE 241

Query: 262 ALNVSNAAAVALYITQNHF 280
           +LN + AA+V +Y      
Sbjct: 242 SLNAAMAASVLMYEALRQR 260


>gi|163843517|ref|YP_001627921.1| RNA methyltransferase [Brucella suis ATCC 23445]
 gi|163674240|gb|ABY38351.1| RNA methyltransferase, TrmH family, group 3 [Brucella suis ATCC
           23445]
          Length = 286

 Score =  139 bits (349), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 139/288 (48%), Positives = 185/288 (64%), Gaps = 13/288 (4%)

Query: 1   MNLISKKKSEKIFSLKDSHYAKLRRNHRDYKKMQSFNQKSRHTS--------QPENLFLY 52
           M   +  ++ K     DSHYA+LRR H D K         +               + LY
Sbjct: 1   MTDQNSPRTPK-----DSHYARLRRQHHDQKAGAEGKSPRKPQRPAIAASAVAEGTVRLY 55

Query: 53  GVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQ 112
           G+HTV AA+ NP RKI ++ AT+N  ARL+       PFPV+ V P+ IDK  G EAVHQ
Sbjct: 56  GLHTVRAAVENPQRKILRMRATRNGFARLEIGEADSLPFPVEIVDPRDIDKETGSEAVHQ 115

Query: 113 GLALETAPLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSE 172
           G+ +E  PL +  L  +R S LL+VLD V DPHN+GAI+RSAVAF    +ITT R+SP E
Sbjct: 116 GVMIEAEPLRTRKLSELRESPLLLVLDQVTDPHNVGAIMRSAVAFGAGALITTSRHSPQE 175

Query: 173 SAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALI 232
           + VLAK+ASGALE I +I + NL +A++++H+ GFQTIGL S     +E  +  ++IAL+
Sbjct: 176 TGVLAKAASGALELIAHIEVRNLAEAIEELHTLGFQTIGLDSQGPLEMEATLSGNRIALV 235

Query: 233 LGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
           LGAEGKGLR KT+ET T++A L MPG IK+LNVSNAAA++LY  + + 
Sbjct: 236 LGAEGKGLRQKTRETVTALARLDMPGEIKSLNVSNAAAISLYAAERYL 283


>gi|226942911|ref|YP_002797984.1| RNA methyltransferase TrmH, group 3 [Azotobacter vinelandii DJ]
 gi|226717838|gb|ACO77009.1| RNA methyltransferase TrmH, group 3 [Azotobacter vinelandii DJ]
          Length = 247

 Score =  139 bits (349), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 75/245 (30%), Positives = 115/245 (46%), Gaps = 8/245 (3%)

Query: 46  PENLFLYGVHTVSAALNNPSRKIFQLLATKNAL-ARLDWDANLPHPFPVKTVPPQTIDKI 104
            +   +YGVH V A L +  R++ +L   +     R+     L     +     +  +  
Sbjct: 2   SDLERIYGVHAVEALLRHHPRRVKRLWLAEGRQDPRVQALLELARQARIAVGQRERRELD 61

Query: 105 VGKEAVHQGLALETAPLLSP-------TLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAF 157
              E VHQG+  E +P            LD      LL+VLD V DPHN+GA LR+A A 
Sbjct: 62  EWAEGVHQGVVAEVSPSQVWGEAMLDELLDRCEGPPLLLVLDGVTDPHNLGACLRTADAA 121

Query: 158 SCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSK 217
               +I  K  S + +A + K A GA E +P + ++NL   L+K+   G  T+G + + +
Sbjct: 122 GAQAVIVPKDKSATLNATVRKVACGAAEVVPLVAVTNLARTLEKLRQRGLWTVGTAGEVE 181

Query: 218 KPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQ 277
           + L          LI+GAEGKG+R  T+E    +  L M G + +LNVS A  V L+   
Sbjct: 182 QELYGVDLRGPTVLIMGAEGKGMRRLTREHCDYLVRLPMAGSVSSLNVSVATGVCLFEAV 241

Query: 278 NHFAK 282
              ++
Sbjct: 242 RQRSR 246


>gi|297583678|ref|YP_003699458.1| tRNA/rRNA methyltransferase SpoU [Bacillus selenitireducens MLS10]
 gi|297142135|gb|ADH98892.1| tRNA/rRNA methyltransferase (SpoU) [Bacillus selenitireducens
           MLS10]
          Length = 251

 Score =  139 bits (349), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 53/277 (19%), Positives = 107/277 (38%), Gaps = 28/277 (10%)

Query: 1   MNLISKKKSEKIFSLKDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAA 60
           M++I+  ++ +I + K  H                     +   +    F+ G H +  A
Sbjct: 1   MDVIASVQNPRIKAWKKLHTK-------------------KGRDKSGLFFIEGDHLIEEA 41

Query: 61  LNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAP 120
           + +    I +L+  +N      W+       PV  V    ++++   E            
Sbjct: 42  IRSAIT-IKELILEENQSLPEAWE---DPEVPVVWVTQPVLNELCETETPQG---FAAVC 94

Query: 121 LLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSA 180
              P ++   +    + +D V DP N+GA++R+A A    G++         +  + +S 
Sbjct: 95  EKPPLVNLPLDDGRFLFIDGVQDPGNLGAMIRTAEAAGITGVVIGDGTVDVYNGKVIRST 154

Query: 181 SGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGL 240
            G+L HIP  ++    +   ++       +  +S            D  ALI+G EG G+
Sbjct: 155 QGSLFHIPVQKMDL--EEAVEICKEANVPVFGTSLQGSTFNALEPQDTFALIMGNEGSGV 212

Query: 241 RPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQ 277
           R +  E      ++ + G  ++LNV+ A  + LY  +
Sbjct: 213 RARLLEMTDQNLYIPIYGKAESLNVAVACGIVLYHLR 249


>gi|302874885|ref|YP_003843518.1| tRNA/rRNA methyltransferase (SpoU) [Clostridium cellulovorans 743B]
 gi|307690498|ref|ZP_07632944.1| RNA methyltransferase, TrmH family [Clostridium cellulovorans 743B]
 gi|302577742|gb|ADL51754.1| tRNA/rRNA methyltransferase (SpoU) [Clostridium cellulovorans 743B]
          Length = 259

 Score =  138 bits (348), Expect = 7e-31,   Method: Composition-based stats.
 Identities = 52/265 (19%), Positives = 101/265 (38%), Gaps = 9/265 (3%)

Query: 20  YAKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALA 79
              L +++   K+ +   +K ++  +     + G   V  A+ + S  I  +   + AL 
Sbjct: 2   EKILSKDNNLIKETRKLKEK-KYRIEKGLFLVEGFRFVEEAVKS-SFIIKSIFIDEKALE 59

Query: 80  RLDWDANLPHPF--PVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMV 137
           +L             +  +P Q    I   E          A + +            + 
Sbjct: 60  KLSDYNIETERIHANIYIIPSQIFKTISTTETPQG----IIAVVENKEFAVKNEKGFYIY 115

Query: 138 LDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTD 197
            D V DP N+G I+R+A A    G+I ++      +    +S  G++  IP I   ++  
Sbjct: 116 ADKVQDPGNMGTIIRTAHASGALGVIYSQGTVDIYNEKTLRSTMGSIFRIPVILDKDMNK 175

Query: 198 ALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMP 257
             +   + GF+ I  S D+ K       +    + +G EG G+  +    +     + MP
Sbjct: 176 LKELK-AQGFKLIVSSLDTNKNFFDVDLSQMSIIAVGNEGNGVSDELYNLSDEKVKIPMP 234

Query: 258 GIIKALNVSNAAAVALYITQNHFAK 282
           G  ++LNV+ AA++  +       K
Sbjct: 235 GGAESLNVAVAASIMAFEAVRQTFK 259


>gi|237747635|ref|ZP_04578115.1| RNA methyltransferase [Oxalobacter formigenes OXCC13]
 gi|229378997|gb|EEO29088.1| RNA methyltransferase [Oxalobacter formigenes OXCC13]
          Length = 249

 Score =  138 bits (348), Expect = 7e-31,   Method: Composition-based stats.
 Identities = 63/239 (26%), Positives = 116/239 (48%), Gaps = 7/239 (2%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDA---NLPHPFPVKTVPPQTIDKIVG 106
            ++G H V++ L + +  + +L        R   D           +       +DK+VG
Sbjct: 5   VIFGFHAVTSRLRHEASSVEELYVDAERSDRRMQDLLKVAKAAGVRIIQADGARLDKMVG 64

Query: 107 KEAVHQGLALETAPLLSPTLDA----VRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGI 162
                  +A+     L+  LD     +  + LL+VLD + DPHN+GA LR A +     +
Sbjct: 65  TRRHQGVVAMAAPVSLARNLDELLDAIEGAPLLLVLDGITDPHNLGACLRVADSVGAHAV 124

Query: 163 ITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQ 222
           I  K  +   +A + K ASGA E +PYI ++NL   L+++       +G + D+++ L +
Sbjct: 125 IAPKDRAVGINATVQKVASGAAETVPYITVTNLARTLRQLQERDIWVVGTTDDAEESLYE 184

Query: 223 EIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHFA 281
              +  +A ++G+EG+G+R  T+E    +  + M G +++LN+S A+ + LY  +    
Sbjct: 185 PDYSGGVAFVMGSEGEGIRRLTRENCDQLVAIPMFGSVESLNISVASGICLYEARRQRI 243


>gi|169830404|ref|YP_001716386.1| RNA methyltransferase [Candidatus Desulforudis audaxviator MP104C]
 gi|169637248|gb|ACA58754.1| RNA methyltransferase, TrmH family, group 3 [Candidatus
           Desulforudis audaxviator MP104C]
          Length = 251

 Score =  138 bits (348), Expect = 7e-31,   Method: Composition-based stats.
 Identities = 65/243 (26%), Positives = 112/243 (46%), Gaps = 7/243 (2%)

Query: 43  TSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARL---DWDANLPHPFPVKTVPPQ 99
               +   +YG + V  AL    R + ++L  + A  RL     +   P   PV+ V   
Sbjct: 5   RDSEKQTVIYGRNPVREALR-GGRTLHKILVVRGADPRLFRELRELARPGRIPVQVVERP 63

Query: 100 TIDKIVGKEAVHQGLALETAPLLSPTLDA--VRNSQLLMVLDHVNDPHNIGAILRSAVAF 157
            +D++      HQG+A   +     T++      + L++VL+ + DP N+GAILR+A A 
Sbjct: 64  LLDRLTD-GGAHQGVAATVSVKDFATVEELLGTENPLIVVLNAIQDPRNLGAILRTAEAA 122

Query: 158 SCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSK 217
             DG +   R +   +   AK+A+GA+E++P  R++N+   L++    G   +G   D  
Sbjct: 123 GVDGAVVPSRRAAPLTPAAAKTAAGAVEYLPVARVTNIALTLREFKQKGLWVVGADPDGP 182

Query: 218 KPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQ 277
                      +AL++G E  GL    +    S+  + M G + +LN S AAA+ +Y   
Sbjct: 183 VSYWDADLGGPLALVIGGEAGGLGRAVRAECDSLVRIPMSGRVGSLNASVAAALLIYEAV 242

Query: 278 NHF 280
              
Sbjct: 243 RQR 245


>gi|146310028|ref|YP_001175102.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Enterobacter sp. 638]
 gi|145316904|gb|ABP59051.1| 23S rRNA Gm-2251 2'-O-methyltransferase [Enterobacter sp. 638]
          Length = 244

 Score =  138 bits (348), Expect = 7e-31,   Method: Composition-based stats.
 Identities = 60/243 (24%), Positives = 107/243 (44%), Gaps = 8/243 (3%)

Query: 48  NLFLYGVHTVSAALNNPSRKIFQLLATKNALARLD---WDANLPHPFPVKTVPPQTIDKI 104
           +  +YG+H V A L     +  ++   K    +       A       ++    Q +D+ 
Sbjct: 2   SEMIYGIHAVQALLERAPERFQEVFILKGREDKRLLPLIHALEAQGVVIQLASRQFLDEK 61

Query: 105 VGKEAVHQGLALETAPLLSP-----TLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSC 159
                    +A               L A  ++   ++LD V DPHN+GA LRSA A   
Sbjct: 62  SEGAVHQGIIARAKPGRQYQENDLPDLIAQLDNPFFLILDGVTDPHNLGACLRSADAAGV 121

Query: 160 DGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKP 219
             +I  +  +   +A   K A GA E++P IR++NL   ++++       +G + ++   
Sbjct: 122 HAVIVPRDRAAQLNATAKKVACGAAENVPLIRVTNLARTMRQLQEENIWIVGTAGEADHT 181

Query: 220 LEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNH 279
           + Q     ++AL++GAEG+G+R  T+E    +  + M G + +LNVS A  + L+     
Sbjct: 182 VYQSKMTGRLALVMGAEGEGMRRLTREHCDELISIPMAGSVSSLNVSVATGICLFEAVRQ 241

Query: 280 FAK 282
             K
Sbjct: 242 RTK 244


>gi|271501896|ref|YP_003334922.1| TrmA family RNA methyltransferase [Dickeya dadantii Ech586]
 gi|270345451|gb|ACZ78216.1| RNA methyltransferase, TrmH family, group 3 [Dickeya dadantii
           Ech586]
          Length = 244

 Score =  138 bits (348), Expect = 7e-31,   Method: Composition-based stats.
 Identities = 66/242 (27%), Positives = 103/242 (42%), Gaps = 8/242 (3%)

Query: 48  NLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANL---PHPFPVKTVPPQTIDKI 104
           +  +YG+H V A L    ++  ++   K    R               V+    Q +D  
Sbjct: 2   SEIIYGIHAVKALLEQDPQRFLEVFTLKGREDRRLQPLIAELEASGIAVQVASRQWLDDK 61

Query: 105 VGKEAVHQGLALETAPLLSPTLDAV-----RNSQLLMVLDHVNDPHNIGAILRSAVAFSC 159
           V        +A           D         +  L+VLD V DPHN+GA LRSA A   
Sbjct: 62  VEGAVHQGIIARVKEGRQYQENDLPGLLASHATPFLLVLDGVTDPHNLGACLRSADAAGV 121

Query: 160 DGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKP 219
             +I  +  S   +A   K A GA E +P IR++NL   L+ +       +G + ++   
Sbjct: 122 HAVIVPRDRSAQLNATAKKVACGAAETVPLIRVTNLARTLRFLQEQNIWIVGTAGEADHT 181

Query: 220 LEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNH 279
           L Q      +AL++GAEG+G+R  T+E    +  + M G + +LNVS A  + L+     
Sbjct: 182 LYQSKLTGPLALVMGAEGEGMRRLTREHCDELISIPMAGSVSSLNVSVATGICLFEAVRQ 241

Query: 280 FA 281
            A
Sbjct: 242 RA 243


>gi|119511316|ref|ZP_01630430.1| RNA methyltransferase TrmH, group 3 [Nodularia spumigena CCY9414]
 gi|119464022|gb|EAW44945.1| RNA methyltransferase TrmH, group 3 [Nodularia spumigena CCY9414]
          Length = 323

 Score =  138 bits (348), Expect = 7e-31,   Method: Composition-based stats.
 Identities = 71/287 (24%), Positives = 129/287 (44%), Gaps = 16/287 (5%)

Query: 5   SKKKSEKIFSLKDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNP 64
           S  +S ++        ++    HR    +     K       ++  +YG H V +AL   
Sbjct: 30  SSIRSPRVGERDKKPVSRGTSPHRIDPHVSPVASKPP----EDSDLIYGRHPVLSALE-G 84

Query: 65  SRKIFQLLA----TKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAP 120
            R + ++        +            +   +  V P+ +D+I    A HQG+A + AP
Sbjct: 85  ERGLNRIWITTRLRYDHRFHHLLLQAKENGTVIDEVEPKRLDQITD-RANHQGIAAQVAP 143

Query: 121 LLSPTLDA------VRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESA 174
                L             +++V + + DPHN+GAI+R+A A    G++  +R +   ++
Sbjct: 144 HDYMELSDLIAQAKSVTDPVIVVAEGITDPHNLGAIIRTAEAIGAQGLVIPQRRASGITS 203

Query: 175 VLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILG 234
            + K A+GALE+    R+ NL+ AL+++   GF   G ++   +PL     +  I L++G
Sbjct: 204 TVMKVAAGALENFSVARVVNLSRALEELKEAGFWIYGTATTGSEPLHTVKFSGPIVLVIG 263

Query: 235 AEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHFA 281
           +EG+GL   TQ +   +  + + G   +LN S AA +ALY      +
Sbjct: 264 SEGEGLSMLTQRSCDVLVSIPLLGKTPSLNASVAAGMALYEIYRQRS 310


>gi|292489612|ref|YP_003532502.1| putative tRNA/rRNA methyltransferase [Erwinia amylovora CFBP1430]
 gi|292898167|ref|YP_003537536.1| 23S_rRNA (guanosine-2'-O-)-methyltransferase [Erwinia amylovora
           ATCC 49946]
 gi|291198015|emb|CBJ45118.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Erwinia amylovora
           ATCC 49946]
 gi|291555049|emb|CBA23125.1| putative tRNA/rRNA methyltransferase [Erwinia amylovora CFBP1430]
 gi|312173789|emb|CBX82043.1| putative tRNA/rRNA methyltransferase [Erwinia amylovora ATCC
           BAA-2158]
          Length = 245

 Score =  138 bits (348), Expect = 7e-31,   Method: Composition-based stats.
 Identities = 71/243 (29%), Positives = 115/243 (47%), Gaps = 10/243 (4%)

Query: 48  NLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDW---DANLPHPFPVKTVPPQTIDKI 104
           +  ++G+H V A L++  ++  ++   K    R       A       ++    Q +D  
Sbjct: 2   SEIVFGIHAVQALLDSCPQRFQEVFILKGRDDRRLQTLVKALEAQGIVIQVANKQMLDN- 60

Query: 105 VGKEAVHQGLALETAPLLSP------TLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFS 158
             + AVHQG+     P           L A   +  L++LD V DPHN+GA +RSA A  
Sbjct: 61  TSEGAVHQGIIARVKPGRQYQEGDLPDLLASLENPFLLILDGVTDPHNLGACMRSADAAG 120

Query: 159 CDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKK 218
              +I  K  S + +A   K ASGA EHIP IR++NL   ++ +       +G + ++  
Sbjct: 121 VHAVIVPKDRSAALNATAKKVASGAAEHIPLIRVTNLARTMRVLQEANVWIVGTAGEADH 180

Query: 219 PLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQN 278
            L Q      +AL++GAEG+G+R  T+E    +  + M G + +LNVS A  V L+    
Sbjct: 181 TLHQSRMTGPMALVMGAEGEGMRRLTREHCDELISIPMAGSVSSLNVSVATGVCLFEAVR 240

Query: 279 HFA 281
             +
Sbjct: 241 QRS 243


>gi|220930680|ref|YP_002507589.1| RNA methyltransferase, TrmH family, group 3 [Clostridium
           cellulolyticum H10]
 gi|220001008|gb|ACL77609.1| RNA methyltransferase, TrmH family, group 3 [Clostridium
           cellulolyticum H10]
          Length = 315

 Score =  138 bits (348), Expect = 7e-31,   Method: Composition-based stats.
 Identities = 63/241 (26%), Positives = 110/241 (45%), Gaps = 10/241 (4%)

Query: 51  LYGVHTVSAALNNPS--RKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKE 108
           L G ++V  AL       K+F     K    R               V    +D +    
Sbjct: 76  LEGRNSVMEALKANRTINKLFIAKGEKEGSIRQIIALARQKGIITTEVDKIILDGMSTTR 135

Query: 109 AVHQGLALETAPLLSPTLDA-------VRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDG 161
           + HQG+    A      +D              +++LD ++DPHN GAILR+A A    G
Sbjct: 136 S-HQGVIAYVAVKDYVEVDDILAVAQENGEPPFIIILDEISDPHNFGAILRTANAVGAHG 194

Query: 162 IITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLE 221
           +I  KR +   ++ +AK+++GA+E++P  R++N++  ++ +       +G  S  +K   
Sbjct: 195 VIIPKRRAIGLTSTVAKASAGAVEYVPVSRVTNISQTIEYLKKNNVWVVGTDSTGEKAFY 254

Query: 222 QEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHFA 281
           +      IAL++G+EG+G+    +E    + ++ M G I +LN S AAA+ +Y       
Sbjct: 255 ESDLKGPIALVVGSEGEGMGKLVREKCDFVVNIPMQGEISSLNASVAAAIVMYEILKQRG 314

Query: 282 K 282
           K
Sbjct: 315 K 315


>gi|120435137|ref|YP_860823.1| TrmH family tRNA/rRNA methyltransferase [Gramella forsetii KT0803]
 gi|117577287|emb|CAL65756.1| TrmH family tRNA/rRNA methyltransferase [Gramella forsetii KT0803]
          Length = 273

 Score =  138 bits (348), Expect = 7e-31,   Method: Composition-based stats.
 Identities = 50/265 (18%), Positives = 103/265 (38%), Gaps = 5/265 (1%)

Query: 20  YAKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALA 79
                + +++ K +    +KSR+  +  +  + G   V+ AL      +      +    
Sbjct: 3   KKITSQQNKEIKWLLQLQEKSRNRRKENSFIVEGKREVNLALKGGYLPLHLYFVPELIDF 62

Query: 80  RLDWDANLPHP---FPVKTVPPQTIDKIVGKEAVHQGLALETAP-LLSPTLDAVRNSQLL 135
           +   +    +      +  +  +  DKI  + +    LA+          L       L+
Sbjct: 63  QEVLEMAKANEHEAAEITEINKEVYDKIAYRGSTEGLLAVFRNIEHPVENLSFEHPFPLI 122

Query: 136 MVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNL 195
           +V +    P NIGAILR+A A + D +I     +   +  + +S+ G+L        +  
Sbjct: 123 LVAEAPEKPGNIGAILRTADAAAVDAVIIANPKTDLYNPNIIRSSVGSLFTNKIATGTTS 182

Query: 196 TDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLH 255
            + +Q + +        +  + KP       +  A+I+G E  GL  +  E +T    + 
Sbjct: 183 -EIIQFLQAQKIHIYAAALQASKPYSDINFKEASAIIMGTEATGLSNEWLENSTQNIIIP 241

Query: 256 MPGIIKALNVSNAAAVALYITQNHF 280
           M G I ++NVS AA + ++  +   
Sbjct: 242 MHGKIDSMNVSVAAGILIFEAKRQR 266


>gi|259907185|ref|YP_002647541.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Erwinia pyrifoliae
           Ep1/96]
 gi|224962807|emb|CAX54265.1| 23S rRNA (Guanosine-2\'-O-)-methyltransferase [Erwinia pyrifoliae
           Ep1/96]
 gi|283476994|emb|CAY72886.1| putative tRNA/rRNA methyltransferase [Erwinia pyrifoliae DSM 12163]
 gi|310765324|gb|ADP10274.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Erwinia sp. Ejp617]
          Length = 245

 Score =  138 bits (348), Expect = 7e-31,   Method: Composition-based stats.
 Identities = 71/243 (29%), Positives = 116/243 (47%), Gaps = 10/243 (4%)

Query: 48  NLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDW---DANLPHPFPVKTVPPQTIDKI 104
           +  ++G+H V A L++  ++  ++   K    R       A       ++    Q +D  
Sbjct: 2   SEIVFGIHAVQALLDSDPQRFQEVFILKGREDRRLQTLVKALEAQGIVIQVANKQMLDN- 60

Query: 105 VGKEAVHQGLALETAPLLSP------TLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFS 158
             + AVHQG+     P           L A  ++  L++LD V DPHN+GA +RSA A  
Sbjct: 61  TSEGAVHQGIIARVKPGRQYQEGDLPDLLASLDNPFLLILDGVTDPHNLGACMRSADAAG 120

Query: 159 CDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKK 218
              II  K  S + +A   K ASGA EHIP +R++NL   ++ +       +G + ++  
Sbjct: 121 VHAIIVPKDRSAALNATAKKVASGAAEHIPLVRVTNLARTMRVLQEANVWIVGTAGEADH 180

Query: 219 PLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQN 278
            L Q      +AL++GAEG+G+R  T+E    +  + M G + +LNVS A  V L+    
Sbjct: 181 TLYQSKMTGPMALVMGAEGEGMRRLTREHCDELISIPMAGSVSSLNVSVATGVCLFEAVR 240

Query: 279 HFA 281
             +
Sbjct: 241 QRS 243


>gi|227510511|ref|ZP_03940560.1| RNA methyltransferase [Lactobacillus brevis subsp. gravesensis ATCC
           27305]
 gi|227513520|ref|ZP_03943569.1| RNA methyltransferase [Lactobacillus buchneri ATCC 11577]
 gi|227524663|ref|ZP_03954712.1| RNA methyltransferase [Lactobacillus hilgardii ATCC 8290]
 gi|227083393|gb|EEI18705.1| RNA methyltransferase [Lactobacillus buchneri ATCC 11577]
 gi|227088147|gb|EEI23459.1| RNA methyltransferase [Lactobacillus hilgardii ATCC 8290]
 gi|227190163|gb|EEI70230.1| RNA methyltransferase [Lactobacillus brevis subsp. gravesensis ATCC
           27305]
          Length = 255

 Score =  138 bits (348), Expect = 8e-31,   Method: Composition-based stats.
 Identities = 45/278 (16%), Positives = 95/278 (34%), Gaps = 23/278 (8%)

Query: 1   MNLISKKKSEKIFSLKDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAA 60
           M  I+  ++ ++   +                     Q  +         + G H V  A
Sbjct: 1   MQSITSNQNNRVKEWRK-------------------MQSKKGRLSSGQYIIEGWHIVDEA 41

Query: 61  LNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAP 120
           + +  +    ++   N L +L+ D  +        + P+    I   E   QG+      
Sbjct: 42  IKHDQQIDAVIVTDANFLDQLEVDPAV---TDTYLITPEVAKHISATE-TPQGVFAVLTT 97

Query: 121 LLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSA 180
                    +     ++LD++ DP NIG ++R+A A   +G+I  K  +   +  + +S 
Sbjct: 98  ENYHESIPEKLGGSWLMLDNIQDPGNIGTMVRTADAAGMNGVIFGKGTADIYNPKVVRSM 157

Query: 181 SGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGL 240
            G+  H+                          +D     +      + AL++G EG G+
Sbjct: 158 QGSQFHVRLYSGDLAVWMAAFNKHNVPVYGTELNDQAISYDDVEPTKQFALVMGNEGNGV 217

Query: 241 RPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQN 278
                +      ++ M G  ++LNV+ A  + ++    
Sbjct: 218 SADLLDKTDQNLYIPMNGEAESLNVAVATGILIFHFVK 255


>gi|255994721|ref|ZP_05427856.1| RNA methyltransferase, TrmH family [Eubacterium saphenum ATCC
           49989]
 gi|255993434|gb|EEU03523.1| RNA methyltransferase, TrmH family [Eubacterium saphenum ATCC
           49989]
          Length = 297

 Score =  138 bits (347), Expect = 8e-31,   Method: Composition-based stats.
 Identities = 62/286 (21%), Positives = 111/286 (38%), Gaps = 12/286 (4%)

Query: 5   SKKKSEKIFSLKDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNP 64
           SK +++     K  +  K   N+   K M++ N+ ++ T      F+YG + V  AL + 
Sbjct: 15  SKLRNDVTMEGKALNRKK---NNTSRKNMKNKNRDAKKTDLGNKFFVYGRNIVEEALIHS 71

Query: 65  SRKIFQLLA--TKNALARLDWDANLPHPFPVKTVPPQTIDKIV------GKEAVHQGLAL 116
           ++ I ++     K    +   D  +      + +    I + +      G  AV    A 
Sbjct: 72  AKYIEKIYFSSKKKKNQKGIEDLAISKGLRPEYIDDDEIAEFISENDAQGCIAVFNKFAY 131

Query: 117 ETAPLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVL 176
                     D      L++VLD + DP N+GAI+R+A      GII  K  +   +  +
Sbjct: 132 RDIDDALRLADIRGEKPLVLVLDRIEDPRNLGAIIRTARCAGVHGIIIAKDRAAGITPTV 191

Query: 177 AKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAE 236
           AK + GA+       +     A  K        +  +  +     ++     +AL+LG E
Sbjct: 192 AKVSEGAIF-SIPCIMVTNLAAALKDLKQRGFWVYAADANGDSCFEQEFGGSVALVLGNE 250

Query: 237 GKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHFAK 282
           GKG+       +     + M     +LNVS AA + +Y       +
Sbjct: 251 GKGISKLCLNESDYKVSIPMVNDFDSLNVSVAAGILMYEIVRKNNR 296


>gi|218438771|ref|YP_002377100.1| tRNA/rRNA methyltransferase (SpoU) [Cyanothece sp. PCC 7424]
 gi|218171499|gb|ACK70232.1| tRNA/rRNA methyltransferase (SpoU) [Cyanothece sp. PCC 7424]
          Length = 265

 Score =  138 bits (347), Expect = 8e-31,   Method: Composition-based stats.
 Identities = 50/255 (19%), Positives = 97/255 (38%), Gaps = 4/255 (1%)

Query: 26  NHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALN-NPSRKIFQLLATKNALARLDWD 84
            +   K+M+  + + +   +     + G H +  A + N S  +           +  W+
Sbjct: 6   QNPLIKQMRKLH-RPKGRREQNLFLIEGTHLLETACSVNSSLDVVCCTPQWQTNHKQLWE 64

Query: 85  ANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDHVNDP 144
                    + V P+ +  I         +A  T               L ++L+ + DP
Sbjct: 65  KAQSLAQRTEVVTPEVLAAIATTINPDGVVASATRIFEDSLAK--SPLSLGLMLERLQDP 122

Query: 145 HNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHS 204
            N+G I+R+AVA   D +  T      ++  + ++++G    +P     NL   ++    
Sbjct: 123 GNLGTIIRTAVATEVDQLWLTHDSVDLDNPKVLRASAGEWFRVPMRVSDNLGALIEGYKR 182

Query: 205 WGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALN 264
              Q IG      K   +        ++LG EG GL P+          + + G +++LN
Sbjct: 183 QQVQVIGTLPQGNKTYWEIDFTRPTLILLGNEGAGLTPELVSLVDQQVTIPLGGGVESLN 242

Query: 265 VSNAAAVALYITQNH 279
           V+ AAA+ LY  +  
Sbjct: 243 VAIAAALLLYEAKRQ 257


>gi|23014094|ref|ZP_00053931.1| COG0566: rRNA methylases [Magnetospirillum magnetotacticum MS-1]
          Length = 267

 Score =  138 bits (347), Expect = 8e-31,   Method: Composition-based stats.
 Identities = 103/235 (43%), Positives = 148/235 (62%), Gaps = 11/235 (4%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEA 109
           +LYG+H VSAAL NP R+I +L+AT  A   L          PV+T+    ID+++   +
Sbjct: 36  WLYGIHAVSAALANPERRIRRLVATTEAAKSLP-----ATKIPVETMERAEIDRLLAPGS 90

Query: 110 VHQGLALETAPLLSPTLDAVRNSQ------LLMVLDHVNDPHNIGAILRSAVAFSCDGII 163
           VHQG+AL   PL + T++ +          L++VLD V DPHN+GAILRSA AF    ++
Sbjct: 91  VHQGIALLVEPLPAITMEDIIRMADSASSALVLVLDQVTDPHNVGAILRSAAAFGALAVV 150

Query: 164 TTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQE 223
              R++P E+  LAKSASGALE +P +R++N+  AL+ M   GF T GL++D+ K L + 
Sbjct: 151 APDRHAPDETGTLAKSASGALERMPLVRVTNVVRALEDMKKGGFWTAGLAADAPKTLAEA 210

Query: 224 IKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQN 278
             + K+ L+LGAEG+G+R  T+E    +  L M G +++LNVSNAAAVALY  + 
Sbjct: 211 ELSGKVVLVLGAEGEGMRRLTREHCDHLVRLPMCGEMESLNVSNAAAVALYEIRR 265


>gi|172035318|ref|YP_001801819.1| tRNA/rRNA methyltransferase [Cyanothece sp. ATCC 51142]
 gi|171696772|gb|ACB49753.1| tRNA/rRNA methyltransferase [Cyanothece sp. ATCC 51142]
          Length = 262

 Score =  138 bits (347), Expect = 8e-31,   Method: Composition-based stats.
 Identities = 49/255 (19%), Positives = 106/255 (41%), Gaps = 4/255 (1%)

Query: 26  NHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKN-ALARLDWD 84
            +   K+++  + +++   +   L L G H V  A       I      +  A     W+
Sbjct: 6   RNPLIKQIRKLH-RTKGRREHNLLLLEGTHLVETAYKENCSLITLCYTEEWQARYPQLWE 64

Query: 85  ANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDHVNDP 144
           +        + V    +  +     V+    + TA     T + + + +L ++++ + DP
Sbjct: 65  SVSKRVKRSELVSADVLASMT--TTVNPDGVVATARFQPRTEEEITDFRLGLIIERLQDP 122

Query: 145 HNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHS 204
            N+G I+R+A A   D I  +      ++  + ++++GA   +P    S+LT  ++K  +
Sbjct: 123 GNLGTIIRTAAAVEIDAIWLSDDSVEIDNPKVLRASAGAWFQVPIFVTSDLTTVIKKHKN 182

Query: 205 WGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALN 264
            G   +    ++ +   Q        ++LG EG GL       A  +  + +   +++LN
Sbjct: 183 HGVNIVATLPNATETYWQLQFTQPTLILLGNEGSGLSNSLIALADELVSIPLSQGVESLN 242

Query: 265 VSNAAAVALYITQNH 279
           V+ A A+ LY  +  
Sbjct: 243 VAIATALLLYEAKRQ 257


>gi|323705643|ref|ZP_08117217.1| RNA methyltransferase, TrmH family, group 3 [Thermoanaerobacterium
           xylanolyticum LX-11]
 gi|323535120|gb|EGB24897.1| RNA methyltransferase, TrmH family, group 3 [Thermoanaerobacterium
           xylanolyticum LX-11]
          Length = 248

 Score =  138 bits (347), Expect = 8e-31,   Method: Composition-based stats.
 Identities = 62/246 (25%), Positives = 120/246 (48%), Gaps = 11/246 (4%)

Query: 45  QPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDA--NLPHPFPVKTVPPQTID 102
           +     +YG + V  A+N+  R+I ++  +K+A   +             V T    T+D
Sbjct: 2   KENENIIYGRNPVLEAINSG-REIEKIYVSKSAKGNISKIIKSARDKNIIVSTADNVTLD 60

Query: 103 KIVGKEAVHQGLALETAPLLSPTLDAVRNS-------QLLMVLDHVNDPHNIGAILRSAV 155
           K+ G    HQG+    +      ++ +            +++LD + D HN GAI+R+A 
Sbjct: 61  KMSG-NGNHQGVVALCSLYKYCDVEDILEYANEKGEKPFILLLDGITDTHNFGAIIRTAE 119

Query: 156 AFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSD 215
           AFS  GI+  KR S   ++ + K+++GA E++   ++SN+ +A+  +   G   +G S D
Sbjct: 120 AFSAHGIVIPKRRSAVVNSTVVKTSAGATEYMKIAKVSNINNAINNLKKQGVWIVGSSVD 179

Query: 216 SKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYI 275
           +K+       +  IA+++G+EG+G+    ++    +  + M G + +LN S AA++ +Y 
Sbjct: 180 AKEDFSNVDYDQPIAIVIGSEGEGISELVKKNCDYLVKIPMMGNMNSLNASVAASIFMYE 239

Query: 276 TQNHFA 281
                 
Sbjct: 240 VVRQRI 245


>gi|317493577|ref|ZP_07951998.1| RNA methyltransferase [Enterobacteriaceae bacterium 9_2_54FAA]
 gi|316918520|gb|EFV39858.1| RNA methyltransferase [Enterobacteriaceae bacterium 9_2_54FAA]
          Length = 244

 Score =  138 bits (347), Expect = 9e-31,   Method: Composition-based stats.
 Identities = 64/242 (26%), Positives = 105/242 (43%), Gaps = 9/242 (3%)

Query: 48  NLFLYGVHTVSAALNNPSRKIFQLLATKNALARLD--WDANLPH-PFPVKTVPPQTIDKI 104
           +  +YG+H V A L    ++  ++   K    R      A L      ++    Q +D+ 
Sbjct: 2   SEMIYGIHAVQALLERDPQRFLEVFVMKGREDRRLMPLIAELEQMGIVIQVANRQWLDEK 61

Query: 105 VGKEAVHQGLALETAPLLSPT------LDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFS 158
           V        +A                L+ +     L++LD V DPHN+GA LRSA A  
Sbjct: 62  VEGAVHQGIIARVREGRQYQENDLPALLENLDKPPFLLILDGVTDPHNLGACLRSADAAG 121

Query: 159 CDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKK 218
              +I  +  S   +A   K A GA E +P IR++NL   ++ +       +G + ++  
Sbjct: 122 VHAVIVPRDRSAQLNATAKKVACGAAETVPLIRVTNLARTMRFLQEQNIWIVGTAGEADH 181

Query: 219 PLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQN 278
            L Q      +AL++GAEG G+R  T+E    +  + M G + +LNVS A  + L+    
Sbjct: 182 NLYQSKMTGPMALVMGAEGDGMRRLTREHCDELISIPMAGSVSSLNVSVATGICLFEAVR 241

Query: 279 HF 280
             
Sbjct: 242 QR 243


>gi|256821782|ref|YP_003145745.1| TrmH family RNA methyltransferase [Kangiella koreensis DSM 16069]
 gi|256795321|gb|ACV25977.1| RNA methyltransferase, TrmH family, group 3 [Kangiella koreensis
           DSM 16069]
          Length = 246

 Score =  138 bits (347), Expect = 9e-31,   Method: Composition-based stats.
 Identities = 60/245 (24%), Positives = 111/245 (45%), Gaps = 10/245 (4%)

Query: 48  NLFLYGVHTVSAALNNPSRKIFQLLAT---KNALARLDWDANLPHPFPVKTVPPQTIDKI 104
           +  +YG+H V   L   S ++ +L       +  +             +     Q +D++
Sbjct: 2   SELVYGLHAVEVLLKRSSDRVERLYIQSNRHDQRSHKVVKLAQDKNIEIIQKERQELDEM 61

Query: 105 VGKEAV-------HQGLALETAPLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAF 157
             +           +         +   L  +  +  +++LD V DPHN+GA LRSA A 
Sbjct: 62  TDQRHQGVIAVCRPEKKKSFHEKHIPELLSQIDEAPFILILDGVTDPHNLGACLRSADAA 121

Query: 158 SCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSK 217
               +I  K  + S + V+ K A GA E +P+I ++NL  A++++   G    G + +++
Sbjct: 122 GVHMVIAPKDNAASITDVVRKVACGAAETVPFIPVTNLVRAMKQLQEAGVWIAGTAGEAE 181

Query: 218 KPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQ 277
           + + Q      +A+++GAEG+G+R  T+E    +  + M G + +LNVS A  V L+   
Sbjct: 182 QDIYQANLKGPLAIVMGAEGEGMRRLTRENCDYLIKIPMAGEVSSLNVSVATGVTLFEAV 241

Query: 278 NHFAK 282
               K
Sbjct: 242 RQRIK 246


>gi|227530492|ref|ZP_03960541.1| RNA methyltransferase [Lactobacillus vaginalis ATCC 49540]
 gi|227349597|gb|EEJ39888.1| RNA methyltransferase [Lactobacillus vaginalis ATCC 49540]
          Length = 258

 Score =  138 bits (347), Expect = 9e-31,   Method: Composition-based stats.
 Identities = 56/271 (20%), Positives = 101/271 (37%), Gaps = 14/271 (5%)

Query: 10  EKIFSLKDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIF 69
           EK+ S+ + H           K  +    K ++  Q     L G H V+ A+ +  + I 
Sbjct: 2   EKLTSIHNQH----------VKNWKKLQTK-KYRRQTGTYLLDGWHLVNEAVQSGVQ-IL 49

Query: 70  QLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAV 129
           QL+ T   LA      +L +   V  V  + +  I          A+   P      D  
Sbjct: 50  QLIGTSEQLAAHSDLNSLTN--EVYEVTEEVMQHITDTVTPQGIAAVVPLPDAHKVPDME 107

Query: 130 RNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPY 189
                 + LD V DP N+G ++R+A A    G++ + R +   S  + +S  G+  H+  
Sbjct: 108 SLHGGWLFLDRVQDPGNVGTMVRTADAAGFAGVVVSHRSADIFSPKVIRSMQGSQFHLKL 167

Query: 190 IRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETAT 249
                                   +   K           ALI+G EG+G+  +     T
Sbjct: 168 YEGDLAKWIEDFKTVNAPIYGTQLNPQAKSFRDAEPGKTFALIMGNEGQGMSDQLLSQTT 227

Query: 250 SMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
           +  ++ M G  ++LNV+ +A + ++    + 
Sbjct: 228 ANLYIPMRGQAESLNVAVSAGILMFQLNKNL 258


>gi|322831164|ref|YP_004211191.1| RNA methyltransferase, TrmH family, group 3 [Rahnella sp. Y9602]
 gi|321166365|gb|ADW72064.1| RNA methyltransferase, TrmH family, group 3 [Rahnella sp. Y9602]
          Length = 271

 Score =  138 bits (347), Expect = 9e-31,   Method: Composition-based stats.
 Identities = 64/241 (26%), Positives = 108/241 (44%), Gaps = 8/241 (3%)

Query: 48  NLFLYGVHTVSAALNNPSRKIFQLLATK---NALARLDWDANLPHPFPVKTVPPQTIDKI 104
           +  +YG+H+V A L+N  ++  ++   K   +   +   D        ++    Q +D+ 
Sbjct: 26  SEIIYGIHSVKALLDNDPQRFLEVFILKGRDDKRLKPLIDELEASGIVIQVASRQWLDEK 85

Query: 105 VGKEAVHQGLALETAPLLSPTLDAVR-----NSQLLMVLDHVNDPHNIGAILRSAVAFSC 159
                    +A           D        +   L+VLD V DPHN+GA LR+A A   
Sbjct: 86  SEGAVHQGIIARVREGRQYQENDLPALLESLDCPFLLVLDGVTDPHNLGACLRTADAAGV 145

Query: 160 DGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKP 219
             +I  +  S   +A   K ASGA E++P I ++NL   L+ +       +G + ++   
Sbjct: 146 HAVIVPRDRSAKLNATAKKVASGAAENVPLINVTNLARTLRVLQEHNVWIVGTAGEADHD 205

Query: 220 LEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNH 279
           L Q      +AL++GAEG+G+R  T+E    +  + M G + +LNVS A  V L+     
Sbjct: 206 LFQSKMTGPMALVMGAEGEGMRRLTREHCDELISIPMAGSVSSLNVSVATGVCLFEAVRQ 265

Query: 280 F 280
            
Sbjct: 266 R 266


>gi|261345208|ref|ZP_05972852.1| RNA methyltransferase, TrmH family, group 3 [Providencia
           rustigianii DSM 4541]
 gi|282566901|gb|EFB72436.1| RNA methyltransferase, TrmH family, group 3 [Providencia
           rustigianii DSM 4541]
          Length = 245

 Score =  138 bits (347), Expect = 9e-31,   Method: Composition-based stats.
 Identities = 76/243 (31%), Positives = 113/243 (46%), Gaps = 10/243 (4%)

Query: 48  NLFLYGVHTVSAALNNPSRKIFQLLATKNALARL---DWDANLPHPFPVKTVPPQTIDKI 104
           +  +YG+H V A L N  ++I ++   K    R               V+    Q +D  
Sbjct: 2   SEIIYGIHAVKALLENSPQRIKEVYILKGREDRRLMPIVHEIEAQGIVVQVANRQWMDAQ 61

Query: 105 VGKEAVHQGLALETAPLLSP------TLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFS 158
             + AVHQG+     P           L     S  L+VLD V DPHN+GA LRSA A  
Sbjct: 62  T-EGAVHQGIIANVLPGKQYQEGDLPDLLESTESPFLLVLDGVTDPHNLGACLRSADAAG 120

Query: 159 CDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKK 218
              +I  K  S   +A + K A GA E+IP IR++NL   L+ +  +    +G + ++  
Sbjct: 121 VHAVIVPKDKSAQLNATVKKVACGAAENIPLIRVTNLARTLRLLQEYNVWIVGTAGEADH 180

Query: 219 PLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQN 278
            L Q   +  IAL++GAEG+G+R  T+E    +  + M G + +LNVS A  V L+    
Sbjct: 181 TLYQSKLSGSIALVMGAEGEGMRRLTREHCDELISIPMAGSVSSLNVSVATGVCLFEAVR 240

Query: 279 HFA 281
              
Sbjct: 241 QRT 243


>gi|188535077|ref|YP_001908874.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Erwinia tasmaniensis
           Et1/99]
 gi|188030119|emb|CAO98005.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Erwinia tasmaniensis
           Et1/99]
          Length = 245

 Score =  138 bits (347), Expect = 9e-31,   Method: Composition-based stats.
 Identities = 71/242 (29%), Positives = 114/242 (47%), Gaps = 10/242 (4%)

Query: 48  NLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDW---DANLPHPFPVKTVPPQTIDKI 104
           +  ++G+H V A L++  ++  ++   K    R       A       ++    Q +D  
Sbjct: 2   SEIVFGIHAVQALLDSDPQRFQEVFILKGREDRRLQTLVKALEAQGIVIQVANKQMLDN- 60

Query: 105 VGKEAVHQGLALETAPLLSP------TLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFS 158
             + AVHQG+     P           L    ++  L++LD V DPHN+GA +RSA A  
Sbjct: 61  TSEGAVHQGIIARVKPGRQYQEGDLPDLLNSLDNPFLLILDGVTDPHNLGACMRSADAAG 120

Query: 159 CDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKK 218
              II  K  S + +A   K ASGA EHIP IR++NL   ++ +       +G + ++  
Sbjct: 121 VHAIIVPKDRSAALNATAKKVASGAAEHIPLIRVTNLARTMRVLQEANVWIVGTAGEADH 180

Query: 219 PLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQN 278
            L Q      +AL++GAEG+G+R  T+E    +  + M G + +LNVS A  V L+    
Sbjct: 181 TLYQSKMTGPMALVMGAEGEGMRRLTREHCDELISIPMAGSVSSLNVSVATGVCLFEAVR 240

Query: 279 HF 280
             
Sbjct: 241 QR 242


>gi|153007507|ref|YP_001368722.1| tRNA/rRNA methyltransferase SpoU [Ochrobactrum anthropi ATCC 49188]
 gi|151559395|gb|ABS12893.1| tRNA/rRNA methyltransferase (SpoU) [Ochrobactrum anthropi ATCC
           49188]
          Length = 294

 Score =  138 bits (347), Expect = 9e-31,   Method: Composition-based stats.
 Identities = 46/255 (18%), Positives = 90/255 (35%), Gaps = 4/255 (1%)

Query: 27  HRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDAN 86
           +   K ++S   K +   Q       G+  V  AL    R    + A      ++     
Sbjct: 30  NPIVKDLRSLALK-KFRDQQGVFLAEGLKLVIDALEQDWRIKTLVFAKSGKGNKMVEQVA 88

Query: 87  L---PHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDHVND 143
                    V  V  + +  I  ++     + +             +N+ + + LD V D
Sbjct: 89  ARTFAKGGLVLEVTEKIMAAITRRDNPQMVVGVFEQQYRPLANLKPKNNDVYIALDRVRD 148

Query: 144 PHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMH 203
           P N+G ++R+A A    GII     +   S    ++  G++  +P  +++       +  
Sbjct: 149 PGNLGTVIRTADAVGAKGIILIGDTTDPYSLETVRATMGSVFSMPLYKVTEADFLNWRKD 208

Query: 204 SWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKAL 263
             G         +         N  + L++G E +GL     +T   +A +   G   +L
Sbjct: 209 ISGLVVGTHLKGAVDYRTIPYANKPVVLMMGNEQQGLPDSLADTCDKLARIPQAGRADSL 268

Query: 264 NVSNAAAVALYITQN 278
           N++ A  V LY  + 
Sbjct: 269 NLAIATGVMLYEIRR 283


>gi|222529198|ref|YP_002573080.1| tRNA/rRNA methyltransferase (SpoU) [Caldicellulosiruptor bescii DSM
           6725]
 gi|222456045|gb|ACM60307.1| tRNA/rRNA methyltransferase (SpoU) [Caldicellulosiruptor bescii DSM
           6725]
          Length = 270

 Score =  138 bits (347), Expect = 9e-31,   Method: Composition-based stats.
 Identities = 51/284 (17%), Positives = 116/284 (40%), Gaps = 26/284 (9%)

Query: 2   NLISKKKSEKIFSLKDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAAL 61
             IS +++E I  +K  H                     ++  +  +  + G+  V  A+
Sbjct: 7   EFISSRENECIKRVKKLHDK-------------------KYREEFRSFIIEGLKLVKEAI 47

Query: 62  NNPSRKIFQLLATKNALARLDWD----ANLPHPFPVKTV--PPQTIDKIVGKEAVHQGLA 115
                 I  ++ ++ A  R          L     +K V   P  + + +   +  QG+ 
Sbjct: 48  EYQIECINLVIFSQQAKDRYQEFYWECKRLLQDGKIKRVIEIPDKLFEYITTTSTPQGIL 107

Query: 116 LETAPLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAV 175
            E   +    ++ ++N + ++V + + DP N+G ++R A AF  D ++TTK      +  
Sbjct: 108 AECNFVDK-DINFIKNLRRVVVANKLQDPGNLGTLIRCADAFGFDAVVTTKGTVDIYNPK 166

Query: 176 LAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGA 235
             ++  G+L H+  +R +     ++ +    F     +      + + + + +  +++G 
Sbjct: 167 TTRATMGSLFHLQIMREAEEGKLIKILKDNSFAVYVATPYGDIEISKIVPDKRFCIVIGN 226

Query: 236 EGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNH 279
           E +G+     + AT    + M G  ++LN + AA++ LY  +  
Sbjct: 227 ESEGVSDSFAKVATRKIKIPMVGETESLNAAVAASIVLYELRKR 270


>gi|157368686|ref|YP_001476675.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Serratia
           proteamaculans 568]
 gi|157320450|gb|ABV39547.1| RNA methyltransferase, TrmH family, group 3 [Serratia
           proteamaculans 568]
          Length = 243

 Score =  138 bits (347), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 65/242 (26%), Positives = 108/242 (44%), Gaps = 8/242 (3%)

Query: 48  NLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANL---PHPFPVKTVPPQTIDKI 104
           +  +YG+H V A L+N  ++  ++   K    R               ++    Q +D+ 
Sbjct: 2   SEIIYGIHAVKALLDNDPQRFLEVFILKGRDDRRLQPLIAELEATGIVIQVANRQWLDEK 61

Query: 105 VGKEAVHQGLALETAPLLSPTLDAVR-----NSQLLMVLDHVNDPHNIGAILRSAVAFSC 159
           V        +A           D        ++  L+VLD V DPHN+GA LRSA A   
Sbjct: 62  VEGAVHQGIIARVREGRQYQENDLPALLESVDTPFLLVLDGVTDPHNLGACLRSADAAGV 121

Query: 160 DGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKP 219
             +I  +  S   +A   K A GA E++P IR++NL   L+ +       +G + ++   
Sbjct: 122 HAVIVPRDRSAQLNATAKKVACGAAENVPLIRVTNLARTLRLLQEMNVWVVGTAGEADHT 181

Query: 220 LEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNH 279
           L Q      +AL++GAEG+G+R  T+E    +  + M G + +LNVS A  + L+     
Sbjct: 182 LFQSKMTGPMALVMGAEGEGMRRLTREHCDELISIPMAGTVSSLNVSVATGICLFEAVRQ 241

Query: 280 FA 281
            +
Sbjct: 242 RS 243


>gi|297538456|ref|YP_003674225.1| TrmH family RNA methyltransferase [Methylotenera sp. 301]
 gi|297257803|gb|ADI29648.1| RNA methyltransferase, TrmH family, group 3 [Methylotenera sp. 301]
          Length = 251

 Score =  138 bits (347), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 66/242 (27%), Positives = 108/242 (44%), Gaps = 10/242 (4%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLATKN---ALARLDWDANLPHPFPVKTVPPQTIDKIVG 106
            L+G H V + L      + ++L  ++   A  +               V    +D + G
Sbjct: 6   ILFGFHAVLSRLRQHGASVQEILIDRDRMDARMKDLLKMAEAAGVRTMEVERSRLDGMAG 65

Query: 107 KEAVHQGLALETAPLLSPTLDAVR-------NSQLLMVLDHVNDPHNIGAILRSAVAFSC 159
               HQG+         P  D               ++LD V DPHN+GA LR A A   
Sbjct: 66  MNGRHQGVIARVVDTPIPYKDIHDILESDLTEPPFFLILDGVEDPHNLGACLRVADAMGV 125

Query: 160 DGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKP 219
             +I  K  +   +A + K A GA E +P+I ++NL   ++++   G   IG + D+   
Sbjct: 126 HAVIAPKDRAVGLNATVRKVACGAAETVPFIAVTNLARTIRELKEAGVFVIGTTMDAPST 185

Query: 220 LEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNH 279
           L     +  IA++LGAEG G+R  T ET  ++  + M G +++LNVS A+ + LY  +  
Sbjct: 186 LINTKLDGPIAIVLGAEGDGIRRLTAETCDALMTIPMYGSVESLNVSVASGICLYEARRQ 245

Query: 280 FA 281
            +
Sbjct: 246 RS 247


>gi|260584968|ref|ZP_05852712.1| TrmH family RNA methyltransferase [Granulicatella elegans ATCC
           700633]
 gi|260157398|gb|EEW92470.1| TrmH family RNA methyltransferase [Granulicatella elegans ATCC
           700633]
          Length = 282

 Score =  138 bits (347), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 78/279 (27%), Positives = 133/279 (47%), Gaps = 17/279 (6%)

Query: 16  KDSHYAKLRRNHRDYKKMQSFNQK----SRHTSQPENLFLYGVHTVSAALNNPSRKIFQL 71
           ++S+  K  +     K+ ++   K    S    Q    F+YG H V  AL  P R + +L
Sbjct: 6   RNSNRRKGSQPKGFKKEAKAPRPKYTPESSSNEQESTDFVYGRHAVREALQQPER-VNKL 64

Query: 72  LATKNALARLD---WDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDA 128
              +    +      D    H   ++ VP   +  +VG E VHQG+    A     TL+ 
Sbjct: 65  WVQEALSGKEITPIIDLAKEHRIQIQNVPKAKLQDLVG-EVVHQGVVASIAAYEYATLED 123

Query: 129 -------VRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSAS 181
                        +++LD + DP+N+G+ILR+A A    GII  KR S S ++ +AK+++
Sbjct: 124 VFEKAQEKNEDPFILILDGIEDPYNLGSILRTADATGVHGIIIPKRRSVSLTSTVAKAST 183

Query: 182 GALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLR 241
           GA+EH+P +R++NLT  ++++   G    G         +   K   IA+++G EGKG+ 
Sbjct: 184 GAIEHVPVVRVTNLTQTIEQLKERGVWVFGTDMKGTDYRQWNTK-GPIAIVMGNEGKGVS 242

Query: 242 PKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
              ++    M  + M G +++LN S A+A+ +Y      
Sbjct: 243 RIVKDAVDEMITIPMTGHVQSLNASVASALMMYEVFRSR 281


>gi|146299980|ref|YP_001194571.1| tRNA/rRNA methyltransferase (SpoU) [Flavobacterium johnsoniae
           UW101]
 gi|146154398|gb|ABQ05252.1| tRNA/rRNA methyltransferase (SpoU) [Flavobacterium johnsoniae
           UW101]
          Length = 262

 Score =  138 bits (347), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 45/280 (16%), Positives = 100/280 (35%), Gaps = 20/280 (7%)

Query: 1   MNLISKKKSEKIFSLKDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAA 60
           M  I+  +                  +   K +    +K++   Q     + G   +S A
Sbjct: 1   MKQITSVQ------------------NPFIKSLALLQEKAKARKQTGTFLIEGQREISLA 42

Query: 61  LNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAP 120
           +     +I  +L   + +     +  +     +  +  +   K+  ++     LA+    
Sbjct: 43  IK-GGYEIETVLFLPDLVTENQINKLVGSSVQLIEINKEVYQKLAYRDTTEGILAVAKTK 101

Query: 121 LLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSA 180
            L  +   + ++ L++V + +  P N+GA+LR+A A + D ++                +
Sbjct: 102 SLKLSDLKLSDNPLILVAESLEKPGNVGAVLRTADAANLDAVLI-ADPKSDLYNPNIVRS 160

Query: 181 SGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGL 240
           S        I      + +  +          +  +      +      AL++G E  GL
Sbjct: 161 SVGCLFTNQIATGTTEEIIAFLKEKNISFYSATLQNSTSYHTQNFTAPTALVVGTEATGL 220

Query: 241 RPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
             K ++ AT    + M G I ++NVS AAA+ ++  +   
Sbjct: 221 SQKWRDEATQNIIIPMQGEIDSMNVSVAAAILIFEAKRQR 260


>gi|308271789|emb|CBX28397.1| Putative trmH family tRNA/rRNA methyltransferase yacO [uncultured
           Desulfobacterium sp.]
          Length = 270

 Score =  138 bits (347), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 71/259 (27%), Positives = 124/259 (47%), Gaps = 10/259 (3%)

Query: 31  KKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATK---NALARLDWDANL 87
           +  +S  +      + E   LYG+H V  A+    RK++++   K   + L R       
Sbjct: 3   RNFKSLEKSRLEMDKSE--ILYGIHPVFEAVRAGRRKVYEIYIAKQKDSTLLRNISKLAE 60

Query: 88  PHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDA-----VRNSQLLMVLDHVN 142
           P   P+ +V P  + KI G +      A  +   L    D       +N   L++LD V 
Sbjct: 61  PAKIPLISVKPDHLTKITGSDFQQNIAAKVSEYPLIAFEDILNSITQKNYDFLLLLDTVV 120

Query: 143 DPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKM 202
           DP N+GA+ R+A+     GI+ TK  S S +  ++K+++GALEHI   +++N+  ++++M
Sbjct: 121 DPQNLGALARTALCAGVSGIVITKDRSASPTPAVSKASAGALEHIFLSKVTNMVSSIKEM 180

Query: 203 HSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKA 262
              G   +G+ + +  P+        IAL++G+EGKG+R   +     +  +   G + +
Sbjct: 181 KDRGIWVVGMDAMADMPVFSCDLKGPIALVIGSEGKGIRQLVKANCDFLVSIPQKGEVSS 240

Query: 263 LNVSNAAAVALYITQNHFA 281
           LN S A AVA+Y       
Sbjct: 241 LNASAAGAVAMYEVFRQRN 259


>gi|270265007|ref|ZP_06193270.1| hypothetical protein SOD_k00430 [Serratia odorifera 4Rx13]
 gi|270040941|gb|EFA14042.1| hypothetical protein SOD_k00430 [Serratia odorifera 4Rx13]
          Length = 243

 Score =  138 bits (346), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 65/242 (26%), Positives = 108/242 (44%), Gaps = 8/242 (3%)

Query: 48  NLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANL---PHPFPVKTVPPQTIDKI 104
           +  +YG+H V A L+N  ++  ++   K    R               ++    Q +D+ 
Sbjct: 2   SEIIYGIHAVKALLDNDPQRFLEVFILKGRDDRRLQPLIAELEATGIVIQVANRQWLDEK 61

Query: 105 VGKEAVHQGLALETAPLLSPTLDAVR-----NSQLLMVLDHVNDPHNIGAILRSAVAFSC 159
           V        +A           D        ++  L+VLD V DPHN+GA LRSA A   
Sbjct: 62  VEGAVHQGIIARVREGRQYQENDLPGLLEGIDTPFLLVLDGVTDPHNLGACLRSADAAGV 121

Query: 160 DGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKP 219
             +I  +  S   +A   K A GA E++P IR++NL   L+ +       +G + ++   
Sbjct: 122 HAVIVPRDRSAQLNATAKKVACGAAENVPLIRVTNLARTLRLLQEMNVWVVGTAGEADHT 181

Query: 220 LEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNH 279
           L Q      +AL++GAEG+G+R  T+E    +  + M G + +LNVS A  + L+     
Sbjct: 182 LFQSKMTGPMALVMGAEGEGMRRLTREHCDELISIPMAGTVSSLNVSVATGICLFEAVRQ 241

Query: 280 FA 281
            +
Sbjct: 242 RS 243


>gi|49473698|ref|YP_031740.1| tRNA/rRNA methyltransferase [Bartonella quintana str. Toulouse]
 gi|49239201|emb|CAF25517.1| tRNA/rRNA methyltransferase [Bartonella quintana str. Toulouse]
          Length = 278

 Score =  138 bits (346), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 52/272 (19%), Positives = 102/272 (37%), Gaps = 13/272 (4%)

Query: 11  KIFSLKDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQ 70
           K+  +          ++   K +++ +QK ++ ++       G+  V  AL N    I  
Sbjct: 13  KVKEITSL-------SNPIIKDLKALSQK-KNRNREGLFMAEGLKLVIDAL-NLEWTIQT 63

Query: 71  LLATKNALARLDWDANLPHPFP----VKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTL 126
           L+ +K+ +     +    H       V     + ++ I  ++     + +         +
Sbjct: 64  LIFSKSKIGDTAIENIAAHTIANGGLVIKASKKVMESITRRDNPQTAIGIFKQQWQPLEM 123

Query: 127 DAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEH 186
              RN  + + LD V DP N+G I+R+  A    G+I     +   S    ++  G++  
Sbjct: 124 IKRRNEDVYVALDRVRDPGNLGTIIRTVDAVGAKGVILIGETTDPFSLETVRATMGSIFS 183

Query: 187 IPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQE 246
           IP  R           H  G         S    + + KN  + L++G E +GL      
Sbjct: 184 IPLYRFDESAFLNWSAHFKGMVVGTHLKGSIDYRKIDFKNGPVILLMGNEKQGLPDTLAN 243

Query: 247 TATSMAHLHMPGIIKALNVSNAAAVALYITQN 278
               +A +   G   +LN++ A A+ LY  + 
Sbjct: 244 RCDQLARIPQSGRADSLNLAVATAIMLYEIRR 275


>gi|313891900|ref|ZP_07825502.1| RNA methyltransferase, TrmH family, group 3 [Dialister
           microaerophilus UPII 345-E]
 gi|313119675|gb|EFR42865.1| RNA methyltransferase, TrmH family, group 3 [Dialister
           microaerophilus UPII 345-E]
          Length = 272

 Score =  138 bits (346), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 60/270 (22%), Positives = 113/270 (41%), Gaps = 5/270 (1%)

Query: 15  LKDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAAL-NNPSRKIFQLLA 73
           +K+  +    +     K+    N++       +   + G ++V  AL  N  +KIF    
Sbjct: 3   IKNKTHKNSNKTQTVKKQFSQKNKRKTLKRSEDLF-ICGRNSVKEALNENQIKKIFIKSG 61

Query: 74  TKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQG---LALETAPLLSPTLDAVR 130
             +   +           PV+    + +DK+            +       L   L   +
Sbjct: 62  NNDQRLKDIVKIAQNKNIPVEIEEQEILDKMSDGVRNQGIVASMKPFEYSDLEEVLSKAK 121

Query: 131 NSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYI 190
              L+++LD V D  NIGAI+R+A       ++  K  S   +A   K+A+GA  ++P  
Sbjct: 122 EDPLIVLLDGVEDVRNIGAIVRTAECAGVSAVLLPKHKSAPVTAAAIKTAAGAFSYLPVC 181

Query: 191 RISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATS 250
            I N+   L+ +   GF  +G   + +    +      + +++GAEGKG+   T++    
Sbjct: 182 EIGNIRQTLEHLKEKGFWVVGADMEGELLYYESNLKGPLVIVMGAEGKGISLLTKKMCDF 241

Query: 251 MAHLHMPGIIKALNVSNAAAVALYITQNHF 280
           +  + M G + +LNVS AAA+ +Y +    
Sbjct: 242 LVRIPMKGKVSSLNVSVAAALLIYESVKQR 271


>gi|313201452|ref|YP_004040110.1| TrmH family RNA methyltransferase [Methylovorus sp. MP688]
 gi|312440768|gb|ADQ84874.1| RNA methyltransferase, TrmH family, group 3 [Methylovorus sp.
           MP688]
          Length = 249

 Score =  138 bits (346), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 73/242 (30%), Positives = 113/242 (46%), Gaps = 10/242 (4%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLATKNALA-RLDWDANLPHPFPVKT--VPPQTIDKIVG 106
            L+G H V + L      + ++L  K+ +  R+    NL     V+   V    +D + G
Sbjct: 6   ILFGFHAVLSRLRQHGASVQEILIDKDRVDARMKDLINLAEGASVRLMQVERSRLDGMAG 65

Query: 107 KEAVHQGLALETAPLLSPTLDAVR-------NSQLLMVLDHVNDPHNIGAILRSAVAFSC 159
               HQG+         P  D               +VLD V DPHN+GA LR A A   
Sbjct: 66  ANGRHQGVIARVVDTPIPYKDIHDILESDLTEPPFFLVLDGVEDPHNLGACLRVADAMGV 125

Query: 160 DGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKP 219
             +I  K  +   +A + K A GA E IP+I ++NL   L+++   G   +G ++D+   
Sbjct: 126 HAVIAPKDRAAGLNATVRKVACGAAETIPFIAVTNLARTLRELQEAGVFVVGAAADAPGN 185

Query: 220 LEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNH 279
           L     +  +AL+LGAEG GLR  T ET  ++  + M G +++LNVS A+ + LY  +  
Sbjct: 186 LFTTKLDGPLALVLGAEGAGLRRLTAETCDTLVSIPMFGSVESLNVSVASGICLYEARRQ 245

Query: 280 FA 281
             
Sbjct: 246 RN 247


>gi|309380106|emb|CBX21517.1| unnamed protein product [Neisseria lactamica Y92-1009]
          Length = 250

 Score =  138 bits (346), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 72/238 (30%), Positives = 113/238 (47%), Gaps = 9/238 (3%)

Query: 51  LYGVHTVSAALNNPSRKIFQLLATK---NALARLDWDANLPHPFPVKTVPPQTIDKIVGK 107
           +YG H V+A L    + I +L   +   +A  R   +        V  V    +D I  K
Sbjct: 7   IYGFHAVNARLWQNPKSIVELYIQEGKSDARTREVLEKAANENIRVYFVDTTRLDAIS-K 65

Query: 108 EAVHQGLALET-----APLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGI 162
            A HQG+A           L   L+ +    LL++LD + DPHN+GA LR+A A     +
Sbjct: 66  GARHQGVAGFIDASKNHVHLEDVLENLSEPPLLLILDGITDPHNLGACLRTADAMGVHAV 125

Query: 163 ITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQ 222
           I  K  S   +A ++K A GA E +PYI ++NL   L+++  +G   IG     +  L  
Sbjct: 126 IAPKDKSAGLNATVSKVACGAAETVPYITVTNLARTLRELKEYGIWIIGTDMGGESDLYH 185

Query: 223 EIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
               D  A ++G EG G+R  T+E    +  + M G ++++NVS +A + L  T+   
Sbjct: 186 CDLPDSAAWVMGNEGDGMRRLTREHCDMLVSIPMFGTVESMNVSVSAGMVLGETRRQR 243


>gi|251788405|ref|YP_003003126.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Dickeya zeae Ech1591]
 gi|247537026|gb|ACT05647.1| RNA methyltransferase, TrmH family, group 3 [Dickeya zeae Ech1591]
          Length = 244

 Score =  138 bits (346), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 66/242 (27%), Positives = 103/242 (42%), Gaps = 8/242 (3%)

Query: 48  NLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANL---PHPFPVKTVPPQTIDKI 104
           +  +YG+H V A L    ++  ++   K    R               V+    Q +D  
Sbjct: 2   SEIIYGIHAVKALLEQDPQRFLEVFILKGREDRRLQPLIAELEAGGIAVQVANRQWLDDK 61

Query: 105 VGKEAVHQGLALETAPLLSPTLDAVR-----NSQLLMVLDHVNDPHNIGAILRSAVAFSC 159
           V        +A           D         +  L+VLD V DPHN+GA LRSA A   
Sbjct: 62  VEGAVHQGIVARVKEGRQYQENDLPGLLAALATPFLLVLDGVTDPHNLGACLRSADAAGV 121

Query: 160 DGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKP 219
             +I  +  S   +A   K A GA E +P IR++NL   L+ +       +G + ++   
Sbjct: 122 HAVIVPRDRSAQLNATAKKVACGAAETVPLIRVTNLARTLRFLQEQNIWIVGTAGEADHT 181

Query: 220 LEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNH 279
           L Q      +AL++GAEG+G+R  T+E    +  + M G + +LNVS A  + L+     
Sbjct: 182 LYQSKLTGPLALVMGAEGEGMRRLTREHCDELISIPMAGSVSSLNVSVATGICLFEAVRQ 241

Query: 280 FA 281
            A
Sbjct: 242 RA 243


>gi|149377618|ref|ZP_01895356.1| probable tRNA/rRNA methyltransferase [Marinobacter algicola DG893]
 gi|149358091|gb|EDM46575.1| probable tRNA/rRNA methyltransferase [Marinobacter algicola DG893]
          Length = 245

 Score =  138 bits (346), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 68/243 (27%), Positives = 111/243 (45%), Gaps = 12/243 (4%)

Query: 48  NLFLYGVHTVSAALNNPSRKIFQLLAT---KNALARLDWDANLPHPFPVKTVPPQTIDKI 104
             +++G H V A L     ++ Q+      ++   +   D         + V  + +D+ 
Sbjct: 3   EEYIFGWHAVEAVLKREPERLQQVWIQTGREDRRVKTVTDTLSELGVRWQVVHRKELDQR 62

Query: 105 VGKEAVHQGLALETAPLLSPTLDA-------VRNSQLLMVLDHVNDPHNIGAILRSAVAF 157
           V    VHQG+    +     + D              L++LD V DPHN+GA LR+A A 
Sbjct: 63  VA--GVHQGVVAAVSESREWSEDDLLAMLSGSEKPPFLLILDGVTDPHNLGACLRTADAV 120

Query: 158 SCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSK 217
               ++  K  S S S  + K A GA E +P +R++NL   ++ +   G   IG + ++ 
Sbjct: 121 GVQAVVVPKDKSASLSPTVRKVACGAAETVPLVRVTNLARFMRTIRDDGVWLIGTAGEAD 180

Query: 218 KPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQ 277
             L Q      +AL++GAEGKG+R  T+E    + ++ M G + +LNVS A  V LY   
Sbjct: 181 STLHQADFTGPVALVMGAEGKGMRRLTREHCDLLINIPMLGHVDSLNVSVATGVCLYEAL 240

Query: 278 NHF 280
              
Sbjct: 241 RQR 243


>gi|241760483|ref|ZP_04758576.1| RNA methyltransferase, TrmH family, group 3 [Neisseria flavescens
           SK114]
 gi|241318987|gb|EER55489.1| RNA methyltransferase, TrmH family, group 3 [Neisseria flavescens
           SK114]
          Length = 249

 Score =  138 bits (346), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 69/239 (28%), Positives = 111/239 (46%), Gaps = 9/239 (3%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLATK---NALARLDWDANLPHPFPVKTVPPQTIDKIVG 106
            +YG H V+A L    + I +L   +   +A  R   D        V       ++ I  
Sbjct: 6   LIYGFHAVNARLWQNPKSITELYIQEGKSDARTRDVLDKAASENVRVHFADADRLNAIS- 64

Query: 107 KEAVHQGLALET-----APLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDG 161
           K A HQG+            L   L+ +     L+VLD + DPHN+GA LR+A A     
Sbjct: 65  KGARHQGVVGFIDASKNHVHLEDVLENLSEPPFLLVLDGITDPHNLGACLRTADAMGVHA 124

Query: 162 IITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLE 221
           +I  K  S   +A ++K A GA E +PYI ++NL   L+++  +G   +G        L 
Sbjct: 125 VIAPKDKSAGLNATVSKVACGAAETVPYITVTNLARTLRELKEYGIWIVGTDMGGNSDLY 184

Query: 222 QEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
                D +A ++G EG+G+R  T+E    +  + M G ++++NVS +A + L  T+   
Sbjct: 185 HCDLPDSVAWVMGNEGEGMRRLTREHCDMLVSIPMFGTVESMNVSVSAGMVLSETRRQR 243


>gi|254671350|emb|CBA08779.1| putative tRNA/rRNA methyltransferase [Neisseria meningitidis
           alpha153]
          Length = 250

 Score =  138 bits (346), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 69/239 (28%), Positives = 111/239 (46%), Gaps = 9/239 (3%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLATK---NALARLDWDANLPHPFPVKTVPPQTIDKIVG 106
            +YG H V+A L    + I +L   +   +A  R   +        V       ++ I  
Sbjct: 6   LIYGFHAVNARLWQNPKSIVELYIQEGKSDARTREVLEKAANENIRVYFADTDRLNAIS- 64

Query: 107 KEAVHQGLALET-----APLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDG 161
           K A HQG+            L   L+ +    LL++LD + DPHN+GA LR+A A     
Sbjct: 65  KGARHQGVVGFIDASKNHVHLEDVLENLSEPPLLLILDGITDPHNLGACLRTADAMGVHA 124

Query: 162 IITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLE 221
           +I  K  S   +A ++K A GA E +PYI ++NL   L+++  +G   IG        L 
Sbjct: 125 VIAPKDKSAGLNATVSKVACGAAETVPYITVTNLARTLRELKEYGIWIIGTDMGGNADLY 184

Query: 222 QEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
             +  D  A ++G EG G+R  T+E    +  + M G ++++NVS +A + L  T+   
Sbjct: 185 HCVLPDSAAWVMGNEGDGMRRLTREHCDMLVSIPMFGTVESMNVSVSAGMVLSETRRQR 243


>gi|238917600|ref|YP_002931117.1| RNA methyltransferase, TrmH family [Eubacterium eligens ATCC 27750]
 gi|238872960|gb|ACR72670.1| RNA methyltransferase, TrmH family [Eubacterium eligens ATCC 27750]
          Length = 279

 Score =  138 bits (346), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 49/256 (19%), Positives = 103/256 (40%), Gaps = 4/256 (1%)

Query: 29  DYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLP 88
             K + S   K+R   + +   + GV  VS    +   KI+      +       +    
Sbjct: 24  QVKHVISLLSKARERKKNKEYVVEGVRMVSEVPADLLVKIYMSERFHSNNPEYVHELVKK 83

Query: 89  HPFP---VKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDHVNDPH 145
                  ++ V     D++  +    QG+        S   D + ++ LL++++++ DP 
Sbjct: 84  QGISSDSIEIVADNVFDRMS-QTQTPQGIMAVVRMKDSSISDMLTDNPLLILVENLQDPG 142

Query: 146 NIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSW 205
           N+G ILR        G+I +       +    +S  G++  +P++ + + +DA+ +  + 
Sbjct: 143 NLGTILRMGEGAGVTGVIMSSNTVDIYNPKTIRSTMGSIFRVPFVYVQDFSDAVSQCKNA 202

Query: 206 GFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNV 265
           G +      D K     E   +  A ++G EG GL     + A ++  + M G +++LN 
Sbjct: 203 GIKVYAAHLDGKNTYLGEDYREGTAFLIGNEGNGLTEDITKQADTLIRIPMQGEVESLNA 262

Query: 266 SNAAAVALYITQNHFA 281
           + A  +  Y      +
Sbjct: 263 AIACTILTYEAVRQRS 278


>gi|15612676|ref|NP_240979.1| tRNA/rRNA methyltransferase [Bacillus halodurans C-125]
 gi|10172725|dbj|BAB03832.1| tRNA/rRNA methyltransferase [Bacillus halodurans C-125]
          Length = 249

 Score =  138 bits (346), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 63/244 (25%), Positives = 117/244 (47%), Gaps = 12/244 (4%)

Query: 47  ENLFLYGVHTVSAALNNPSRKIFQLLATKNAL---ARLDWDANLPHPFPVKTVPPQTIDK 103
           +  F+ G + +  AL +  R + ++   + +     +   +        V+ VP + +D+
Sbjct: 2   DREFITGKNPIIEALRSG-RPMNKIWIGEGSQKGQMQKVLELAKEQGVLVQHVPKRKLDQ 60

Query: 104 IVGKEAVHQGLALETAPLLSPTLDA-------VRNSQLLMVLDHVNDPHNIGAILRSAVA 156
           ++G E  HQG+    A      +D               +VLD V DPHN+G+ILR+A A
Sbjct: 61  LIGHE-NHQGVVASVAAYEYAEMDDLFQRAAEKGEEPFFIVLDEVEDPHNLGSILRTADA 119

Query: 157 FSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDS 216
               G+I  KR +   +  +AK+++GA+E++P +R++NL   ++ +   G   IG  +  
Sbjct: 120 AGVHGVIIPKRRAVGLTQTVAKASTGAIEYVPVVRVTNLARTMEDLKKRGLWFIGTDAKG 179

Query: 217 KKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYIT 276
            +       +  IAL++G+EGKGL    +E    +  + M G + +LN S A ++ +Y  
Sbjct: 180 SEDYRGAAYDMPIALVIGSEGKGLSRLVREKCDFLVRIPMVGQVTSLNASVATSLLMYEA 239

Query: 277 QNHF 280
               
Sbjct: 240 YRKR 243


>gi|304405070|ref|ZP_07386730.1| tRNA/rRNA methyltransferase (SpoU) [Paenibacillus curdlanolyticus
           YK9]
 gi|304345949|gb|EFM11783.1| tRNA/rRNA methyltransferase (SpoU) [Paenibacillus curdlanolyticus
           YK9]
          Length = 264

 Score =  138 bits (346), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 58/257 (22%), Positives = 97/257 (37%), Gaps = 5/257 (1%)

Query: 26  NHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDA 85
            +   K   S   K +H  +     + G+H V  AL   ++    +   +  L       
Sbjct: 10  QNARAKGWASLLDK-KHRDRSGQFLVEGIHLVKEALECGAQVETIVYDGERGLPLELQQL 68

Query: 86  NLPHPFPVKTVPPQ--TIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDHVND 143
                FP   V      + K  G ++     A+   P++  T    R   L++VLD V D
Sbjct: 69  PALIAFPELLVSASTVVMAKCTGTDSPPPVFAVVAKPVVEETA-LFREQSLVVVLDGVRD 127

Query: 144 PHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMH 203
           P N+G I+RSA A   D ++  +      +    +S  G+L H+P I    L    +   
Sbjct: 128 PGNVGTIIRSADAVGADAVVLGRGCVDLYNPKTVRSTMGSLFHLPVIEADLLELLPKAQE 187

Query: 204 SWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKAL 263
                       +    + +       L++G+E  GL P+  E A     + + G  ++L
Sbjct: 188 RGIRLAATSLQSAVSCYDCD-WTSATWLLMGSESDGLSPEVLELADQSVIIPIRGRAESL 246

Query: 264 NVSNAAAVALYITQNHF 280
           NV+ AA V LY      
Sbjct: 247 NVAMAATVILYEALRQR 263


>gi|261380701|ref|ZP_05985274.1| RNA methyltransferase, TrmH family, group 3 [Neisseria subflava
           NJ9703]
 gi|284796412|gb|EFC51759.1| RNA methyltransferase, TrmH family, group 3 [Neisseria subflava
           NJ9703]
          Length = 249

 Score =  138 bits (346), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 69/239 (28%), Positives = 111/239 (46%), Gaps = 9/239 (3%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLATK---NALARLDWDANLPHPFPVKTVPPQTIDKIVG 106
            +YG H V+A L    + I +L   +   +A  R   D        V       ++ I  
Sbjct: 6   LIYGFHAVNARLWQNPKSITELYIQEGKSDARTRDVLDKAASENVRVHFADADRLNAIS- 64

Query: 107 KEAVHQGLALET-----APLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDG 161
           K A HQG+            L   L+ +     L+VLD + DPHN+GA LR+A A     
Sbjct: 65  KGARHQGVVGFIDASKNHVHLEDVLENLSEPPFLLVLDGITDPHNLGACLRTADAMGVHA 124

Query: 162 IITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLE 221
           +I  K  S   +A ++K A GA E +PYI ++NL   L+++  +G   +G        L 
Sbjct: 125 VIAPKDKSAGLNATVSKVACGAAETVPYITVTNLARTLRELKEYGIWIVGTDMGGDSDLY 184

Query: 222 QEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
                D +A ++G EG+G+R  T+E    +  + M G ++++NVS +A + L  T+   
Sbjct: 185 HCDLPDSVAWVMGNEGEGMRRLTREHCDMLVSIPMFGTVESMNVSVSAGMVLSETRRQR 243


>gi|119493555|ref|ZP_01624220.1| tRNA/rRNA methyltransferase (SpoU) [Lyngbya sp. PCC 8106]
 gi|119452609|gb|EAW33791.1| tRNA/rRNA methyltransferase (SpoU) [Lyngbya sp. PCC 8106]
          Length = 328

 Score =  138 bits (346), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 53/256 (20%), Positives = 99/256 (38%), Gaps = 8/256 (3%)

Query: 26  NHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLA--TKNALARLDW 83
            +   K+++   Q+++   + +   L G H +  AL      +        +N   RL  
Sbjct: 68  QNPLIKQLRKL-QRTKGRREQQLFLLEGTHLIEEALATQYPLLTVCYTAQWQNRYPRLWE 126

Query: 84  DANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDHVND 143
                     + V  + +  I    A         A    P    V  +Q+ + L+ V D
Sbjct: 127 SVCQAAS-RSEEVNERVLQAI----ATTVNPDGIIATAPRPQPQTVAITQIGLALETVQD 181

Query: 144 PHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMH 203
           P N+G ++R+A A   DG+  +      +   + ++++GA   +P     +LT+ L    
Sbjct: 182 PGNLGTMIRTAAAAGIDGLWLSDDSVDLDHPKVLRASAGAWFRLPMAVGGDLTEQLTIAQ 241

Query: 204 SWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKAL 263
             G Q +    D+     +        ++LG EG GL       A     + + G +++L
Sbjct: 242 QQGVQIVATLPDADLTYWELDFQQPTIVVLGNEGAGLSSSLTALADQHVQIPLSGGVESL 301

Query: 264 NVSNAAAVALYITQNH 279
           NV+  AA+ LY  Q  
Sbjct: 302 NVAICAALMLYEGQRQ 317


>gi|293399197|ref|ZP_06643362.1| RNA methyltransferase, TrmH family, group 3 [Neisseria gonorrhoeae
           F62]
 gi|291610611|gb|EFF39721.1| RNA methyltransferase, TrmH family, group 3 [Neisseria gonorrhoeae
           F62]
          Length = 250

 Score =  138 bits (346), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 69/238 (28%), Positives = 110/238 (46%), Gaps = 9/238 (3%)

Query: 51  LYGVHTVSAALNNPSRKIFQLLATK---NALARLDWDANLPHPFPVKTVPPQTIDKIVGK 107
           +YG H V+A L    + I +L   +   +A  R   +        V       ++ I  K
Sbjct: 7   IYGFHAVNARLWQNPKSITELYIQEGKSDARTREVLEKAANENIRVYFADADRLNAIS-K 65

Query: 108 EAVHQGLALET-----APLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGI 162
            A HQG+            L   L+ +    LL++LD + DPHN+GA LR+A A     +
Sbjct: 66  GARHQGVVGFIDASKNHVHLEDVLENLSEPPLLLILDGITDPHNLGACLRTADAMGVHAV 125

Query: 163 ITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQ 222
           I  K  S   +A ++K A GA E +PYI ++NL   L+++  +G   IG        L  
Sbjct: 126 IAPKDKSAGLNATVSKVACGAAETVPYITVTNLARTLRELKEYGIWIIGTDMGGDADLYH 185

Query: 223 EIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
               D  A ++G EG G+R  T+E    +  + M G ++++NVS +A + L  T+   
Sbjct: 186 CNLPDSTAWVMGNEGDGMRRLTREHCDMLVSIPMFGTVESMNVSVSAGMVLSETRRQR 243


>gi|326202357|ref|ZP_08192226.1| RNA methyltransferase, TrmH family, group 3 [Clostridium
           papyrosolvens DSM 2782]
 gi|325987475|gb|EGD48302.1| RNA methyltransferase, TrmH family, group 3 [Clostridium
           papyrosolvens DSM 2782]
          Length = 319

 Score =  138 bits (346), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 60/241 (24%), Positives = 111/241 (46%), Gaps = 10/241 (4%)

Query: 51  LYGVHTVSAALNNPS--RKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKE 108
           L G +++  AL       K+F     K    R               V    +D +    
Sbjct: 80  LEGRNSIMEALKANRTINKLFIAKGEKEGSIRQIIAMARQKGIITTEVDKSILDGMSSTR 139

Query: 109 AVHQGLALETAPLLSPTLDAV-------RNSQLLMVLDHVNDPHNIGAILRSAVAFSCDG 161
           + HQG+    A      +D +            +++LD ++DPHN GAILR+A A    G
Sbjct: 140 S-HQGVIAYVAVKDYVEVDDILAAAQEKGEPPFIIILDEISDPHNFGAILRTANAVGAHG 198

Query: 162 IITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLE 221
           +I  KR +   ++ ++K+++GA+E++P  R++N++  ++ +       +G  S  +K   
Sbjct: 199 VIIPKRRAIGLTSTVSKASAGAVEYVPVSRVTNISQTIEYLKKNNVWVVGTDSTGEKAFY 258

Query: 222 QEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHFA 281
           +      +AL++G+EG+G+    +E    + ++ M G I +LN S AAA+ +Y       
Sbjct: 259 ESDLKGPMALVVGSEGEGMGKLVREKCDFVVNIPMKGEISSLNASVAAAIVMYEILKQRG 318

Query: 282 K 282
           K
Sbjct: 319 K 319


>gi|300311188|ref|YP_003775280.1| tRNA/rRNA methyltransferase [Herbaspirillum seropedicae SmR1]
 gi|300073973|gb|ADJ63372.1| tRNA/rRNA methyltransferase protein [Herbaspirillum seropedicae
           SmR1]
          Length = 245

 Score =  137 bits (345), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 67/237 (28%), Positives = 113/237 (47%), Gaps = 7/237 (2%)

Query: 51  LYGVHTVSAALNNPSRKIFQLLATKNALARLDWDA---NLPHPFPVKTVPPQTIDKIVGK 107
           ++G H V++ + + +  + ++        R   D           +     Q +  +VG 
Sbjct: 6   IFGFHAVTSRIRHEASSVDEIYVDAERRDRRMLDLLHAAKEANVRIIQADDQRLAAMVGT 65

Query: 108 EAVHQGLALETA----PLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGII 163
                 +A   A      L   LDAV    LL++LD + DPHN+GA LR A       +I
Sbjct: 66  RRHQGVVAKAAALSLARTLDELLDAVVGPPLLLILDGITDPHNLGACLRVADGAGAHAVI 125

Query: 164 TTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQE 223
             K  +   +A   K +SGA + +PYI ++NL   ++ +   G   IG S D++K L + 
Sbjct: 126 APKDRAVGLNATAMKVSSGASDTVPYITVTNLARTMRDLKERGVWIIGTSDDAEKGLYEG 185

Query: 224 IKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
                 AL++G+EG+G+R  T+ET   + ++ M G +++LNVS A+ V LY  +   
Sbjct: 186 DFTGPTALVMGSEGEGMRRLTRETCDVLVNIPMFGSVESLNVSVASGVCLYEARRQR 242


>gi|269214830|ref|ZP_05987243.2| RNA methyltransferase, TrmH family, group 3 [Neisseria lactamica
           ATCC 23970]
 gi|269208890|gb|EEZ75345.1| RNA methyltransferase, TrmH family, group 3 [Neisseria lactamica
           ATCC 23970]
          Length = 261

 Score =  137 bits (345), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 68/238 (28%), Positives = 111/238 (46%), Gaps = 9/238 (3%)

Query: 51  LYGVHTVSAALNNPSRKIFQLLATK---NALARLDWDANLPHPFPVKTVPPQTIDKIVGK 107
           +YG H V+A L    + I +L   +   +A  R   +        V       ++ I  K
Sbjct: 18  IYGFHAVNARLWQNPKSIVELYIQEGKSDARTREVLEKAANENIRVYFADADRLNAIS-K 76

Query: 108 EAVHQGLALET-----APLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGI 162
            A HQG+            L   L+ +    LL++LD + DPHN+GA LR+A A     +
Sbjct: 77  GARHQGVVGFIDASKNHVHLEDVLENLSEPPLLLILDGITDPHNLGACLRTADAMGVHAV 136

Query: 163 ITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQ 222
           I  K  S   +A ++K A GA E +PYI ++NL   ++++  +G   IG     +  L  
Sbjct: 137 IAPKDKSAGLNATVSKVACGAAETVPYITVTNLARTMRELKEYGIWIIGTDMGGESDLYH 196

Query: 223 EIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
               D  A ++G EG G+R  T+E    +  + M G ++++NVS +A + L  T+   
Sbjct: 197 CNLPDSAAWVMGNEGDGMRRLTREHCDMLVSIPMFGTVESMNVSVSAGMVLSETRRQR 254


>gi|240115499|ref|ZP_04729561.1| RNA methyltransferase [Neisseria gonorrhoeae PID18]
 gi|260440690|ref|ZP_05794506.1| RNA methyltransferase [Neisseria gonorrhoeae DGI2]
          Length = 250

 Score =  137 bits (345), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 69/238 (28%), Positives = 111/238 (46%), Gaps = 9/238 (3%)

Query: 51  LYGVHTVSAALNNPSRKIFQLLATK---NALARLDWDANLPHPFPVKTVPPQTIDKIVGK 107
           +YG H V+A L    + I +L   +   +A  R   +        V       ++ I  K
Sbjct: 7   IYGFHAVNARLWQNPKSITELYIQEGKSDARTREVLEKAANENIRVYFADADRLNAIS-K 65

Query: 108 EAVHQGLALET-----APLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGI 162
            A HQG+            L   L+ +    LL++LD + DPHN+GA LR+A A     +
Sbjct: 66  GARHQGVVGFIDASKNHVHLEDVLENLSEPPLLLILDGITDPHNLGACLRTADAMGVHAV 125

Query: 163 ITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQ 222
           I  K  S   +A ++K A GA E +PYI ++NL   L+++  +G   IG     +  L  
Sbjct: 126 IAPKDKSAGLNATVSKVACGAAETVPYITVTNLARTLRELKEYGIWIIGTDMGGESDLYH 185

Query: 223 EIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
               D  A ++G EG G+R  T+E    +  + M G ++++NVS +A + L  T+   
Sbjct: 186 CNLPDSTAWVMGNEGDGMRRLTREHCDMLVSIPMFGTVESMNVSVSAGMVLSETRRQR 243


>gi|126652676|ref|ZP_01724837.1| rRNA methylase [Bacillus sp. B14905]
 gi|126590525|gb|EAZ84643.1| rRNA methylase [Bacillus sp. B14905]
          Length = 254

 Score =  137 bits (345), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 48/274 (17%), Positives = 95/274 (34%), Gaps = 24/274 (8%)

Query: 1   MNLISKKKSEKIFSLKDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAA 60
           M  I   +                  +   K  +      +   +     + G H V  A
Sbjct: 1   MKRIESTQ------------------NALVKYWKKLATTRKERERSGEFIVEGFHLVEEA 42

Query: 61  LNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAP 120
           L N   ++ Q++  +     + W  +      V +V  +   +    + V          
Sbjct: 43  LKN-KEQVLQIIVREGVDLPMLWPIDGIAIIEVTSVVAKEFAETETSQGV-----FAICK 96

Query: 121 LLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSA 180
             +   +   + + ++++D V DP NIG ++R+A A   D +I  K  +   +    ++A
Sbjct: 97  QPALEEEVKASWRKVLLIDAVQDPGNIGTMIRTADAAGLDAVILGKGCADVYNPKTLRAA 156

Query: 181 SGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGL 240
            G+  HIP +R                       +   P          A+I+G EG G+
Sbjct: 157 QGSHFHIPVVREELTECVDFLQAQGVPVFGTALDEDAVPYSDIQHTGAFAIIMGNEGSGI 216

Query: 241 RPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
           +P+          + + G  ++LNV+ A  + LY
Sbjct: 217 QPQLLAMTDQNIIIPIFGQAESLNVAVATGIVLY 250


>gi|21674445|ref|NP_662510.1| SpoU rRNA methylase family protein [Chlorobium tepidum TLS]
 gi|21647630|gb|AAM72852.1| spoU rRNA methylase family protein [Chlorobium tepidum TLS]
          Length = 257

 Score =  137 bits (345), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 58/244 (23%), Positives = 104/244 (42%), Gaps = 7/244 (2%)

Query: 44  SQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALA-RLDWDANLPHP--FPVKTVPPQT 100
            +P    +YG + V   L +    + ++    N    +L            P      + 
Sbjct: 12  QKPREQVVYGRNAVIELLQSKPESVEKIYLQFNTSHPKLKEIVITARRLRIPCGKARMEK 71

Query: 101 IDKIVGKEAVHQGLALETAPLLSPTLD----AVRNSQLLMVLDHVNDPHNIGAILRSAVA 156
           +  + G        AL T+       +       +S LL++L  + DPHN+GAI+R+A A
Sbjct: 72  LTLLSGTAKNQGVCALLTSVTFYTLNEVLAAPRNSSPLLVILQGLEDPHNVGAIIRTAEA 131

Query: 157 FSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDS 216
            + D +I  +      SA + K+++GAL H+   ++ ++  AL  +   GF  +    ++
Sbjct: 132 VAADAVIMIEGKGAPISATVHKASAGALSHMRVCKVKSVVKALDLLRERGFSIVAADMEA 191

Query: 217 KKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYIT 276
           +             L++GAEG GL  +T+     +  + M G +++LNVS AA V LY  
Sbjct: 192 EHNHTDIDWKRPTVLVMGAEGSGLGSETRNRCDQIVRIPMAGCVESLNVSVAAGVMLYEA 251

Query: 277 QNHF 280
               
Sbjct: 252 MRQR 255


>gi|312877039|ref|ZP_07737012.1| tRNA/rRNA methyltransferase (SpoU) [Caldicellulosiruptor
           lactoaceticus 6A]
 gi|311796180|gb|EFR12536.1| tRNA/rRNA methyltransferase (SpoU) [Caldicellulosiruptor
           lactoaceticus 6A]
          Length = 270

 Score =  137 bits (345), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 50/284 (17%), Positives = 117/284 (41%), Gaps = 26/284 (9%)

Query: 2   NLISKKKSEKIFSLKDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAAL 61
             IS +++E I  +K  H                     ++  +  +  + G+  V  A+
Sbjct: 7   EFISSRENECIKRVKKLHDK-------------------KYREEFRSFIIEGLKLVREAI 47

Query: 62  NNPSRKIFQLLATKNALARLDWD----ANLPHPFPVKTV--PPQTIDKIVGKEAVHQGLA 115
           +     I  ++ ++ A  R          L     ++ V   P  + + +   +  QG+ 
Sbjct: 48  DYQIECINLVIFSQQAKDRYQEFYWECKRLLEDGKIERVIEVPDKLFEYITTTSTPQGIL 107

Query: 116 LETAPLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAV 175
            E   +    ++ ++N + ++V + + DP N+G ++R A AF  D ++TTK      +  
Sbjct: 108 AECNFVDKG-INFIKNLRRVVVANKLQDPGNLGTLIRCADAFGFDAVVTTKGTVDIYNPK 166

Query: 176 LAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGA 235
             ++  G+L H+  +R +     ++ +    F     +      + + + + +  +++G 
Sbjct: 167 TIRATMGSLFHLQIMREAEEGKLIKILKDNSFAVYVTTPYGDIEISKIVPDKRFCVVIGN 226

Query: 236 EGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNH 279
           E +G+     + AT    + M G  ++LN + AA++ LY  +  
Sbjct: 227 ESEGVSDSFAKVATRKIKIPMAGKAESLNAAVAASIVLYELRKR 270


>gi|268610377|ref|ZP_06144104.1| RNA methyltransferase, TrmH family, group 3 [Ruminococcus
           flavefaciens FD-1]
          Length = 254

 Score =  137 bits (345), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 57/244 (23%), Positives = 99/244 (40%), Gaps = 7/244 (2%)

Query: 44  SQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDK 103
            +     ++G + V  AL + +      +        L           +K    + + +
Sbjct: 9   DERSEDIIFGRNPVIEALKSDANLDCIYICGSGGSLNLIRKLAKDKGVVIKDAQEKKLSQ 68

Query: 104 IVGKEAVHQGLALETAPLLSPTLD------AVRNSQLLMVLDHVNDPHNIGAILRSAVAF 157
           + G  +     A+          D             +++ D + DPHN+GAI+R+A   
Sbjct: 69  LSGGASHQGVAAVGACGEYVSVEDILAVSRNKGTKPFIIICDEIEDPHNLGAIIRTAETS 128

Query: 158 SCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSK 217
             DGII  KR S S +A + K+++GA  ++P  R+SNL   +  +   G    G  +   
Sbjct: 129 GADGIIIPKRRSASLNATVFKTSAGAANYVPVARVSNLASCIDMLKENGVWIYGTDASGT 188

Query: 218 KPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQ 277
           +   Q       AL++G+EG G+    Q+    M  L M G I +LN S AA + +Y   
Sbjct: 189 EYT-QTDFTGSCALVIGSEGFGISKLIQKKCDFMIKLPMLGKINSLNASVAAGIFMYEIL 247

Query: 278 NHFA 281
              +
Sbjct: 248 RQRS 251


>gi|254518665|ref|ZP_05130721.1| tRNA/rRNA methyltransferase [Clostridium sp. 7_2_43FAA]
 gi|226912414|gb|EEH97615.1| tRNA/rRNA methyltransferase [Clostridium sp. 7_2_43FAA]
          Length = 260

 Score =  137 bits (345), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 53/257 (20%), Positives = 100/257 (38%), Gaps = 6/257 (2%)

Query: 24  RRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDW 83
            + +  +K ++   ++ R   +     L G   +  A        + +L+  N     + 
Sbjct: 6   SKENNFFKSIKKLKER-RFRQKEGKFILEGFRLIEEAAKANMEIEYIILSQGNEEKLYNS 64

Query: 84  DANL-PHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDHVN 142
                 +   +         +I   E     +A+     ++  LD        +V D V 
Sbjct: 65  SLKEVINDDKIYVFSSSLFLQISSTEHPQGVIAVVKNKKMTIDLDGG----FFLVCDKVQ 120

Query: 143 DPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKM 202
           DP N+G I+R+  A   DGII TK      +    +S  G++ ++P          ++K+
Sbjct: 121 DPGNLGTIIRTGHAAGVDGIILTKGTVDIYNDKTIRSTMGSIFYVPIFYDDEDFSIIKKL 180

Query: 203 HSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKA 262
              G   +  S +  K   +E    KI L +G EG G+  +  E A+    + MPG  ++
Sbjct: 181 KDNGVALVTTSLEESKNFFEENLKGKIMLAVGNEGNGISNELFELASKKVKIPMPGGAES 240

Query: 263 LNVSNAAAVALYITQNH 279
           LNV+ A ++ L+     
Sbjct: 241 LNVAIATSIILFEKVRQ 257


>gi|237745438|ref|ZP_04575918.1| RNA methyltransferase [Oxalobacter formigenes HOxBLS]
 gi|229376789|gb|EEO26880.1| RNA methyltransferase [Oxalobacter formigenes HOxBLS]
          Length = 248

 Score =  137 bits (345), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 67/238 (28%), Positives = 115/238 (48%), Gaps = 7/238 (2%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDA---NLPHPFPVKTVPPQTIDKIVG 106
            ++G H V++ L + +  + ++        R   D           +     Q +DK+VG
Sbjct: 5   VIFGFHAVTSRLRHEASSVEEIYVDSERSDRRMQDLLKAAKAAGIRIIAADSQRLDKMVG 64

Query: 107 KEAVHQGLALETA----PLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGI 162
                  +A+         L   LD++  + LL+VLD + DPHN+GA LR A +     +
Sbjct: 65  TRRHQGVVAMAAPLSLARNLDELLDSIEGAPLLLVLDGITDPHNLGACLRVADSVGAHAV 124

Query: 163 ITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQ 222
           I  K  S   +A + K ASGA E +PYI ++NL   L+++       +G + DS K L +
Sbjct: 125 IAPKDRSAGINATVEKVASGAAETVPYITVTNLARTLRQLKERDIWVVGTADDSDKSLYE 184

Query: 223 EIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
                  A ++G+EG+G+R  T+ET   +  + M G +++LN+S A+ + LY  +   
Sbjct: 185 PDYAGGTAFVMGSEGEGMRRLTKETCDELVAIPMFGSVESLNISVASGICLYEARRQR 242


>gi|313668627|ref|YP_004048911.1| RNA methylase [Neisseria lactamica ST-640]
 gi|313006089|emb|CBN87550.1| putative RNA methylase [Neisseria lactamica 020-06]
          Length = 250

 Score =  137 bits (345), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 72/238 (30%), Positives = 113/238 (47%), Gaps = 9/238 (3%)

Query: 51  LYGVHTVSAALNNPSRKIFQLLATK---NALARLDWDANLPHPFPVKTVPPQTIDKIVGK 107
           +YG H V+A L    + I +L   +   +A  R   +        V  V    +D I  K
Sbjct: 7   IYGFHAVNARLWQNPKSITELYIQEGKSDARTREVLEKAANENIRVYFVDTTRLDAIS-K 65

Query: 108 EAVHQGLALET-----APLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGI 162
            A HQG+A           L   L+ +    LL++LD + DPHN+GA LR+A A     +
Sbjct: 66  GARHQGVAGFIDASKNHVHLEDVLENLSEPPLLLILDGITDPHNLGACLRTADAMGVHAV 125

Query: 163 ITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQ 222
           I  K  S   +A ++K A GA E +PYI ++NL   L+++  +G   IG     +  L  
Sbjct: 126 IAPKDKSAGLNATVSKVACGAAETVPYITVTNLARTLRELKEYGIWIIGTDMGGESDLYH 185

Query: 223 EIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
               D  A ++G EG G+R  T+E    +  + M G ++++NVS +A + L  T+   
Sbjct: 186 CNLPDSAAWVMGNEGGGMRRLTREHCDMLVSIPMFGTVESMNVSVSAGMVLSETRRQR 243


>gi|206580783|ref|YP_002240863.1| RNA methyltransferase, TrmH family, group 3 [Klebsiella pneumoniae
           342]
 gi|290512258|ref|ZP_06551625.1| RNA methyltransferase, TrmH family, group 3 [Klebsiella sp. 1_1_55]
 gi|206569841|gb|ACI11617.1| RNA methyltransferase, TrmH family, group 3 [Klebsiella pneumoniae
           342]
 gi|289775253|gb|EFD83254.1| RNA methyltransferase, TrmH family, group 3 [Klebsiella sp. 1_1_55]
          Length = 243

 Score =  137 bits (345), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 68/243 (27%), Positives = 111/243 (45%), Gaps = 10/243 (4%)

Query: 48  NLFLYGVHTVSAALNNPSRKIFQLLATKNALARLD---WDANLPHPFPVKTVPPQTIDKI 104
           +  +YG+H V A L     +  ++   K    +       A       ++    Q +D+ 
Sbjct: 2   SEMIYGIHAVQALLERAPERFQEVYILKGREDKRLLPLIHALEAQGVVIQVANRQFLDEK 61

Query: 105 VGKEAVHQGLALETAPLLSP------TLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFS 158
             + AVHQG+     P           L A  +   L++LD V DPHN+GA LRSA A  
Sbjct: 62  S-EGAVHQGIIARVKPGRQYQENDLPDLLAQHDQPFLLILDGVTDPHNLGACLRSADAAG 120

Query: 159 CDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKK 218
              +I  K  S   +A   K A GA E++P IR++NL   ++ +       +G + ++  
Sbjct: 121 VHAVIVPKDRSAQLNATAKKVACGAAENVPLIRVTNLARTMRLLQEANVWIVGTAGEADH 180

Query: 219 PLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQN 278
            L Q      +AL++GAEG+G+R  T+E    +  + M G + +LNVS A  + L+    
Sbjct: 181 TLFQSKMTGPMALVMGAEGEGMRRLTREHCDELISIPMAGSVSSLNVSVATGICLFEAVR 240

Query: 279 HFA 281
             +
Sbjct: 241 QRS 243


>gi|163756791|ref|ZP_02163900.1| 23S rRNA methyltransferase [Kordia algicida OT-1]
 gi|161323180|gb|EDP94520.1| 23S rRNA methyltransferase [Kordia algicida OT-1]
          Length = 268

 Score =  137 bits (345), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 46/260 (17%), Positives = 93/260 (35%), Gaps = 6/260 (2%)

Query: 26  NHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKN--ALARLDW 83
            +   K +    +KSR   +     L G   ++ AL   +  I  LL      +  R+  
Sbjct: 9   QNTTIKHILQLQEKSRSRKKEGKCILEGFRELTLALE-GNYAIDTLLFYPEICSYERIQE 67

Query: 84  DANLPHPFP-VKTVPPQTIDKIVGKEAVHQG-LALETAPLLSPTLDAVRNSQLLMVLDHV 141
                   P    +  +   KI  + +       ++T      T+     + L++V +  
Sbjct: 68  LLATAKNTPECIEISKEVYQKIAYRGSTEGVLAIIQTKEHSLKTITFHNKTPLILVAEAP 127

Query: 142 NDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQK 201
             P NIGA+LR+A A + D +                 +S        I + +  + +  
Sbjct: 128 EKPGNIGALLRTADAANIDAVFI-ANPKTDLYNPNIVRSSVGCVFTTQIAMGSTAEIISF 186

Query: 202 MHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIK 261
           +          +  + +    +      A+++G E  GL  +    +T    + M G I 
Sbjct: 187 LQEKDIAIYCAALTASEHYHLQNYQKATAIVVGTEATGLSDEWLNNSTQNIIIPMQGKID 246

Query: 262 ALNVSNAAAVALYITQNHFA 281
           ++NVS AAA+ ++  +   +
Sbjct: 247 SMNVSVAAAIVIFEAKRQRS 266


>gi|288937520|ref|YP_003441579.1| RNA methyltransferase, TrmH family, group 3 [Klebsiella variicola
           At-22]
 gi|288892229|gb|ADC60547.1| RNA methyltransferase, TrmH family, group 3 [Klebsiella variicola
           At-22]
          Length = 243

 Score =  137 bits (345), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 68/243 (27%), Positives = 111/243 (45%), Gaps = 10/243 (4%)

Query: 48  NLFLYGVHTVSAALNNPSRKIFQLLATKNALARLD---WDANLPHPFPVKTVPPQTIDKI 104
           +  +YG+H V A L     +  ++   K    +       A       ++    Q +D+ 
Sbjct: 2   SEMIYGIHAVQALLERAPERFQEVYILKGREDKRLLPLIHALEAQGVVIQVANRQFLDEK 61

Query: 105 VGKEAVHQGLALETAPLLSP------TLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFS 158
             + AVHQG+     P           L A  +   L++LD V DPHN+GA LRSA A  
Sbjct: 62  S-EGAVHQGVIARVKPGRQYQENDLPDLLAQHDQPFLLILDGVTDPHNLGACLRSADAAG 120

Query: 159 CDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKK 218
              +I  K  S   +A   K A GA E++P IR++NL   ++ +       +G + ++  
Sbjct: 121 VHAVIVPKDRSAQLNATAKKVACGAAENVPLIRVTNLARTMRLLQEANVWIVGTAGEADH 180

Query: 219 PLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQN 278
            L Q      +AL++GAEG+G+R  T+E    +  + M G + +LNVS A  + L+    
Sbjct: 181 TLFQSKMTGPMALVMGAEGEGMRRLTREHCDELISIPMAGSVSSLNVSVATGICLFEAVR 240

Query: 279 HFA 281
             +
Sbjct: 241 QRS 243


>gi|268601172|ref|ZP_06135339.1| RNA methyltransferase [Neisseria gonorrhoeae PID18]
 gi|291044000|ref|ZP_06569716.1| RNA methyltransferase [Neisseria gonorrhoeae DGI2]
 gi|268585303|gb|EEZ49979.1| RNA methyltransferase [Neisseria gonorrhoeae PID18]
 gi|291012463|gb|EFE04452.1| RNA methyltransferase [Neisseria gonorrhoeae DGI2]
          Length = 255

 Score =  137 bits (345), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 69/238 (28%), Positives = 111/238 (46%), Gaps = 9/238 (3%)

Query: 51  LYGVHTVSAALNNPSRKIFQLLATK---NALARLDWDANLPHPFPVKTVPPQTIDKIVGK 107
           +YG H V+A L    + I +L   +   +A  R   +        V       ++ I  K
Sbjct: 12  IYGFHAVNARLWQNPKSITELYIQEGKSDARTREVLEKAANENIRVYFADADRLNAIS-K 70

Query: 108 EAVHQGLALET-----APLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGI 162
            A HQG+            L   L+ +    LL++LD + DPHN+GA LR+A A     +
Sbjct: 71  GARHQGVVGFIDASKNHVHLEDVLENLSEPPLLLILDGITDPHNLGACLRTADAMGVHAV 130

Query: 163 ITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQ 222
           I  K  S   +A ++K A GA E +PYI ++NL   L+++  +G   IG     +  L  
Sbjct: 131 IAPKDKSAGLNATVSKVACGAAETVPYITVTNLARTLRELKEYGIWIIGTDMGGESDLYH 190

Query: 223 EIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
               D  A ++G EG G+R  T+E    +  + M G ++++NVS +A + L  T+   
Sbjct: 191 CNLPDSTAWVMGNEGDGMRRLTREHCDMLVSIPMFGTVESMNVSVSAGMVLSETRRQR 248


>gi|225076451|ref|ZP_03719650.1| hypothetical protein NEIFLAOT_01497 [Neisseria flavescens
           NRL30031/H210]
 gi|224952130|gb|EEG33339.1| hypothetical protein NEIFLAOT_01497 [Neisseria flavescens
           NRL30031/H210]
          Length = 249

 Score =  137 bits (345), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 69/239 (28%), Positives = 111/239 (46%), Gaps = 9/239 (3%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLATK---NALARLDWDANLPHPFPVKTVPPQTIDKIVG 106
            +YG H V+A L    + I +L   +   +A  R   D        V       ++ I  
Sbjct: 6   LIYGFHAVNARLWQNPKSITELYIQEGKSDARTRDVLDKAASENVRVHFADADRLNAIS- 64

Query: 107 KEAVHQGLALET-----APLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDG 161
           K A HQG+            L   L+ +     L+VLD + DPHN+GA LR+A A     
Sbjct: 65  KGARHQGVVGFIDASKNHVHLEDVLENLSEPPFLLVLDGITDPHNLGACLRTADAMGVHA 124

Query: 162 IITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLE 221
           +I  K  S   +A ++K A GA E +PYI ++NL   L+++  +G   +G        L 
Sbjct: 125 VIAPKDKSAGLNATVSKVACGAAETVPYITVTNLARTLRELKEYGIWIVGTDMGGDSDLY 184

Query: 222 QEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
                D +A ++G EG+G+R  T+E    +  + M G ++++NVS +A + L  T+   
Sbjct: 185 HCDLPDSVAWVMGNEGEGMRRLTREHCDMLISIPMFGTVESMNVSVSAGMVLSETRRQR 243


>gi|300715048|ref|YP_003739851.1| 23S rRNA (guanosine-2\'-O-)-methyltransferase [Erwinia billingiae
           Eb661]
 gi|299060884|emb|CAX57991.1| 23S rRNA (Guanosine-2\'-O-)-methyltransferase [Erwinia billingiae
           Eb661]
          Length = 245

 Score =  137 bits (345), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 67/243 (27%), Positives = 112/243 (46%), Gaps = 10/243 (4%)

Query: 48  NLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDW---DANLPHPFPVKTVPPQTIDKI 104
           +  ++G+H V A L++  ++  ++   K    +               V+    Q +D  
Sbjct: 2   SEIVFGIHAVKALLDSSPQRFQEVFILKGRDDKRLQPLVKELEAQGIVVQIANRQWLDSQ 61

Query: 105 VGKEAVHQGLALETAPLLSP------TLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFS 158
           V +  VHQG+     P           L    +S  L++LD + DPHN+GA LRSA A  
Sbjct: 62  V-EGGVHQGIVARVKPGRQYQESDLPDLLESLDSPFLLILDGITDPHNLGACLRSADAAG 120

Query: 159 CDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKK 218
              +I  +  S   +A   K ASGA EH+P I ++NL   ++ +       +G + ++  
Sbjct: 121 VHAVIVPRDRSAQLNATAKKVASGAAEHVPLITVTNLARTMRVLQDANVWIVGTAGEADH 180

Query: 219 PLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQN 278
            L Q      +AL++GAEG+G+R  T+E    +  + M G + +LNVS A  V L+    
Sbjct: 181 NLYQSKMTGPMALVMGAEGEGMRRLTREHCDELISIPMSGSVSSLNVSVATGVCLFEAVR 240

Query: 279 HFA 281
             +
Sbjct: 241 QRS 243


>gi|319899065|ref|YP_004159158.1| tRNA/rRNA metyltransferase [Bartonella clarridgeiae 73]
 gi|319403029|emb|CBI76584.1| tRNA/rRNA metyltransferase [Bartonella clarridgeiae 73]
          Length = 271

 Score =  137 bits (345), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 135/266 (50%), Positives = 177/266 (66%), Gaps = 4/266 (1%)

Query: 16  KDSHYAKLRRNHRDYKKMQSFNQKSRHTS-QPENLFLYGVHTVSAALNNPSRKIFQLLAT 74
           KDSHYA+LRR +RD K      Q S H   Q E ++LYG+H V AAL NP R +  L AT
Sbjct: 7   KDSHYARLRRQYRDTKGF--LFQSSTHPKLQKEKIYLYGIHPVRAALKNPRRILRHLYAT 64

Query: 75  KNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQL 134
            NAL RL+ + +     P+    P+ ++  VG EAVHQGL LET  L S +L  + N+ L
Sbjct: 65  PNALKRLNINESSLS-CPITLCLPKKLEAFVGNEAVHQGLVLETETLKSHSLSELTNTDL 123

Query: 135 LMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISN 194
           ++V+D + DPHN+GAI+RSAVAF    IITT R+SP ES VLAK+ASGALE I YI + N
Sbjct: 124 IIVMDQITDPHNVGAIMRSAVAFKAGAIITTNRHSPQESGVLAKAASGALELIEYITVQN 183

Query: 195 LTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHL 254
           L+ AL++++   F + GL S+ + PLE  +  +KI+L+LGAE KGLR KT+ET   +A L
Sbjct: 184 LSQALKELNQMNFISFGLDSEGELPLEIALTGNKISLVLGAESKGLRQKTRETVYKLARL 243

Query: 255 HMPGIIKALNVSNAAAVALYITQNHF 280
            MPG IK+LNVSNAA +ALY    + 
Sbjct: 244 DMPGDIKSLNVSNAATIALYAAHKYL 269


>gi|303228929|ref|ZP_07315739.1| RNA methyltransferase, TrmH family, group 3 [Veillonella atypica
           ACS-134-V-Col7a]
 gi|302516343|gb|EFL58275.1| RNA methyltransferase, TrmH family, group 3 [Veillonella atypica
           ACS-134-V-Col7a]
          Length = 245

 Score =  137 bits (345), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 57/239 (23%), Positives = 110/239 (46%), Gaps = 8/239 (3%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLATKNALARLDWD--ANLPHPFPVKTVPPQTIDKIVGK 107
           ++ G + V  AL         L++       L             V+  P + +++    
Sbjct: 4   YIVGRNAVKEALKAGRSIQRILVSDDKIKTGLSDIVGLAKSKGIEVRPTPVKQMNRY-ET 62

Query: 108 EAVHQGLALETAPLLSPTL-----DAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGI 162
           +  HQG+      +    L     ++   + LL++ D V DPHN+GAI+R+A       +
Sbjct: 63  DVPHQGVIAFVNAVEFKDLGEVLQESNHENPLLILTDGVEDPHNMGAIIRTAECVGATAV 122

Query: 163 ITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQ 222
           +  KR++   +A +AK+++GA+E IP +++ N+T  ++++   GF  +G   +  + L +
Sbjct: 123 LIPKRHNAPINATVAKTSAGAVEQIPLVQVGNVTQTIKQLQKQGFWVLGAHMEGDRTLYE 182

Query: 223 EIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHFA 281
                   L++G EGKG+    +E    +  + M G + +LN S AAA+ +Y       
Sbjct: 183 ADLTIPTVLVIGNEGKGISRVVKEACDFLVTIPMYGNLNSLNASVAAAILMYEAVRQRT 241


>gi|292670592|ref|ZP_06604018.1| 23S rRNA (guanosine-2'-O-)-methyltransferase RlmB [Selenomonas
           noxia ATCC 43541]
 gi|292647758|gb|EFF65730.1| 23S rRNA (guanosine-2'-O-)-methyltransferase RlmB [Selenomonas
           noxia ATCC 43541]
          Length = 272

 Score =  137 bits (344), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 69/262 (26%), Positives = 116/262 (44%), Gaps = 10/262 (3%)

Query: 28  RDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLAT--KNALARLDWDA 85
           R  K     +Q+     +  +  L G H V  A+         LLA     +  R   D 
Sbjct: 3   RRMKH-TEQHQRGTRPVEHRSDILAGRHAVMEAMKAGRGINRILLADGLHGSGVRELRDL 61

Query: 86  NLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDA-------VRNSQLLMVL 138
              +      V    +D  V +   HQG+    AP+   +++             LL++L
Sbjct: 62  AREYGVATDVVSRSKLDAAVPEGVRHQGVIAYAAPVSYVSVEEIIAAARARGEDPLLLLL 121

Query: 139 DHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDA 198
           D + DP N+GA+LR+A A    GI+  +R+S   +  +A+ ++GALE++P  RI N+   
Sbjct: 122 DGIEDPQNLGALLRTADAAGVHGILLPRRHSVPLTETVARVSAGALEYVPVARIGNIAQT 181

Query: 199 LQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPG 258
           ++ +   GF   G   D  +  ++      + L++G+EG+G+   T+E       L M G
Sbjct: 182 MRALKEQGFWIAGADMDGTETYDRANLTGALVLVIGSEGRGMSRLTREICDFTVRLPMCG 241

Query: 259 IIKALNVSNAAAVALYITQNHF 280
            I +LN S A A+ +Y  Q   
Sbjct: 242 KINSLNASAAGAILMYEAQRQR 263


>gi|317123114|ref|YP_004103117.1| RNA methyltransferase, TrmH family, group 3 [Thermaerobacter
           marianensis DSM 12885]
 gi|315593094|gb|ADU52390.1| RNA methyltransferase, TrmH family, group 3 [Thermaerobacter
           marianensis DSM 12885]
          Length = 298

 Score =  137 bits (344), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 57/238 (23%), Positives = 101/238 (42%), Gaps = 8/238 (3%)

Query: 51  LYGVHTVSAAL--NNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKE 108
           + G   V   L   +P  ++      + A              PV+ V P  I++    +
Sbjct: 51  VEGRRPVLELLGSAHPVHRVLVARGRRGAAIAELEQRARARGVPVEEVDPVEIERRAQTD 110

Query: 109 AVHQGLALETAPLLSPTLDAVR------NSQLLMVLDHVNDPHNIGAILRSAVAFSCDGI 162
                LAL         LD +          LL++   + DPHN+GA+ R+A A    G 
Sbjct: 111 THQGVLALAAPLPRYDLLDLLDRAAGAGQPPLLVICAEIQDPHNLGAVFRTAEAAGAHGA 170

Query: 163 ITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQ 222
           +     S    A + KS++GAL H+P   ++NL  +++++   G   +    +  +P ++
Sbjct: 171 VVPVHRSAPLGATVFKSSAGALVHLPVAEVTNLARSVEQLKERGVWVVAADPEGAEPYDR 230

Query: 223 EIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
                 +A++LG+EG+G+ P  +        + M G + +LNVS AA V L+      
Sbjct: 231 WDWTQPVAVVLGSEGRGVPPLVRRRCDGRVTIPMAGRVGSLNVSVAAGVLLFEAARQR 288


>gi|309704685|emb|CBJ04035.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Escherichia coli ETEC
           H10407]
          Length = 243

 Score =  137 bits (344), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 62/242 (25%), Positives = 104/242 (42%), Gaps = 8/242 (3%)

Query: 48  NLFLYGVHTVSAALNNPSRKIFQLLATKNALARLD---WDANLPHPFPVKTVPPQTIDKI 104
           +  +YG+H V A L     +  ++   K    +       A       ++    Q +D+ 
Sbjct: 2   SEIIYGIHAVQALLERAPERFQEVFILKGREDKRLLPLIHALESQGVVIQLANRQYLDEK 61

Query: 105 VGKEAVHQGLALETAPLLSPTLDAVR-----NSQLLMVLDHVNDPHNIGAILRSAVAFSC 159
                    +A           D        +   L++LD V DPHN+GA LRSA A   
Sbjct: 62  SDGAVHQGIIARVKPGRQYQENDLPDLIASLDQPFLLILDGVTDPHNLGACLRSADAAGV 121

Query: 160 DGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKP 219
             +I  K  S   +A   K A GA E +P IR++NL   ++ +       +G + ++   
Sbjct: 122 HAVIVPKDRSAQLNATAKKVACGAAESVPLIRVTNLARTMRMLQEENIWIVGTAGEADHT 181

Query: 220 LEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNH 279
           L Q     ++AL++GAEG+G+R  T+E    +  + M G + +LNVS A  + L+     
Sbjct: 182 LYQSKMTGRLALVMGAEGEGMRRLTREHCDELISIPMAGSVSSLNVSVATGICLFEAVRQ 241

Query: 280 FA 281
            +
Sbjct: 242 RS 243


>gi|253999430|ref|YP_003051493.1| TrmH family RNA methyltransferase [Methylovorus sp. SIP3-4]
 gi|253986109|gb|ACT50966.1| RNA methyltransferase, TrmH family, group 3 [Methylovorus sp.
           SIP3-4]
          Length = 249

 Score =  137 bits (344), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 73/242 (30%), Positives = 113/242 (46%), Gaps = 10/242 (4%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLATKNALA-RLDWDANLPHPFPVKT--VPPQTIDKIVG 106
            L+G H V + L   +  + ++L  K+ +  R+    NL     V+   V    +D + G
Sbjct: 6   ILFGFHAVLSRLRQHAASVQEILIDKDRVDARMKDLINLAEGASVRLMQVERSRLDGMAG 65

Query: 107 KEAVHQGLALETAPLLSPTLDAVR-------NSQLLMVLDHVNDPHNIGAILRSAVAFSC 159
               HQG+         P  D               +VLD V DPHN+GA LR A A   
Sbjct: 66  ANGRHQGVIARVVDTPIPYKDIHDILESDLTEPPFFLVLDGVEDPHNLGACLRVADAMGV 125

Query: 160 DGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKP 219
             +I  K  +   +A + K A GA E IP+I ++NL   L+++   G   +G ++D+   
Sbjct: 126 HAVIAPKDRAAGLNATVRKVACGAAETIPFIAVTNLARTLRELQEAGVFVVGAAADAPGN 185

Query: 220 LEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNH 279
           L        +AL+LGAEG GLR  T ET  ++  + M G +++LNVS A+ + LY  +  
Sbjct: 186 LFTTKLAGPLALVLGAEGAGLRRLTAETCDTLVSIPMFGSVESLNVSVASGICLYEARRQ 245

Query: 280 FA 281
             
Sbjct: 246 RN 247


>gi|240123348|ref|ZP_04736304.1| RNA methyltransferase [Neisseria gonorrhoeae PID332]
 gi|240128052|ref|ZP_04740713.1| RNA methyltransferase [Neisseria gonorrhoeae SK-93-1035]
          Length = 250

 Score =  137 bits (344), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 69/238 (28%), Positives = 111/238 (46%), Gaps = 9/238 (3%)

Query: 51  LYGVHTVSAALNNPSRKIFQLLATK---NALARLDWDANLPHPFPVKTVPPQTIDKIVGK 107
           +YG H V+A L    + I +L   +   +A  R   +        V       ++ I  K
Sbjct: 7   IYGFHAVNARLWQNPKSITELYIQEGKSDARTREVLEKAANENIRVYFADADRLNAIS-K 65

Query: 108 EAVHQGLALET-----APLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGI 162
            A HQG+            L   L+ +    LL++LD + DPHN+GA LR+A A     +
Sbjct: 66  GARHQGVVGFIDASKNHVHLEDILENLSEPPLLLILDGITDPHNLGACLRTADAMGVHAV 125

Query: 163 ITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQ 222
           I  K  S   +A ++K A GA E +PYI ++NL   L+++  +G   IG     +  L  
Sbjct: 126 IAPKDKSAGLNATVSKVACGAAETVPYITVTNLARTLRELKEYGIWIIGTDMGGESDLYH 185

Query: 223 EIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
               D  A ++G EG G+R  T+E    +  + M G ++++NVS +A + L  T+   
Sbjct: 186 CNLPDSTAWVMGNEGDGMRRLTREHCDMLVSIPMFGTVESMNVSVSAGMVLSETRRQR 243


>gi|240080889|ref|ZP_04725432.1| RNA methylase [Neisseria gonorrhoeae FA19]
 gi|240112748|ref|ZP_04727238.1| RNA methylase [Neisseria gonorrhoeae MS11]
 gi|240117794|ref|ZP_04731856.1| RNA methylase [Neisseria gonorrhoeae PID1]
 gi|254493607|ref|ZP_05106778.1| RNA methylase [Neisseria gonorrhoeae 1291]
 gi|268597006|ref|ZP_06131173.1| 23S rRNA (guanosine-2'-O-)-methyltransferase rlmB [Neisseria
           gonorrhoeae FA19]
 gi|268598815|ref|ZP_06132982.1| RNA methylase [Neisseria gonorrhoeae MS11]
 gi|226512647|gb|EEH61992.1| RNA methylase [Neisseria gonorrhoeae 1291]
 gi|268550794|gb|EEZ45813.1| 23S rRNA (guanosine-2'-O-)-methyltransferase rlmB [Neisseria
           gonorrhoeae FA19]
 gi|268582946|gb|EEZ47622.1| RNA methylase [Neisseria gonorrhoeae MS11]
          Length = 250

 Score =  137 bits (344), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 69/238 (28%), Positives = 110/238 (46%), Gaps = 9/238 (3%)

Query: 51  LYGVHTVSAALNNPSRKIFQLLATK---NALARLDWDANLPHPFPVKTVPPQTIDKIVGK 107
           +YG H V+A L    + I +L   +   +A  R   +        V       ++ I  K
Sbjct: 7   IYGFHAVNARLWQNPKSITELYIQEGKSDARTREVLEKAANENIRVYFADADRLNAIS-K 65

Query: 108 EAVHQGLALET-----APLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGI 162
            A HQG+            L   L+ +    LL++LD + DPHN+GA LR+A A     +
Sbjct: 66  GARHQGVVGFIDASKNHVHLEGILENLSEPPLLLILDGITDPHNLGACLRTADAMGVHAV 125

Query: 163 ITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQ 222
           I  K  S   +A ++K A GA E +PYI ++NL   L+++  +G   IG        L  
Sbjct: 126 IAPKDKSAGLNATVSKVACGAAETVPYITVTNLARTLRELKEYGIWIIGTDMGGDADLYH 185

Query: 223 EIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
               D  A ++G EG G+R  T+E    +  + M G ++++NVS +A + L  T+   
Sbjct: 186 CNLPDSTAWVMGNEGDGMRRLTREHCDMLVSIPMFGTVESMNVSVSAGMVLSETRRQR 243


>gi|330720741|gb|EGG98965.1| 23S rRNA (guanosine-2'-O-) -methyltransferase rlmB [gamma
           proteobacterium IMCC2047]
          Length = 244

 Score =  137 bits (344), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 63/245 (25%), Positives = 108/245 (44%), Gaps = 12/245 (4%)

Query: 48  NLFLYGVHTVSAALNNPSRKIFQLLATKNALA---RLDWDANLPHPFPVKTVPPQTIDKI 104
              ++G+H V A L   + ++ ++L  ++      R            V  V    +++ 
Sbjct: 1   MEIVFGIHAVQALLQRNAGRVERVLIQQDKFNGRVRELMQLANKKKVRVDQVDRDELEQH 60

Query: 105 VGKEAVHQGLALETAPLLS------PTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFS 158
                 HQG+        S        L    +  L++VLD V D HN+GA LRSA A  
Sbjct: 61  AD--GNHQGVVAICKNQKSLNEADLDQLLEEVSQPLVLVLDGVTDTHNLGACLRSADAAG 118

Query: 159 CDGIITTKRYSPSESAVLAKSASGALEHIPYIRISN-LTDALQKMHSWGFQTIGLSSDSK 217
              ++  K  S   ++V++K ASGA E +P+++++N             + T     +S 
Sbjct: 119 VTAVVVPKDNSADLNSVVSKVASGAAETLPFVKVTNLARTMKAMQDRGLWITGTAVDESS 178

Query: 218 KPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQ 277
           +PL +        +++G+EGKG+R  TQE    + ++ M G + +LNVS A  V L+   
Sbjct: 179 RPLYEADLTGPRVIVMGSEGKGMRRLTQEHCDELVYIPMAGEVSSLNVSVATGVCLFEAV 238

Query: 278 NHFAK 282
               K
Sbjct: 239 RQRVK 243


>gi|87120578|ref|ZP_01076472.1| RNA methyltransferase, TrmH family, group 3 [Marinomonas sp.
           MED121]
 gi|86164221|gb|EAQ65492.1| RNA methyltransferase, TrmH family, group 3 [Marinomonas sp.
           MED121]
          Length = 270

 Score =  137 bits (344), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 62/254 (24%), Positives = 116/254 (45%), Gaps = 13/254 (5%)

Query: 41  RHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDW---DANLPHPFPVKTVP 97
           +  +  +  ++YG+H V   L     +I ++   +    +      +    +      V 
Sbjct: 13  KKITMSDLEWVYGIHAVENLLLQQPERIKEIRFQEGRDDKKIKRLLNLCRENGIKANVVA 72

Query: 98  PQTIDKI---VGKEAVHQGLALETAP-------LLSPTLDAVRNSQLLMVLDHVNDPHNI 147
            + ID++     +  VHQG+A             L   ++ +    L+++LD + DPHN+
Sbjct: 73  RREIDQLFKASQERVVHQGVAAFAKMTRSQDEADLYKLVENLDEPPLIIILDGITDPHNL 132

Query: 148 GAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGF 207
           GA LRSA A     ++  K  S   +A ++K A GA E +P   ++NL   ++K+   G 
Sbjct: 133 GACLRSADAAGAHALVMPKDKSAPLNATVSKVACGAAESMPVYAVTNLARTMKKLQDKGV 192

Query: 208 QTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSN 267
              G + ++ + + ++      A+++GAEG G+R  T+E    +  L M G++ +LNVS 
Sbjct: 193 WIFGTAGEASQTIYEQDLTIPSAIVMGAEGDGMRRLTREQCDYLVKLPMAGVVSSLNVSV 252

Query: 268 AAAVALYITQNHFA 281
           A  + LY       
Sbjct: 253 ATGICLYEAVRQRI 266


>gi|289422574|ref|ZP_06424417.1| RNA methyltransferase, TrmH family, group 3 [Peptostreptococcus
           anaerobius 653-L]
 gi|289157146|gb|EFD05768.1| RNA methyltransferase, TrmH family, group 3 [Peptostreptococcus
           anaerobius 653-L]
          Length = 244

 Score =  137 bits (344), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 58/242 (23%), Positives = 110/242 (45%), Gaps = 13/242 (5%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDA---NLPHPFPVKTVPPQTIDKIVG 106
            + G + V  AL N  R I +++  K +              +   ++ V    +D++  
Sbjct: 3   LIEGRNPVIEALKNN-RPIEKIMVNKGSKEGSIKKIIGMAKDNNIIIQQVDRHKLDEMSE 61

Query: 107 KEAVHQGLALETAPLLSPTLDAV-------RNSQLLMVLDHVNDPHNIGAILRSAVAFSC 159
             A HQG+   T+  +   L  +             ++LD + DPHN+G+I+R+A A   
Sbjct: 62  SHA-HQGVIALTSDYVYYELSDILKKAREKEEDPFFIILDGITDPHNLGSIIRTADAVGA 120

Query: 160 DGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKP 219
            GII  KR S   + ++AK+++GA+E++P  +++N+ + ++++   G             
Sbjct: 121 HGIIIPKRRSVHITPIVAKASAGAVEYVPVCKVTNIVNTIKQLKEEGLWIA-AVDMGGDA 179

Query: 220 LEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNH 279
             Q      +AL++G+EG+G+   T+E       + M G + +LN S A  + LY     
Sbjct: 180 FYQTNLTGPLALVVGSEGEGISRLTKENCDFTVSMPMSGNVTSLNASVAGGILLYEVYRQ 239

Query: 280 FA 281
             
Sbjct: 240 RN 241


>gi|209921669|ref|YP_002295753.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Escherichia coli
           SE11]
 gi|209914928|dbj|BAG80002.1| putative RNA methyltransferase [Escherichia coli SE11]
          Length = 243

 Score =  137 bits (344), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 63/242 (26%), Positives = 105/242 (43%), Gaps = 8/242 (3%)

Query: 48  NLFLYGVHTVSAALNNPSRKIFQLLATKNALAR---LDWDANLPHPFPVKTVPPQTIDKI 104
           +  +YG+H V A L     +  ++   K    +   L   A       ++    Q +D+ 
Sbjct: 2   SEMIYGIHAVQALLERAPERFQEVFILKGREDKRLLLLIHALESQGVVIQLANRQYLDEK 61

Query: 105 VGKEAVHQGLALETAPLLSPTLDAVR-----NSQLLMVLDHVNDPHNIGAILRSAVAFSC 159
                    +A           D        +   L++LD V DPHN+GA LRSA A   
Sbjct: 62  SDGAVHQGIIARVKPGRQYQENDLPDLIASLDQPFLLILDGVTDPHNLGACLRSADAAGV 121

Query: 160 DGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKP 219
             +I  K  S   +A   K A GA E +P IR++NL   ++ +       +G + ++   
Sbjct: 122 HAVIVPKDRSAQLNATAKKVACGAAESVPLIRVTNLARTMRMLQEENIWIVGTAGEADHT 181

Query: 220 LEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNH 279
           L Q     ++AL++GAEG+G+R  T+E    +  + M G + +LNVS A  + L+     
Sbjct: 182 LYQSKMTGRLALVMGAEGEGMRRLTREHCDELISIPMAGSVSSLNVSVATGICLFEAVRQ 241

Query: 280 FA 281
            +
Sbjct: 242 RS 243


>gi|160934427|ref|ZP_02081814.1| hypothetical protein CLOLEP_03300 [Clostridium leptum DSM 753]
 gi|156867100|gb|EDO60472.1| hypothetical protein CLOLEP_03300 [Clostridium leptum DSM 753]
          Length = 270

 Score =  137 bits (344), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 51/258 (19%), Positives = 96/258 (37%), Gaps = 4/258 (1%)

Query: 24  RRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDW 83
            + +   K      + ++   Q E     GV     A  +  R I ++  T+ AL R   
Sbjct: 7   SKENPAVKHAARLLKSAKFRRQEEAFLAEGVRLCRDAAYSGVR-ILRMFYTEEALERYPK 65

Query: 84  DANLPHPF--PVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDHV 141
           D  L          +  Q    +           +      +  LD +  S  L+ L+ +
Sbjct: 66  DVELLREKAERAFLLSQQLAGGLSATVTPQGIFCVCAMLDKTDCLDKMDASGQLLGLEDI 125

Query: 142 NDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYI-RISNLTDALQ 200
            DP N+G +LR+A A    G+I T+      S  + + + GA+  +P     +       
Sbjct: 126 QDPSNLGTVLRTAEALGIGGVILTRGCCDIYSPKVLRGSMGAVFRLPMALVETMPPAVNA 185

Query: 201 KMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGII 260
                      +     +P+ Q + +    +++G EG GL+P+T         + M G  
Sbjct: 186 LEQKGFVTMAAVPDREAEPITQVLFSSPSIVLVGNEGNGLKPETIRACQRRVTIPMLGRA 245

Query: 261 KALNVSNAAAVALYITQN 278
           ++LN S AA++ ++    
Sbjct: 246 ESLNASVAASLLMWEMMR 263


>gi|295398832|ref|ZP_06808826.1| TrmH family RNA methyltransferase [Aerococcus viridans ATCC 11563]
 gi|294972922|gb|EFG48755.1| TrmH family RNA methyltransferase [Aerococcus viridans ATCC 11563]
          Length = 264

 Score =  137 bits (344), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 49/253 (19%), Positives = 103/253 (40%), Gaps = 4/253 (1%)

Query: 26  NHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDA 85
            ++  K+++    + +   +     L G H V  A+   +         +++   +    
Sbjct: 10  QNQQIKELKKLFTR-KGRKKAGQYLLEGPHLVEMAVKADAEIQMIYYVPESSHQNVMQIQ 68

Query: 86  NLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDHVNDPH 145
            L    P+  V P+    +   +  HQ +        + +LD  + ++ L++LD V DP 
Sbjct: 69  ALKADLPLTQVTPEVAKALSQTD-HHQDIFAVANIPQAKSLDIDQLTKGLLILDQVQDPG 127

Query: 146 NIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSW 205
           N+G ++R+A AF    ++         +  + +S  G+   +    +  +    Q   + 
Sbjct: 128 NLGTLIRTADAFGYRDVLLGLGTVDLYNDKVLRSMQGSHFAVNTYEVDLVEVIPQLQEAG 187

Query: 206 GFQTIGLSSDSKKPLEQEIKN--DKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKAL 263
            F T    ++  K           K AL++G EG G+   T + A +  ++ M G  ++L
Sbjct: 188 YFITTTELNNQAKASNAFDLKSKGKWALVMGNEGNGVSQTTSQLADAALYIPMSGSAESL 247

Query: 264 NVSNAAAVALYIT 276
           NV+ A A+ +Y  
Sbjct: 248 NVAVAGAIVMYQF 260


>gi|268603493|ref|ZP_06137660.1| RNA methylase [Neisseria gonorrhoeae PID1]
 gi|268587624|gb|EEZ52300.1| RNA methylase [Neisseria gonorrhoeae PID1]
          Length = 255

 Score =  137 bits (344), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 69/238 (28%), Positives = 110/238 (46%), Gaps = 9/238 (3%)

Query: 51  LYGVHTVSAALNNPSRKIFQLLATK---NALARLDWDANLPHPFPVKTVPPQTIDKIVGK 107
           +YG H V+A L    + I +L   +   +A  R   +        V       ++ I  K
Sbjct: 12  IYGFHAVNARLWQNPKSITELYIQEGKSDARTREVLEKAANENIRVYFADADRLNAIS-K 70

Query: 108 EAVHQGLALET-----APLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGI 162
            A HQG+            L   L+ +    LL++LD + DPHN+GA LR+A A     +
Sbjct: 71  GARHQGVVGFIDASKNHVHLEGILENLSEPPLLLILDGITDPHNLGACLRTADAMGVHAV 130

Query: 163 ITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQ 222
           I  K  S   +A ++K A GA E +PYI ++NL   L+++  +G   IG        L  
Sbjct: 131 IAPKDKSAGLNATVSKVACGAAETVPYITVTNLARTLRELKEYGIWIIGTDMGGDADLYH 190

Query: 223 EIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
               D  A ++G EG G+R  T+E    +  + M G ++++NVS +A + L  T+   
Sbjct: 191 CNLPDSTAWVMGNEGDGMRRLTREHCDMLVSIPMFGTVESMNVSVSAGMVLSETRRQR 248


>gi|284047633|ref|YP_003397972.1| RNA methyltransferase, TrmH family, group 3 [Acidaminococcus
           fermentans DSM 20731]
 gi|283951854|gb|ADB46657.1| RNA methyltransferase, TrmH family, group 3 [Acidaminococcus
           fermentans DSM 20731]
          Length = 250

 Score =  137 bits (344), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 66/243 (27%), Positives = 113/243 (46%), Gaps = 10/243 (4%)

Query: 48  NLFLYGVHTVSAALNN--PSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIV 105
             F+ G + V  AL +  P  K+     +         +       PV+ V  + +D++ 
Sbjct: 2   EEFIVGRNAVREALRSRRPFNKVLVQEGSHGGSLSEILELAQEQKIPVEKVSREVLDRLA 61

Query: 106 GKEAVHQGLALETAPLLSPTLDA-------VRNSQLLMVLDHVNDPHNIGAILRSAVAFS 158
                HQG+A + AP+    LD             LL++LD + DP N+GA++R+A A  
Sbjct: 62  DGVR-HQGVAAQGAPVAFQDLDTVLARVESRGEVPLLLLLDELQDPQNVGALIRTANAAG 120

Query: 159 CDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKK 218
             G++  +R S   +AV+AK ++GA+E++P I+I N+   ++++   GF   G   D + 
Sbjct: 121 VHGVLLPQRRSCPLNAVVAKISAGAIEYVPVIQIGNIPQTMKQLKKRGFWIAGADMDGED 180

Query: 219 PLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQN 278
                     + L++GAEGKGL    +E    +  + M G + +LN S A  + LY    
Sbjct: 181 QYFDANLTGPMVLVVGAEGKGLGRLVKENCDFIVRIPMLGQVSSLNASVAGGILLYDIVR 240

Query: 279 HFA 281
              
Sbjct: 241 QRI 243


>gi|313896352|ref|ZP_07829905.1| RNA methyltransferase, TrmH family, group 3 [Selenomonas sp. oral
           taxon 137 str. F0430]
 gi|312975151|gb|EFR40613.1| RNA methyltransferase, TrmH family, group 3 [Selenomonas sp. oral
           taxon 137 str. F0430]
          Length = 266

 Score =  137 bits (344), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 63/241 (26%), Positives = 106/241 (43%), Gaps = 10/241 (4%)

Query: 50  FLYGVHTVSAALNNPS--RKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGK 107
            L G H ++ A+       +I        +  R   D    H   V  V    +D    +
Sbjct: 19  ILAGRHAITEAIKAGRGINRILIADGLHGSGVRELRDLARAHDITVDIVSRAKLDA-AAQ 77

Query: 108 EAVHQGLALETAPLLSPTLDA-------VRNSQLLMVLDHVNDPHNIGAILRSAVAFSCD 160
            A H G+    AP+    ++             LL++LD + DPHN+GA+LR+A A    
Sbjct: 78  GARHGGMLAYAAPVSYVPVEEIISSVRARGEEPLLLLLDGIEDPHNLGALLRTADAAGVH 137

Query: 161 GIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPL 220
           GI+  +R+S   +  +A+ ++GALE++P  RI N+   ++ +   GF   G         
Sbjct: 138 GILLPRRHSVPLTETVARVSAGALEYVPVTRIGNIAQTIRALKEDGFWIAGADMAGSDTY 197

Query: 221 EQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
           ++      + L++G+EG+G+   T+E       L M G I +LN S A A+ +Y      
Sbjct: 198 DKANLTGALVLVIGSEGRGMSRLTRELCDFTVRLPMRGKINSLNASVAGAILMYEAMRQR 257

Query: 281 A 281
            
Sbjct: 258 T 258


>gi|303231482|ref|ZP_07318212.1| RNA methyltransferase, TrmH family, group 3 [Veillonella atypica
           ACS-049-V-Sch6]
 gi|302513825|gb|EFL55837.1| RNA methyltransferase, TrmH family, group 3 [Veillonella atypica
           ACS-049-V-Sch6]
          Length = 245

 Score =  137 bits (344), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 56/239 (23%), Positives = 109/239 (45%), Gaps = 8/239 (3%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLATKNALARLDWD--ANLPHPFPVKTVPPQTIDKIVGK 107
           ++ G + V  AL         L++       L             V+  P + +++    
Sbjct: 4   YIVGRNAVKEALKAGRSIQRILVSDDKIKTGLSDIVGLAKSKGIEVRPTPVKQMNRY-ET 62

Query: 108 EAVHQGLALETAPLLSPTL-----DAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGI 162
           +  HQG+      +    L     ++   + LL++ D V DPHN+GAI+R+A       +
Sbjct: 63  DVPHQGVIAFVNAVEFKDLGEVLQESNHENPLLILTDGVEDPHNMGAIIRTAECVGATAV 122

Query: 163 ITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQ 222
           +  KR++   +A +AK+++GA+E I  +++ N+T  ++++   GF  +G   +  + L +
Sbjct: 123 LIPKRHNAPINATVAKTSAGAVEQISLVQVGNVTQTIKQLQKQGFWVLGAHMEGDRTLYE 182

Query: 223 EIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHFA 281
                   L++G EGKG+    +E    +  + M G + +LN S AAA+ +Y       
Sbjct: 183 ADLTIPTVLVIGNEGKGISRVVKEACDFLVTIPMYGNLNSLNASVAAAILMYEAVRQRT 241


>gi|292493502|ref|YP_003528941.1| RNA methyltransferase, TrmH family, group 3 [Nitrosococcus
           halophilus Nc4]
 gi|291582097|gb|ADE16554.1| RNA methyltransferase, TrmH family, group 3 [Nitrosococcus
           halophilus Nc4]
          Length = 249

 Score =  137 bits (344), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 74/238 (31%), Positives = 111/238 (46%), Gaps = 9/238 (3%)

Query: 52  YGVHTVSAALNNPSRKIFQLLATKNALARLDWD---ANLPHPFPVKTVPPQTIDKIVGKE 108
           YG+H V AAL  P+ +I  L   ++   R   +     L        V  + +D +V   
Sbjct: 7   YGLHAVRAALEQPATQIISLWLDQSRKDRAIQEITELALEQGLDFYPVNREDLDSLVPGV 66

Query: 109 AVHQGLALE------TAPLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGI 162
                +A        T   L   LD ++   LL++LD V DPHN+GA LR+A A    G+
Sbjct: 67  RHQGVVAHCSAQPTFTEEGLFDLLDNLKAPPLLLILDGVQDPHNLGACLRTAEAAGVHGV 126

Query: 163 ITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQ 222
           I  K  +   +A + K ASGA E +P++R++NL   ++K+   G   +G        L  
Sbjct: 127 IAPKDRAVGLTAAVRKVASGAAERVPFVRVTNLARLMRKLRERGLWLVGTVVKGGGSLYN 186

Query: 223 EIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
                 + L+LGAE +GLR  T E    +  + M G + +LNVS AA V L+  Q   
Sbjct: 187 TDLKGPLGLVLGAEDRGLRRLTAEHCDCLVQIPMQGAVGSLNVSVAAGVCLFEAQRQR 244


>gi|304315921|ref|YP_003851066.1| RNA methyltransferase, TrmH family, group 3 [Thermoanaerobacterium
           thermosaccharolyticum DSM 571]
 gi|302777423|gb|ADL67982.1| RNA methyltransferase, TrmH family, group 3 [Thermoanaerobacterium
           thermosaccharolyticum DSM 571]
          Length = 248

 Score =  137 bits (344), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 68/245 (27%), Positives = 122/245 (49%), Gaps = 11/245 (4%)

Query: 45  QPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLP--HPFPVKTVPPQTID 102
           +     +YG + V  A+N+  R+I ++  +KNA   +             V T    T+D
Sbjct: 2   KENENIIYGRNPVLEAINSG-REIEKIYVSKNAKGNISKIIKAARDKNIIVSTTDNGTLD 60

Query: 103 KIVGKEAVHQGLALETAPLLSPTLDAVRNS-------QLLMVLDHVNDPHNIGAILRSAV 155
           K+      HQG+A   +      ++ +            +++LD + D HN+GAI+R+A 
Sbjct: 61  KLS-NYGNHQGIAALCSLYKYYEVEDILEYAEKRGEKPFILLLDGITDTHNLGAIIRTAE 119

Query: 156 AFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSD 215
           AFS  GII  KR S   ++ + K+++GA E+I  +++SN+ +A+  +   G   +G S D
Sbjct: 120 AFSAHGIIIPKRRSAVVNSTVVKTSAGATEYIKIVKVSNINNAINNLKKQGVWIVGSSLD 179

Query: 216 SKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYI 275
           +    +       +A+++G+EGKG+   TQ+    +A + M G I +LN S AA++ +Y 
Sbjct: 180 ADVDFQNVDYTGPVAIVIGSEGKGMSELTQKNCDYIAKIPMRGNINSLNASVAASIFMYE 239

Query: 276 TQNHF 280
                
Sbjct: 240 VIRQR 244


>gi|261377685|ref|ZP_05982258.1| RNA methyltransferase, TrmH family, group 3 [Neisseria cinerea ATCC
           14685]
 gi|269145953|gb|EEZ72371.1| RNA methyltransferase, TrmH family, group 3 [Neisseria cinerea ATCC
           14685]
          Length = 250

 Score =  137 bits (344), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 69/238 (28%), Positives = 110/238 (46%), Gaps = 9/238 (3%)

Query: 51  LYGVHTVSAALNNPSRKIFQLLATK---NALARLDWDANLPHPFPVKTVPPQTIDKIVGK 107
           +YG H V+A L    + I +L   +   +A  R   +        V       ++ I  K
Sbjct: 7   IYGFHAVNARLWQNPKSIVELYIQEGKSDARTREVLEKAANENIRVYFADADRLNAIS-K 65

Query: 108 EAVHQGLALET-----APLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGI 162
            A HQG+            L   L+ +    LL++LD + DPHN+GA LR+A A     +
Sbjct: 66  GARHQGVVGFIDASKNHVHLEDVLENLSEPPLLLILDGITDPHNLGACLRTADAMGVHAV 125

Query: 163 ITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQ 222
           I  K  S   +A ++K A GA E +PYI ++NL   L+++  +G   IG        L  
Sbjct: 126 IAPKDKSAGLNATVSKVACGAAETVPYITVTNLARTLRELKEYGIWIIGTDMGGDADLYH 185

Query: 223 EIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
               D  A ++G EG G+R  T+E    +  + M G ++++NVS +A + L  T+   
Sbjct: 186 CDLPDSAAWVMGNEGDGMRRLTREHCDMLVSIPMFGTVESMNVSVSAGMVLSETRRQR 243


>gi|220934084|ref|YP_002512983.1| RNA methyltransferase, TrmH family, group 3 [Thioalkalivibrio sp.
           HL-EbGR7]
 gi|219995394|gb|ACL71996.1| RNA methyltransferase, TrmH family, group 3 [Thioalkalivibrio sp.
           HL-EbGR7]
          Length = 248

 Score =  137 bits (344), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 76/241 (31%), Positives = 115/241 (47%), Gaps = 10/241 (4%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLA---TKNALARLDWDANLPHPFPVKTVPPQTIDKIVG 106
           FL+G+H V AAL      +  L      K+A  R   DA       V+ V  Q ++++  
Sbjct: 6   FLFGLHAVLAALTRKPTPVTTLWVDAGRKDARMREILDAARKAGVTVERVDAQALERLCP 65

Query: 107 KEAVHQGLALETAPLLS-------PTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSC 159
                  +A               P L     S LL+VLD V DPHN+GA LR+A A   
Sbjct: 66  GARHQGVVAERIQEAGPEITEADLPNLVGRVASPLLLVLDGVTDPHNLGACLRTADAAGV 125

Query: 160 DGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKP 219
           D +I  +  +   + V  K ASGA E +P+++++NL   L ++   G   IG S D+ + 
Sbjct: 126 DAVIVPRDRAAGLTPVARKVASGAAEVVPFVQVTNLARTLDQLKQAGVWIIGTSGDAPQT 185

Query: 220 LEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNH 279
           L Q      IA+++GAEG+G+R  T+E    + ++ M G + +LNVS A  V L+     
Sbjct: 186 LYQADLKGPIAIVMGAEGQGMRRLTRERCDLLVNIPMQGSVSSLNVSVATGVCLFEVVRQ 245

Query: 280 F 280
            
Sbjct: 246 R 246


>gi|197287185|ref|YP_002153057.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Proteus mirabilis
           HI4320]
 gi|194684672|emb|CAR46614.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Proteus mirabilis
           HI4320]
          Length = 247

 Score =  137 bits (344), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 67/242 (27%), Positives = 100/242 (41%), Gaps = 8/242 (3%)

Query: 48  NLFLYGVHTVSAALNNPSRKIFQLLATKNALARLD---WDANLPHPFPVKTVPPQTIDKI 104
              +YG+H V A L     +  ++   K    R       A       V+    Q +D  
Sbjct: 3   EDIIYGIHAVKALLERDPTRFKEVYVLKGREDRRLMPVIHALEEQGILVQVANRQWLDNQ 62

Query: 105 VGKEAVHQGLALETAPLLSPTLDAVR-----NSQLLMVLDHVNDPHNIGAILRSAVAFSC 159
                    +A           D         +  L+VLD V DPHN+GA LRSA A   
Sbjct: 63  TEGAVHQGIIAKVKPSRQYQEQDLPDLLAEVGTPFLLVLDGVTDPHNLGACLRSADAAGV 122

Query: 160 DGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKP 219
             +I  K  S   +A   K A GA E +P IR++NL   L+ +       +G + ++   
Sbjct: 123 HAVIVPKDRSAQLNATAKKVACGAAESVPLIRVTNLARTLRLLQEENIWIVGTAGEADHT 182

Query: 220 LEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNH 279
           L Q      +AL++GAEG+G+R  T+E    +  + M G + +LNVS A  V L+     
Sbjct: 183 LYQSKLTGPLALVMGAEGEGMRRLTREHCDELISIPMAGSVSSLNVSVATGVCLFEAMRQ 242

Query: 280 FA 281
             
Sbjct: 243 RI 244


>gi|329121964|ref|ZP_08250576.1| 23S rRNA (guanosine-2'-O-)-methyltransferase RlmB [Dialister
           micraerophilus DSM 19965]
 gi|327467262|gb|EGF12765.1| 23S rRNA (guanosine-2'-O-)-methyltransferase RlmB [Dialister
           micraerophilus DSM 19965]
          Length = 272

 Score =  136 bits (343), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 59/270 (21%), Positives = 113/270 (41%), Gaps = 5/270 (1%)

Query: 15  LKDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAAL-NNPSRKIFQLLA 73
           +K+  +    +     K+    N++       +   + G ++V  AL  N  +KIF    
Sbjct: 3   IKNKTHKNSNKTQTVKKQFSQKNKRKTLKKSEDLF-ICGRNSVKEALNENQIKKIFIKSG 61

Query: 74  TKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQG---LALETAPLLSPTLDAVR 130
             +   +           P++    + +DK+            +       L   L   +
Sbjct: 62  NNDQRLKDIVKIAQNKNIPIQIEEQEILDKMSDGVRNQGIVASMKPFEYSDLEEVLLKAK 121

Query: 131 NSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYI 190
              L+++LD V D  NIGAI+R+A       ++  K  S   +A   K+A+GA  ++P  
Sbjct: 122 EDPLIVLLDGVEDVRNIGAIVRTAECAGVSAVLLPKHKSAPVTAAAIKTAAGAFSYLPVC 181

Query: 191 RISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATS 250
            I N+   L+ +   GF  +G   + +    +      + +++GAEGKG+   T++    
Sbjct: 182 EIGNIRQTLEHLKEKGFWVVGADMEGELLYYESNLKGPLVIVMGAEGKGISLLTKKMCDF 241

Query: 251 MAHLHMPGIIKALNVSNAAAVALYITQNHF 280
           +  + M G + +LNVS AAA+ +Y +    
Sbjct: 242 LVRIPMKGKVSSLNVSVAAALLIYESVKQR 271


>gi|311746389|ref|ZP_07720174.1| TrmH family RNA methyltransferase [Algoriphagus sp. PR1]
 gi|126575275|gb|EAZ79607.1| TrmH family RNA methyltransferase [Algoriphagus sp. PR1]
          Length = 258

 Score =  136 bits (343), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 62/246 (25%), Positives = 110/246 (44%), Gaps = 11/246 (4%)

Query: 46  PENLFLYGVHTVSAALNNPSR--KIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDK 103
            E  F++G   V  A++      K+       N L +        +  PV  VP   +++
Sbjct: 15  TEKDFIFGTRAVMEAIHAGKEMDKVLVQKELNNDLIKELLQVCKANAVPVVRVPDAKLNR 74

Query: 104 IVGKEAVHQGLALETAPLLSPTLDAVRNSQ-------LLMVLDHVNDPHNIGAILRSAVA 156
           +      HQG+    + +   +LD V  S        L+++LD + D  N GAI RSA  
Sbjct: 75  VT--RKNHQGVVAYISSIEYASLDHVIESCFSVGKSPLVLILDRITDVRNFGAIARSAEC 132

Query: 157 FSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDS 216
              D I+   + S   ++   K+++GAL  +P +R+ NL    + +   G   + ++  S
Sbjct: 133 AGIDAIVIPSKGSAQINSDAVKTSAGALNFLPVVRVKNLFYTCRDLQKMGLTLVAITEKS 192

Query: 217 KKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYIT 276
            K + +      +A+I+G+E  G+  +    A    ++ M G I++LNVS +A VA+Y  
Sbjct: 193 DKDMYEADFASPVAMIMGSEEDGISNELMGIADEKVNIPMLGKIESLNVSVSAGVAIYEA 252

Query: 277 QNHFAK 282
                K
Sbjct: 253 MRQRRK 258


>gi|319638169|ref|ZP_07992932.1| RNA methylase [Neisseria mucosa C102]
 gi|317400442|gb|EFV81100.1| RNA methylase [Neisseria mucosa C102]
          Length = 249

 Score =  136 bits (343), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 69/239 (28%), Positives = 110/239 (46%), Gaps = 9/239 (3%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLATK---NALARLDWDANLPHPFPVKTVPPQTIDKIVG 106
            +YG H V+A L    + I +L   +   +A  R   D        V       ++ I  
Sbjct: 6   LIYGFHAVNARLWQNPKSITELYIQEGKSDARTRDVLDKAASENVRVHFADADRLNAIS- 64

Query: 107 KEAVHQGLALET-----APLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDG 161
           K A HQG+            L   L+ +     L+VLD + DPHN+GA LR+A A     
Sbjct: 65  KGARHQGVVGFIDASKNHVHLEDVLENLSEPPFLLVLDGITDPHNLGACLRTADAMGVHA 124

Query: 162 IITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLE 221
           +I  K  S   +A ++K A GA E +PYI ++NL   L+++  +G   +G        L 
Sbjct: 125 VIAPKDKSAGLNATVSKVACGAAETVPYITVTNLARTLRELKEYGIWIVGTDMGGDSDLY 184

Query: 222 QEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
                D  A ++G EG+G+R  T+E    +  + M G ++++NVS +A + L  T+   
Sbjct: 185 HCDLPDSAAWVMGNEGEGMRRLTREHCDMLVSIPMFGTVESMNVSVSAGMVLSETRRQR 243


>gi|268681973|ref|ZP_06148835.1| RNA methyltransferase [Neisseria gonorrhoeae PID332]
 gi|268686441|ref|ZP_06153303.1| RNA methyltransferase [Neisseria gonorrhoeae SK-93-1035]
 gi|268622257|gb|EEZ54657.1| RNA methyltransferase [Neisseria gonorrhoeae PID332]
 gi|268626725|gb|EEZ59125.1| RNA methyltransferase [Neisseria gonorrhoeae SK-93-1035]
          Length = 255

 Score =  136 bits (343), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 69/238 (28%), Positives = 111/238 (46%), Gaps = 9/238 (3%)

Query: 51  LYGVHTVSAALNNPSRKIFQLLATK---NALARLDWDANLPHPFPVKTVPPQTIDKIVGK 107
           +YG H V+A L    + I +L   +   +A  R   +        V       ++ I  K
Sbjct: 12  IYGFHAVNARLWQNPKSITELYIQEGKSDARTREVLEKAANENIRVYFADADRLNAIS-K 70

Query: 108 EAVHQGLALET-----APLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGI 162
            A HQG+            L   L+ +    LL++LD + DPHN+GA LR+A A     +
Sbjct: 71  GARHQGVVGFIDASKNHVHLEDILENLSEPPLLLILDGITDPHNLGACLRTADAMGVHAV 130

Query: 163 ITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQ 222
           I  K  S   +A ++K A GA E +PYI ++NL   L+++  +G   IG     +  L  
Sbjct: 131 IAPKDKSAGLNATVSKVACGAAETVPYITVTNLARTLRELKEYGIWIIGTDMGGESDLYH 190

Query: 223 EIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
               D  A ++G EG G+R  T+E    +  + M G ++++NVS +A + L  T+   
Sbjct: 191 CNLPDSTAWVMGNEGDGMRRLTREHCDMLVSIPMFGTVESMNVSVSAGMVLSETRRQR 248


>gi|302391187|ref|YP_003827007.1| tRNA/rRNA methyltransferase (SpoU) [Acetohalobium arabaticum DSM
           5501]
 gi|302203264|gb|ADL11942.1| tRNA/rRNA methyltransferase (SpoU) [Acetohalobium arabaticum DSM
           5501]
          Length = 268

 Score =  136 bits (343), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 53/282 (18%), Positives = 107/282 (37%), Gaps = 21/282 (7%)

Query: 2   NLISKKKSEKIFSLKDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAAL 61
            +IS  K+ KI  L+  +  K RR +                       L G   ++ AL
Sbjct: 3   EVISSFKNSKIKFLRSLYRKKYRRRN-------------------NKFILEGSRIITDAL 43

Query: 62  NNPSRKIFQLLATK--NALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETA 119
              +       + +  +     +  A L     +  +    ++KI         +A+   
Sbjct: 44  EAKADIDQIFYSAQFLSQQKNKELLAQLREVTEIIEITDSLLNKIADTATPQGIIAIVNQ 103

Query: 120 PLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKS 179
           P        + ++ L +++D + DP N+G ILR+A     DG+   K      +    ++
Sbjct: 104 PEFELEDFLIEDNDLFLIIDRIQDPGNLGTILRTADGAGVDGVFLLKGTVDIYNLKTIRA 163

Query: 180 ASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKG 239
             G+L  +P   +++ +D    +     Q +    ++K    +   N   AL++G EG G
Sbjct: 164 TMGSLFRVPVFGLNSPSDLTDILQMKDIQMVAADIEAKDYYYELDYNQPTALVIGNEGAG 223

Query: 240 LRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHFA 281
            +P+T + A     + +   I +LN + A+ + +Y       
Sbjct: 224 AQPETLKLADKKVKIPLSEGIDSLNAAIASGIIMYEMVRQRK 265


>gi|304387767|ref|ZP_07369947.1| RNA methyltransferase [Neisseria meningitidis ATCC 13091]
 gi|304338243|gb|EFM04373.1| RNA methyltransferase [Neisseria meningitidis ATCC 13091]
          Length = 250

 Score =  136 bits (343), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 69/238 (28%), Positives = 110/238 (46%), Gaps = 9/238 (3%)

Query: 51  LYGVHTVSAALNNPSRKIFQLLATK---NALARLDWDANLPHPFPVKTVPPQTIDKIVGK 107
           +YG H V+A L    + I +L   +   +A  R   +        V       ++ I  K
Sbjct: 7   IYGFHAVNARLWQNPKSIIELYIQEGKSDARTREVLEKAANENIRVYFADADRLNAIS-K 65

Query: 108 EAVHQGLALET-----APLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGI 162
            A HQG+            L   L+ +    LL++LD + DPHN+GA LR+A A     +
Sbjct: 66  GARHQGVVGFIDASKNHVHLEDVLENLSEPPLLLILDGITDPHNLGACLRTADAMGVHAV 125

Query: 163 ITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQ 222
           I  K  S   +A ++K A GA E +PYI ++NL   L+++  +G   IG        L  
Sbjct: 126 IAPKDKSAGLNATVSKVACGAAETVPYITVTNLARTLRELKEYGIWIIGTDMGGNADLYH 185

Query: 223 EIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
               D  A ++G EG G+R  T+E    +  + M G ++++NVS +A + L  T+   
Sbjct: 186 CDLPDSAAWVMGNEGDGMRRLTREHCDMLVSIPMFGTVESMNVSVSAGMVLSETRRQR 243


>gi|268319892|ref|YP_003293548.1| rRNA methyltransferase [Lactobacillus johnsonii FI9785]
 gi|262398267|emb|CAX67281.1| rRNA methyltransferase [Lactobacillus johnsonii FI9785]
          Length = 253

 Score =  136 bits (343), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 55/251 (21%), Positives = 106/251 (42%), Gaps = 6/251 (2%)

Query: 26  NHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDA 85
           N+   K ++   QK ++  + +   + G H V  AL N    ++ L  T  AL +LD   
Sbjct: 8   NNPTIKSLRKLEQK-KYRKKTQTYLIEGFHLVEEALKNHENYLYVL-GTAEALKKLDASY 65

Query: 86  NLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDHVNDPH 145
            L     ++     +      K +    + L      S + +  +     +VLD++ DP 
Sbjct: 66  KLKDDKVIQITDAISQHLSSTKNSQDIFMVLPINQPKSFSFEYGKW----VVLDNLTDPG 121

Query: 146 NIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSW 205
           N+G I+R+A A   DG++ ++      +  + +S  G+  HI  I+   L        + 
Sbjct: 122 NVGTIIRTADAAGFDGVVLSEESVDLYNPKVQRSMQGSQFHIQIIQNPILEAISSFKENG 181

Query: 206 GFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNV 265
               + +   + K L       ++AL++G E  G   +  ETA    ++ + G  ++LN 
Sbjct: 182 LPVYVSILDKTAKSLNNCTPVPQLALVIGNEAHGASKEVIETADKKIYIPIKGKAESLNA 241

Query: 266 SNAAAVALYIT 276
           + AA + +Y  
Sbjct: 242 AVAAGIMIYHF 252


>gi|254822714|ref|ZP_05227715.1| RNA methyltransferase, TrmH family protein, group 3 [Mycobacterium
           intracellulare ATCC 13950]
          Length = 310

 Score =  136 bits (343), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 74/269 (27%), Positives = 119/269 (44%), Gaps = 10/269 (3%)

Query: 21  AKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNP-SRKIFQLLATKNALA 79
           A +R NH   K+ QS +++       E   + G + V   L          +     A  
Sbjct: 41  AHMRPNHPAAKRAQSPSRRPARGKTDETETVLGRNPVLECLRAGVPATALYVALGSEADE 100

Query: 80  RLDWDANLPH--PFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDA------VRN 131
           RL    +        +  VP   +D++     +HQG+AL+  P      D          
Sbjct: 101 RLTESVSRAADLGIAILEVPRTDLDRMTNNH-LHQGIALQVPPYNYAHPDDLVEAATGSP 159

Query: 132 SQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIR 191
             LL+ LD+++DP N+GAI+RS  AF   G++  +R S S +AV  ++++GA   +P  R
Sbjct: 160 PALLVALDNISDPRNLGAIVRSVAAFGGHGVLIPQRRSASVTAVAWRTSAGAAARVPVAR 219

Query: 192 ISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSM 251
            +NLT  L      G + IGL +     L+     D I +++G+EGKGL    ++    +
Sbjct: 220 ATNLTRTLTDWADRGLRVIGLDAGGDTTLDDLDGTDPIVVVVGSEGKGLSRLVRQNCDEV 279

Query: 252 AHLHMPGIIKALNVSNAAAVALYITQNHF 280
             + M G  ++LN S AA V L       
Sbjct: 280 VSIPMAGNAESLNASVAAGVVLAEISRQR 308


>gi|332886049|gb|EGK06293.1| hypothetical protein HMPREF9456_00167 [Dysgonomonas mossii DSM
           22836]
          Length = 263

 Score =  136 bits (343), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 46/282 (16%), Positives = 92/282 (32%), Gaps = 23/282 (8%)

Query: 1   MNLISKKKSEKIFSLKDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAA 60
           M  I   ++ +I ++                       K++   +     + G   ++ A
Sbjct: 1   MEKIVSLQNTRIKNIVKL-------------------SKAKERREQNLFIIEGARELNLA 41

Query: 61  LNNPSRKIFQLLATKNALAR--LDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALET 118
           L      +  +        +                 V     +KI  +E     L L  
Sbjct: 42  LMAGYE-VDSVFVCPELFVKTDYPHVLESISDNKKFEVSEAVFEKIAYREGSDGLLTLAK 100

Query: 119 APLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAK 178
               + T   + ++  L++L+ V  P N+GA+LR+A A   D +I     +       A 
Sbjct: 101 PKGHTLTDLKLSDTPFLIILESVEKPGNLGAVLRTADAAQADAVIVC-DPATDIYNPNAI 159

Query: 179 SASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGK 238
            +S          +    +AL  + S   +      ++ +  +        A+++G E  
Sbjct: 160 RSSVGCVFTVQTAVCTSQEALSYLRSRNIKAYAAELNASQWYQDTDFTKPSAIVMGTEAD 219

Query: 239 GLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
           GL     + A     + M G I +LNVS + A+  +      
Sbjct: 220 GLTLFWLDNADYRVKIPMRGKIDSLNVSVSTAILTFEAMRQR 261


>gi|82546579|ref|YP_410526.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Shigella boydii
           Sb227]
 gi|81247990|gb|ABB68698.1| conserved hypothetical protein [Shigella boydii Sb227]
          Length = 243

 Score =  136 bits (343), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 62/242 (25%), Positives = 104/242 (42%), Gaps = 8/242 (3%)

Query: 48  NLFLYGVHTVSAALNNPSRKIFQLLATKNALARLD---WDANLPHPFPVKTVPPQTIDKI 104
           +  +YG+H V A L     +  ++   K    +       A       ++    Q +D+ 
Sbjct: 2   SEMIYGIHAVQALLERAPERFQEVFILKGREDKRLLPLIHALEAQGVVIQLANRQYLDEK 61

Query: 105 VGKEAVHQGLALETAPLLSPTLDAVR-----NSQLLMVLDHVNDPHNIGAILRSAVAFSC 159
                    +A           D        +   L++LD V DPHN+GA LRSA A   
Sbjct: 62  SDGAVHQGIIARVKPGRQYQENDLPDLIASLDQPFLLILDGVTDPHNLGACLRSADAAGV 121

Query: 160 DGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKP 219
             +I  K  S   +A   K A GA E +P IR++NL   ++ +       +G + ++   
Sbjct: 122 HAVIVPKDRSAQLNATAKKVACGAAESVPLIRVTNLVRTMRMLQEENIWIVGTAGEADHT 181

Query: 220 LEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNH 279
           L Q     ++AL++GAEG+G+R  T+E    +  + M G + +LNVS A  + L+     
Sbjct: 182 LYQSKMTGRLALVMGAEGEGMRRLTREHCDELISIPMAGSVSSLNVSVATGICLFEAVRQ 241

Query: 280 FA 281
            +
Sbjct: 242 RS 243


>gi|259047742|ref|ZP_05738143.1| 23S rRNA (guanosine-2'-O-)-methyltransferase RlmB [Granulicatella
           adiacens ATCC 49175]
 gi|259035933|gb|EEW37188.1| 23S rRNA (guanosine-2'-O-)-methyltransferase RlmB [Granulicatella
           adiacens ATCC 49175]
          Length = 287

 Score =  136 bits (343), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 80/281 (28%), Positives = 134/281 (47%), Gaps = 22/281 (7%)

Query: 20  YAKLRRNHRDYKKMQSFNQKSRHTSQPENL---------FLYGVHTVSAALNNPSRKIFQ 70
             K R  +R  +      +K    ++             F++G H V  AL  P R + +
Sbjct: 9   KKKSRNGNRSDRGRSERAEKRPRPTREHVERVEAQDVVDFVFGRHAVVEALQTPDR-VNR 67

Query: 71  LLATKNALARLD---WDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLD 127
           +   +    R      D        V+TVP   I+ +VG  AVHQGL    A      L+
Sbjct: 68  VFIQEGTSGRDAAKVIDLAREKGIQVQTVPKTKIEDLVG-NAVHQGLVASIAAYEYADLE 126

Query: 128 A-------VRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSA 180
                         +++LD V DPHN+G+ILR+A A    GII  KR S S +A +AK++
Sbjct: 127 DVFKKAEEKGEDPFIVILDGVEDPHNLGSILRTADATGVHGIIIPKRRSASLTATVAKAS 186

Query: 181 SGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGL 240
           +GA+EH+P +R++NLT  ++++ + G    G   +     +   K   +A+++G EGKG+
Sbjct: 187 TGAIEHVPVVRVTNLTQTIEQLKARGVWVFGTDMNGTDYRKWNTK-GPLAIVMGNEGKGV 245

Query: 241 RPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHFA 281
               +E+   M  + M G +++LN S A+A+ +Y    + +
Sbjct: 246 SRIVKESVDEMVTIPMVGHVQSLNASVASALMMYEVFRNRS 286


>gi|259046651|ref|ZP_05737052.1| TrmH family RNA methyltransferase [Granulicatella adiacens ATCC
           49175]
 gi|259036816|gb|EEW38071.1| TrmH family RNA methyltransferase [Granulicatella adiacens ATCC
           49175]
          Length = 256

 Score =  136 bits (343), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 55/274 (20%), Positives = 95/274 (34%), Gaps = 25/274 (9%)

Query: 1   MNLISKKKSEKIFSLKDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAA 60
           M  IS  K+EKI  L     A                   +   +     L G H V  A
Sbjct: 1   MESISSPKNEKIKELVKLQTA-------------------KGRKKAGMYLLEGEHLVEEA 41

Query: 61  LNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAP 120
           +    R   +L+   +       +        V  V      K+       QG+      
Sbjct: 42  IK--ERAQIKLIVVTSNRLEDYKNLLAQTDVQVLVVSQDVFHKLS-MTETAQGILAVVEI 98

Query: 121 LLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSA 180
           +    L    +    +VLD V DP N+G I+R+A A   D ++         +  + +S 
Sbjct: 99  VKQEIL---PHKGRFIVLDAVQDPGNLGTIVRTADAAGFDAVVLGTGTVDLYNDKVLRSM 155

Query: 181 SGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGL 240
            G+  HIP  + +                +       K          +A+++G EG+G+
Sbjct: 156 QGSHFHIPVFQANLQEYLPILKEKGVQVAVTALHRDSKDYSVLQGATDVAIVVGNEGQGV 215

Query: 241 RPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
                + A  +  + + G  ++LNVS A+A+ +Y
Sbjct: 216 SDDVIDLADVVVTIPIFGKAESLNVSIASALLMY 249


>gi|118444322|ref|YP_877839.1| rRNA methylase [Clostridium novyi NT]
 gi|118134778|gb|ABK61822.1| rRNA methylase [Clostridium novyi NT]
          Length = 262

 Score =  136 bits (343), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 57/281 (20%), Positives = 104/281 (37%), Gaps = 26/281 (9%)

Query: 1   MNLISKKKSEKIFSLKDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAA 60
           MNLI  K +  I  ++                     +K ++  Q E   + G   V  A
Sbjct: 1   MNLIESKDNTLIKYVRKL-------------------RKKKYRVQEEKFLVEGFRFVEEA 41

Query: 61  LNNPSRKIFQLLATK--NALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALET 118
           L +  +    L+A          +   ++     V  V  + + ++              
Sbjct: 42  LKSTFQVSHMLIAESAIEKCNSFNILNSVDENTKVSLVKDEILKELCETNNPQG----II 97

Query: 119 APLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAK 178
           A + +  +     +   +++D V DP N+G I+RSA A    G+I TK      +    +
Sbjct: 98  AVVDNKKISIEDKNGFYILIDKVQDPGNMGTIIRSANASGALGVIVTKGTVDIYNDKTLR 157

Query: 179 SASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGK 238
           S  G++  IP I  ++           GF+ I  S D++          K+ + +G EG 
Sbjct: 158 STMGSIFKIPIIEDNDFEVINDLK-LKGFKLIVSSLDTENNFFDIDLTKKVIICVGNEGN 216

Query: 239 GLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNH 279
           G+  +          + MPG  ++LNV  AA++ +Y     
Sbjct: 217 GVSDEVYNLGDERVKIPMPGDAESLNVGVAASIMMYEVVRQ 257


>gi|332531978|ref|ZP_08407862.1| 23S rRNA (guanosine-2'-O-) -methyltransferase RlmB
           [Pseudoalteromonas haloplanktis ANT/505]
 gi|332038605|gb|EGI75048.1| 23S rRNA (guanosine-2'-O-) -methyltransferase RlmB
           [Pseudoalteromonas haloplanktis ANT/505]
          Length = 247

 Score =  136 bits (343), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 62/243 (25%), Positives = 108/243 (44%), Gaps = 10/243 (4%)

Query: 48  NLFLYGVHTVSAALNNPSRKIFQLLATKNALARL---DWDANLPHPFPVKTVPPQTIDKI 104
           N  ++G H+V A L +   +  ++ A K    +      D        V+ +  + +D  
Sbjct: 3   NELIFGFHSVEAILESEPERFVEIYALKGRDDKRSTPIIDEARKFGISVQFMQRKALDSK 62

Query: 105 VGKEAVHQGLALETAPLLSPTLDA------VRNSQLLMVLDHVNDPHNIGAILRSAVAFS 158
              E  HQG+        +             ++  L+VLD + DPHN+GA LRSA A  
Sbjct: 63  SKGE-QHQGIIANVKAAPTFNEKDLDAIIAREDTPFLLVLDGITDPHNLGACLRSADAAG 121

Query: 159 CDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKK 218
              +I  K  S   +    K A GA E +P I+++NL   L+++   G   +G + ++  
Sbjct: 122 VHAVIVPKDKSAKLNGTARKVACGAAETVPLIQVTNLARTLREIKDAGVWVVGTAGETDN 181

Query: 219 PLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQN 278
            +        +A+++GAEG+G+R  T+E    +  + M G + +LNVS A  + L+    
Sbjct: 182 HVFDASLTGPMAIVMGAEGEGMRRLTREHCDMLVKIPMAGTVSSLNVSVATGICLFEVLR 241

Query: 279 HFA 281
              
Sbjct: 242 QRN 244


>gi|17988081|ref|NP_540715.1| 23S ribosomal RNA methyltransferase [Brucella melitensis bv. 1 str.
           16M]
 gi|256045941|ref|ZP_05448813.1| 23S ribosomal RNA methyltransferase [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|260563222|ref|ZP_05833708.1| tRNA/rRNA methyltransferase [Brucella melitensis bv. 1 str. 16M]
 gi|265992352|ref|ZP_06104909.1| tRNA/rRNA methyltransferase [Brucella melitensis bv. 1 str. Rev.1]
 gi|17983831|gb|AAL52979.1| 23S ribosomal RNA methyltransferase [Brucella melitensis bv. 1 str.
           16M]
 gi|260153238|gb|EEW88330.1| tRNA/rRNA methyltransferase [Brucella melitensis bv. 1 str. 16M]
 gi|263003418|gb|EEZ15711.1| tRNA/rRNA methyltransferase [Brucella melitensis bv. 1 str. Rev.1]
          Length = 297

 Score =  136 bits (343), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 50/277 (18%), Positives = 92/277 (33%), Gaps = 8/277 (2%)

Query: 5   SKKKSEKIFSLKDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNP 64
            + +  K+  +K+         +   K ++S   K +   Q       G+  V  AL   
Sbjct: 17  HRPEHPKVGQVKEVT----SLANPIVKDLRSLALK-KFRDQQGVFLAEGLKLVIDALEQD 71

Query: 65  SRKIFQLLATKNALARLDWDANL---PHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPL 121
            R    + A      +               V  V  + I  I  ++       +     
Sbjct: 72  WRIKTLVFAKSGKGNKTVEQVAARTFAKGGLVLEVTEKVISAITRRDNPQMVAGVFEQQY 131

Query: 122 LSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSAS 181
                   + + + + LD V DP N+GA++R+A A    G+I     +   S    ++  
Sbjct: 132 HQLAGLKPKGNDVYVALDRVRDPGNLGAVIRTADAVGAKGVILIGDTTDPYSLETVRATM 191

Query: 182 GALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLR 241
           G++  +P  R S       +    G         +         N  + LI+G E +GL 
Sbjct: 192 GSVFSVPLYRASEADFLNWRKGFSGLVVGTHLKGAVDYRTIPYANKPVILIMGNEQQGLP 251

Query: 242 PKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQN 278
                    +A +   G   +LN++ A  V LY  + 
Sbjct: 252 DSLAGACDKLARIPQAGRADSLNLAIATGVMLYEIRR 288


>gi|313884616|ref|ZP_07818374.1| RNA methyltransferase, TrmH family [Eremococcus coleocola
           ACS-139-V-Col8]
 gi|312620126|gb|EFR31557.1| RNA methyltransferase, TrmH family [Eremococcus coleocola
           ACS-139-V-Col8]
          Length = 258

 Score =  136 bits (343), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 52/274 (18%), Positives = 101/274 (36%), Gaps = 23/274 (8%)

Query: 4   ISKKKSEKIFSLKDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNN 63
           I+ K+++ I   +  H                    S+   +     + G H V  AL  
Sbjct: 7   ITSKQNQSIKEWRKLHT-------------------SKGRRKARAFLIEGDHLVQEALKA 47

Query: 64  PSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLS 123
               +  L+AT   L   +   +  H      + P     +   +      A+  +    
Sbjct: 48  G-LPLQALMATPAYLGDHEELFDQDH-CDTYLLTPGLAQYLSQTQQDQGVFAVVESKQKP 105

Query: 124 PTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGA 183
            +LD   +   L++LD + DP N+G ++R+A A   D +I  +      +  + ++  G+
Sbjct: 106 ASLD--PSWHRLLLLDAIQDPGNLGTMIRTADAAGFDAVILGQGCVDPYNDKVLRATQGS 163

Query: 184 LEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPK 243
           + H+P I             +             +       +DK+ALI+G EG G+   
Sbjct: 164 IWHLPVIHYDLKAAIPALQATKIPVLATALHKDAQIYSDLKLDDKVALIMGNEGAGVAGD 223

Query: 244 TQETATSMAHLHMPGIIKALNVSNAAAVALYITQ 277
             + A    ++ M G  ++LNV+ A  + L+   
Sbjct: 224 LIQAADHSVYIPMLGQAESLNVAVATGILLFHFN 257


>gi|120555299|ref|YP_959650.1| RNA methyltransferase [Marinobacter aquaeolei VT8]
 gi|120325148|gb|ABM19463.1| 23S rRNA Gm-2251 2'-O-methyltransferase [Marinobacter aquaeolei
           VT8]
          Length = 245

 Score =  136 bits (343), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 74/243 (30%), Positives = 115/243 (47%), Gaps = 12/243 (4%)

Query: 48  NLFLYGVHTVSAALNNPSRKIFQLLAT---KNALARLDWDANLPHPFPVKTVPPQTIDKI 104
             +++G H V A L     ++ ++      ++   +   DA      P K V  + +D+ 
Sbjct: 3   QEYVFGWHAVDAVLKREPERLQRVWIQTGRQDKRVKSVTDALDGLGVPWKVVHRKELDER 62

Query: 105 VGKEAVHQGLALETAPLLSPTLDA-------VRNSQLLMVLDHVNDPHNIGAILRSAVAF 157
           V    VHQG+    A     T D              L+VLD V DPHN+GA +R+A A 
Sbjct: 63  VS--GVHQGVVAAVAESREWTEDDLLAQLAASDKPPFLLVLDGVTDPHNLGACMRTADAA 120

Query: 158 SCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSK 217
               +I  K  S S + V  K A GA E +P++R++NL   L+++   G   IG + ++ 
Sbjct: 121 GVQAVIVPKDKSASLTPVARKVACGAAETVPFVRVTNLARFLRELKDQGVWLIGTAGEAD 180

Query: 218 KPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQ 277
             L Q      +AL++GAEGKG+R  T+E    + ++ M G + +LNVS A  V LY   
Sbjct: 181 ATLYQADFKGPVALVMGAEGKGMRRLTREHCDQLINIPMLGHVDSLNVSVATGVCLYEAL 240

Query: 278 NHF 280
              
Sbjct: 241 RQR 243


>gi|116621924|ref|YP_824080.1| RNA methyltransferase [Candidatus Solibacter usitatus Ellin6076]
 gi|116225086|gb|ABJ83795.1| RNA methyltransferase, TrmH family, group 3 [Candidatus Solibacter
           usitatus Ellin6076]
          Length = 237

 Score =  136 bits (343), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 78/233 (33%), Positives = 122/233 (52%), Gaps = 3/233 (1%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPH--PFPVKTVPPQTIDKIVGK 107
            L G+H V  AL   +     ++A      RL    +L      PV+  P  ++D++ G 
Sbjct: 3   LLSGIHPVVEALRAGNPLERIVIAQGAGGPRLQEIIDLARQAKIPVRFEPRPSLDRLAG- 61

Query: 108 EAVHQGLALETAPLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKR 167
            + HQG+    A      LD+V  S++L+VLD V DPHN+GAI+R+A A     +I  +R
Sbjct: 62  SSAHQGVVGLGAARKYADLDSVAESEMLVVLDGVEDPHNLGAIVRTAHAAGAGAVIVPER 121

Query: 168 YSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKND 227
            +   + V+AK+A+GALEH+P +R++N+  AL+ +   G    GL     +  +Q     
Sbjct: 122 RAAGVTDVVAKAAAGALEHLPVVRVTNINRALEDLKERGMWIYGLDERGTESYDQIDYAK 181

Query: 228 KIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
           K  L+LG EGKGL  + ++    +  + M G I +LNVS AA V L+  +   
Sbjct: 182 KSVLVLGGEGKGLHEQVRKHCDVLVRIPMAGQISSLNVSVAAGVVLFEWRRRR 234


>gi|316985328|gb|EFV64277.1| RNA 2'-O ribose methyltransferase substrate binding family protein
           [Neisseria meningitidis H44/76]
 gi|325140178|gb|EGC62705.1| RNA methyltransferase, TrmH family, group 3 [Neisseria meningitidis
           CU385]
          Length = 261

 Score =  136 bits (343), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 69/238 (28%), Positives = 111/238 (46%), Gaps = 9/238 (3%)

Query: 51  LYGVHTVSAALNNPSRKIFQLLATK---NALARLDWDANLPHPFPVKTVPPQTIDKIVGK 107
           +YG H V+A L    + I +L   +   +A  R   +        V       ++ I  K
Sbjct: 18  IYGFHAVNARLWQNPKSIVELYIQEGKSDARTREVLEKAANENIRVYFADADRLNAIS-K 76

Query: 108 EAVHQGLALET-----APLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGI 162
            A HQG+            L   L+ +    LL++LD + DPHN+GA LR+A A     +
Sbjct: 77  GARHQGVVGFIDASKNHVHLEDVLENLSEPPLLLILDGITDPHNLGACLRTADAMGVHAV 136

Query: 163 ITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQ 222
           I  K  S   +A ++K A GA E +PYI ++NL   L+++  +G   IG     +  L  
Sbjct: 137 IAPKDKSAGLNATVSKVACGAAETVPYITVTNLARTLRELKEYGIWIIGTDMSGESDLYH 196

Query: 223 EIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
               D  A ++G EG G+R  T+E    +  + M G ++++NVS +A + L  T+   
Sbjct: 197 CNLPDSAAWVMGNEGDGMRRLTREHCDMLVSIPMFGTVESMNVSVSAGMVLSETRRQR 254


>gi|192360670|ref|YP_001983449.1| TrmH family RNA methyltransferase [Cellvibrio japonicus Ueda107]
 gi|190686835|gb|ACE84513.1| RNA methyltransferase, TrmH family, group 3 [Cellvibrio japonicus
           Ueda107]
          Length = 249

 Score =  136 bits (343), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 71/241 (29%), Positives = 112/241 (46%), Gaps = 9/241 (3%)

Query: 49  LFLYGVHTVSAALNNPSRKIFQLLA---TKNALARLDWDANLPHPFPVKTVPPQTIDKIV 105
             +YG+H V A L +  +++ ++      ++   +    A   +      V    +D +V
Sbjct: 4   ELVYGLHAVQALLKSAPQRVLEIYVLQGRQDQRLQKIAHAAELNQIHCNLVSRNKLDDMV 63

Query: 106 GKEAVHQGLALETAPLLSPT------LDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSC 159
            +E     +A  T             L+ +     L+VLD V DPHN+GA +RSA A   
Sbjct: 64  SEENHQGVVARCTPGETYDEAYLFSLLETLDEPPFLLVLDGVTDPHNLGACMRSAEAAGV 123

Query: 160 DGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKP 219
             +I  K  S   + V  K A GA E +P+I ++NL   L+K+   G    G + ++ + 
Sbjct: 124 HAVIAPKDKSAGLTPVARKVACGAAEVLPFIPVTNLARTLKKLQEKGIWLFGAAGEASQS 183

Query: 220 LEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNH 279
           L Q      IA+++GAEG GLR  TQET   + H+ M G + +LNVS A  V L+     
Sbjct: 184 LYQTRLTGPIAILMGAEGDGLRRLTQETCDQLMHIPMAGSVSSLNVSVATGVCLFEAVRQ 243

Query: 280 F 280
            
Sbjct: 244 R 244


>gi|329914600|ref|ZP_08276137.1| 23S rRNA (guanosine-2'-O-) -methyltransferase rlmB
           [Oxalobacteraceae bacterium IMCC9480]
 gi|327545100|gb|EGF30394.1| 23S rRNA (guanosine-2'-O-) -methyltransferase rlmB
           [Oxalobacteraceae bacterium IMCC9480]
          Length = 242

 Score =  136 bits (343), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 73/237 (30%), Positives = 114/237 (48%), Gaps = 7/237 (2%)

Query: 51  LYGVHTVSAALNNPSRKIFQLLA---TKNALARLDWDANLPHPFPVKTVPPQTIDKIVGK 107
           ++G H V+A L + +  + ++       +   +    A       V     Q +  +VG 
Sbjct: 2   IFGFHAVTARLRHEASTVEEIYVDTARHDQRMKDMLKAAAAVKVRVIQADDQRLSNMVGT 61

Query: 108 EAVHQGLAL----ETAPLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGII 163
                 +A       A  L   LDA+    LL+VLD + DPHN+GA LR A       +I
Sbjct: 62  RRHQGVVAKAGEVSLARNLDELLDAIDGPPLLLVLDGITDPHNLGACLRVADGAGAHAVI 121

Query: 164 TTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQE 223
             K  +   +A  AK ASGA E +PYI ++NL   L+ +   G   IG + D+++ L Q 
Sbjct: 122 APKDRAVGLNATAAKVASGAAESVPYITVTNLARTLRDLKDRGIWLIGTTEDAEQTLYQG 181

Query: 224 IKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
                 ALI+G+EG+G+R  T ET   + H+ M G +++LNVS A+ V L+  +   
Sbjct: 182 DFTGPTALIMGSEGEGMRRLTTETCDFLVHIPMFGAVESLNVSVASGVCLFEARRQR 238


>gi|319638350|ref|ZP_07993112.1| TrmH family RNA methyltransferase [Neisseria mucosa C102]
 gi|317400099|gb|EFV80758.1| TrmH family RNA methyltransferase [Neisseria mucosa C102]
          Length = 263

 Score =  136 bits (343), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 52/282 (18%), Positives = 95/282 (33%), Gaps = 25/282 (8%)

Query: 1   MNLISKKKSEKIFSLKDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAA 60
           M LI+  ++E++                  K +     +++   +     L GVH +   
Sbjct: 1   MKLITSAQNEQL------------------KHLFRLLTQAKARRESGETVLEGVHLLQTY 42

Query: 61  LNNPSRKIFQLLATKNALARLDWDA-NLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETA 119
           L +        L  K        +         +  V  + + KI         +     
Sbjct: 43  LQSGGTPKQVYLPEKKQQHPEIQEITAQLDEGLITWVGNEALSKITS-LTDADDVMTWID 101

Query: 120 PLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKS 179
                 L +  +    +VL+ V DP N G ILRSA A     I+ +       S  + ++
Sbjct: 102 IPKQAGLPSDDDC---VVLERVQDPGNAGTILRSAAAAGVKQIVCSNDSVDIWSPKVLRA 158

Query: 180 ASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKG 239
             GA   +       L+  ++K     + T     +          +   A + G EG G
Sbjct: 159 GMGAHFLLSIFSRVELSAWMEKYQHPIWATALGGRNIGLYEMN--LSQSCAWVFGNEGSG 216

Query: 240 LRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHFA 281
           +  + +E A +   + M G  ++LNV+ AA V L+       
Sbjct: 217 VSERIKEKAEACVKIPMLGQTESLNVAMAATVCLFEQMRQRI 258


>gi|261392720|emb|CAX50293.1| 23S rRNA (guanosine-2'-O-)-methyltransferase RlmB (23S rRNA Gm2251
           2'-O-methyltransferase) [Neisseria meningitidis 8013]
          Length = 250

 Score =  136 bits (343), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 69/238 (28%), Positives = 110/238 (46%), Gaps = 9/238 (3%)

Query: 51  LYGVHTVSAALNNPSRKIFQLLATK---NALARLDWDANLPHPFPVKTVPPQTIDKIVGK 107
           +YG H V+A L    + I +L   +   +A  R   +        V       ++ I  K
Sbjct: 7   IYGFHAVNARLWQNPKSIVELYIQEGKSDARTREVLEKAANENIRVYFADADRLNAIS-K 65

Query: 108 EAVHQGLALET-----APLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGI 162
            A HQG+            L   L+ +    LL++LD + DPHN+GA LR+A A     +
Sbjct: 66  GARHQGVVGFIDASKNHVHLEDVLENLSEPPLLLILDGITDPHNLGACLRTADAMGVHAV 125

Query: 163 ITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQ 222
           I  K  S   +A ++K A GA E +PYI ++NL   L+++  +G   IG        L  
Sbjct: 126 IAPKDKSAGLNATVSKVACGAAETVPYITVTNLARTLRELKEYGIWIIGTDMGGNADLYH 185

Query: 223 EIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
               D  A ++G EG G+R  T+E    +  + M G ++++NVS +A + L  T+   
Sbjct: 186 CDLPDSAAWVMGNEGDGMRRLTREHCDMLVSIPMFGTVESMNVSVSAGMVLSETRRQR 243


>gi|311693514|gb|ADP96387.1| RNA methyltransferase, TrmH family, group 3 [marine bacterium HP15]
          Length = 245

 Score =  136 bits (343), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 73/242 (30%), Positives = 111/242 (45%), Gaps = 12/242 (4%)

Query: 49  LFLYGVHTVSAALNNPSRKIFQLLAT---KNALARLDWDANLPHPFPVKTVPPQTIDKIV 105
            F++G H V A L     +  Q+      ++   +   D         K V  + +D+ V
Sbjct: 4   EFVFGWHAVEAVLKREPERFQQVWIQTGRQDKRVKSITDTLDGLGVKWKVVHRKELDERV 63

Query: 106 GKEAVHQGLALETAPLLSPTLDA-------VRNSQLLMVLDHVNDPHNIGAILRSAVAFS 158
               VHQG+    +     T D              L+VLD V DPHN+GA +R+A A  
Sbjct: 64  S--GVHQGVVAAVSESREWTEDDLLAQLAASDKPPFLLVLDGVTDPHNLGACMRTADAAG 121

Query: 159 CDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKK 218
              +I  K  S S + V  K A GA E +P++R++NL   L+ +   G   IG + ++  
Sbjct: 122 VQAVIVPKDKSASLTPVARKVACGAAETVPFVRVTNLARFLRSLQDQGVWLIGTAGEADA 181

Query: 219 PLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQN 278
            L Q      +AL++GAEGKG+R  T+E    + ++ M G + +LNVS A  V LY    
Sbjct: 182 TLYQADFKGPVALVMGAEGKGMRRLTREHCDQLINIPMLGHVDSLNVSVATGVCLYEALR 241

Query: 279 HF 280
             
Sbjct: 242 QR 243


>gi|85058322|ref|YP_454024.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Sodalis glossinidius
           str. 'morsitans']
 gi|84778842|dbj|BAE73619.1| conserved hypothetical protein [Sodalis glossinidius str.
           'morsitans']
          Length = 245

 Score =  136 bits (343), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 67/241 (27%), Positives = 107/241 (44%), Gaps = 8/241 (3%)

Query: 48  NLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDW---DANLPHPFPVKTVPPQTIDKI 104
           +  +YG+H V A L    ++   +   K    R               ++ V  Q +D+ 
Sbjct: 2   SEIIYGIHAVQALLERDPQRFLDVYLLKGRDDRRLQPLLQQLENAGIVIQMVSRQWLDEK 61

Query: 105 VGKEAVHQGLALETAPLLSPTLD-----AVRNSQLLMVLDHVNDPHNIGAILRSAVAFSC 159
                    +A   A       D       + + LL+VLD V DPHN+GA LR A A   
Sbjct: 62  AEGAVHQGIVARVQAGWQYQENDLPALLTQQAAPLLLVLDGVTDPHNLGACLRCADAAGV 121

Query: 160 DGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKP 219
             +I  +  +   +A   K ASGA E +P IR++NL   L+ +       +G + ++   
Sbjct: 122 HAVIVPRDRAAPLNATAKKVASGAAETVPLIRVTNLARTLRLLQEHNVWIVGTAGEADHH 181

Query: 220 LEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNH 279
           L Q      +AL++GAEG+G+R  T+E    +  + M G + +LNVS AA V+L+     
Sbjct: 182 LYQSKLTGPLALVMGAEGEGMRRLTREHCDELISIPMAGTVSSLNVSVAAGVSLFEAVRQ 241

Query: 280 F 280
            
Sbjct: 242 R 242


>gi|296270012|ref|YP_003652644.1| tRNA/rRNA methyltransferase SpoU [Thermobispora bispora DSM 43833]
 gi|296092799|gb|ADG88751.1| tRNA/rRNA methyltransferase (SpoU) [Thermobispora bispora DSM
           43833]
          Length = 277

 Score =  136 bits (343), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 53/256 (20%), Positives = 102/256 (39%), Gaps = 5/256 (1%)

Query: 28  RDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANL 87
              K ++    K     +       G   +  AL  P   + +L AT  A AR       
Sbjct: 10  PRVKAVRRL-TKRAFRDRDRAFLAEGPQAIREALRTPGVTV-ELYATTEAEARHPDIVAA 67

Query: 88  PH--PFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDHVNDPH 145
                 PV     + + ++         +A+     +         ++L+ VL HV DP 
Sbjct: 68  ARDAGVPVHRTSGEVMAELTQTVTPQGLVAVCRFVHVPLEEAVRPGARLVAVLAHVRDPG 127

Query: 146 NIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSW 205
           N G +LR+A A   D ++ T       +    ++++G+L H+P    +   + +++    
Sbjct: 128 NAGTVLRTADAAGADAVVFTDASVDPYNGKCVRASAGSLFHLPVSINARFPETVRQAREA 187

Query: 206 GFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNV 265
           G + +   +   + L++   +   A + G E  GL P+  E A  +  + + G  ++LN+
Sbjct: 188 GLRILAADASGARTLDEVDLSRPTAWVFGNEAWGLPPELLELADEVVRVPIYGRAESLNL 247

Query: 266 SNAAAVALYITQN-HF 280
           + AAAV LY +     
Sbjct: 248 ATAAAVCLYASARAQR 263


>gi|288553667|ref|YP_003425602.1| RNA methyltransferase [Bacillus pseudofirmus OF4]
 gi|288544827|gb|ADC48710.1| RNA methyltransferase, TrmH family [Bacillus pseudofirmus OF4]
          Length = 281

 Score =  136 bits (343), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 57/277 (20%), Positives = 111/277 (40%), Gaps = 27/277 (9%)

Query: 1   MNLISKKKSEKIFSLKDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAA 60
           M  I   K+E++   K  H                     +   +     + G H V  A
Sbjct: 31  MKRIDSVKNEQVKGWKKLHTK-------------------KGRDKAGRFLIEGFHLVEEA 71

Query: 61  LNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAP 120
           L      I  +L T+  +  L W+    +   +  V PQ + +I   E      A+   P
Sbjct: 72  LKA-KFHIEVILMTEQTVLPLTWEV---YENDIIIVSPQVLKEISETETPQGIAAVCAIP 127

Query: 121 LLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSA 180
                      S   +++D V DP NIG ++R+A A    G++  +      ++ + +++
Sbjct: 128 APP---SMTTLSGQFLLIDRVQDPGNIGTMIRTADAAGMTGVVLGEGSVDLFNSKVIRAS 184

Query: 181 SGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGL 240
            G++ H+P IR S +    +             +++      E + +  ALI+G EG+G+
Sbjct: 185 QGSIFHMPVIRGSLIEWVEKLKEKNIPVFGTSLTEASSYTAIEPQPE-FALIVGNEGEGV 243

Query: 241 RPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQ 277
           + +  E +    ++ + G  ++LNV+ A  + LY  +
Sbjct: 244 QSELLEGSDQNIYIPIYGQAESLNVAVATGILLYYLK 280


>gi|288575697|ref|ZP_06393898.1| RNA methyltransferase, TrmH family [Neisseria mucosa ATCC 25996]
 gi|288567117|gb|EFC88677.1| RNA methyltransferase, TrmH family [Neisseria mucosa ATCC 25996]
          Length = 260

 Score =  136 bits (343), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 52/283 (18%), Positives = 87/283 (30%), Gaps = 26/283 (9%)

Query: 1   MNLISKKKSEKIFSLKDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAA 60
           M  I+  ++E++                  K +     +S+   +     L GVH +   
Sbjct: 1   MKSITSAQNEQL------------------KHLSKLLSQSKARREYGQTVLEGVHLLQVY 42

Query: 61  LNNPSRKIFQLLATKNALARLDWDAN--LPHPFPVKTVPPQTIDKIVGKEAVHQGLALET 118
           L          L           +    L     +  V  + + KI         +    
Sbjct: 43  LEAGYTPKQVYLPESKNTHPEIRNLISSLDEDC-ITWVGNEALSKITS-LNDADDVMTWI 100

Query: 119 APLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAK 178
                  L    +    +VLD + DP N+G +LRSA A     I+         S  + +
Sbjct: 101 EIPPQGDLPLSGDC---VVLDRLQDPGNVGTVLRSAAASGVRQIVLGNDCVDIWSPKVLR 157

Query: 179 SASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGK 238
           +  GA   +  I            +        L   +   L Q   N   A + G EG 
Sbjct: 158 AGMGAHL-LLNIYSRVSLPQWLDTYQDKIWATALDGRNPSDLYQLDLNAPCAWVFGNEGS 216

Query: 239 GLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHFA 281
           G+  +  E       + M G  ++LNV+ AA V L+       
Sbjct: 217 GVSREILEKVDGGVRIPMLGQTESLNVAMAATVCLFEQMRQRI 259


>gi|167769675|ref|ZP_02441728.1| hypothetical protein ANACOL_01009 [Anaerotruncus colihominis DSM
           17241]
 gi|167668036|gb|EDS12166.1| hypothetical protein ANACOL_01009 [Anaerotruncus colihominis DSM
           17241]
          Length = 256

 Score =  136 bits (343), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 66/258 (25%), Positives = 116/258 (44%), Gaps = 17/258 (6%)

Query: 37  NQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALAR-----LDWDANLPHPF 91
           N   +   +   +   G + V   L    R++  +    +  AR                
Sbjct: 3   NSNPKRDLEEGLVL--GRNAVIELLK-GPREVECIYICDDVPARGQPISRIVALAKEARV 59

Query: 92  PVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDA-------VRNSQLLMVLDHVNDP 144
           PVK V  + +D +      HQG+A + A     T++             LL++ D + DP
Sbjct: 60  PVKRVDVRRLDTLANGL-NHQGVAAQAAAFHYCTVEELFARAAARGEPPLLVIADSIEDP 118

Query: 145 HNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHS 204
           HN+GAI+R+A A    G+I  KR     +A++ ++++GA+EH+P  R++NL   ++++ +
Sbjct: 119 HNLGAIIRTAEAAGAHGLIIPKRGGAGLTAIVGRTSAGAVEHLPVARVTNLVSTIKELKA 178

Query: 205 WGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALN 264
            G    G  +   +   Q       AL++G+EG GL    +ET  ++  L M G + +LN
Sbjct: 179 RGVWIYGADASGARWD-QTDLTGPSALVIGSEGFGLSRLVRETCDALLSLPMRGEVNSLN 237

Query: 265 VSNAAAVALYITQNHFAK 282
            S AA + +Y       K
Sbjct: 238 ASVAAGILMYEAVRQRTK 255


>gi|30248779|ref|NP_840849.1| tRNA/rRNA methyltransferase (SpoU) [Nitrosomonas europaea ATCC
           19718]
 gi|30180374|emb|CAD84686.1| tRNA/rRNA methyltransferase (SpoU) [Nitrosomonas europaea ATCC
           19718]
          Length = 277

 Score =  136 bits (343), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 43/260 (16%), Positives = 91/260 (35%), Gaps = 7/260 (2%)

Query: 24  RRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDW 83
            R H  +KK+      +R         L G+H + + L +    +  +++   +      
Sbjct: 6   SREHPLFKKLFKLQHSARQRHDEGMTLLDGIHLLQSCLASGKTPVLLIVSESGSQHPEIS 65

Query: 84  DANLPHPFPVKTVP----PQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLD 139
              +      +         T+   +       G+                 +   ++L+
Sbjct: 66  QLLIHIDKDPQKTDCLMLSDTLFNQISPVKTPVGILALIDIPQHTLPADTYQNSFSILLE 125

Query: 140 HVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDAL 199
            + DP N+G++LRSA A   +G+  +   + + S    ++  GA   +      +L    
Sbjct: 126 GIQDPGNLGSMLRSAAAAGVEGVFLSSDCADAWSPKTLRAGMGAHFSLKIHENVDLIQVA 185

Query: 200 QKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGI 259
           ++        +  +      L        +  + G EG G+  +  ET      + MPG 
Sbjct: 186 RQFAGNV---VATTLHDASNLFHTDLRGAVVFVFGNEGGGISEELLETVHQRVMIPMPGC 242

Query: 260 IKALNVSNAAAVALYITQNH 279
            ++LNV+ AAA+ L+     
Sbjct: 243 TESLNVATAAAICLFEKVRQ 262


>gi|290968521|ref|ZP_06560060.1| RNA methyltransferase, TrmH family, group 3 [Megasphaera genomosp.
           type_1 str. 28L]
 gi|290781517|gb|EFD94106.1| RNA methyltransferase, TrmH family, group 3 [Megasphaera genomosp.
           type_1 str. 28L]
          Length = 250

 Score =  136 bits (342), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 58/244 (23%), Positives = 110/244 (45%), Gaps = 10/244 (4%)

Query: 46  PENLFLYGVHTVSAALNNPS--RKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDK 103
               ++ G ++V  AL       KI+   +   A  +            V+    + +D+
Sbjct: 2   SGLAWITGRNSVLEALRAGRKIEKIYIASSPHGAALQEIMSLAKAAHIVVEERDRKALDR 61

Query: 104 IVGKEAVHQGLALETAPLLSPTLDAVR-------NSQLLMVLDHVNDPHNIGAILRSAVA 156
           +V ++  HQG+A +  P+   + +               ++LD + D HN+GAI+R+A  
Sbjct: 62  LVPQQR-HQGVAAQAQPIAMTSWETCAATAARRGEVPFFVLLDGIEDVHNMGAIIRTAEC 120

Query: 157 FSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDS 216
                ++  KR+S   +  + K+++GA+E++P + I N T  L+ +   GF  IG   + 
Sbjct: 121 AGAHAVLIPKRHSAPINETVGKTSAGAVEYMPLVSIGNTTQVLKALKKAGFWIIGADMNG 180

Query: 217 KKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYIT 276
           +           + L++G EGKG+    +E    +  + M G + +LN S AAA+ +Y T
Sbjct: 181 EADYFHTDMTMPLVLVIGNEGKGISRLVKENCDILVQIPMFGHVNSLNASVAAALLIYET 240

Query: 277 QNHF 280
               
Sbjct: 241 VRQR 244


>gi|302382701|ref|YP_003818524.1| RNA methyltransferase, TrmH family, group 3 [Brevundimonas
           subvibrioides ATCC 15264]
 gi|302193329|gb|ADL00901.1| RNA methyltransferase, TrmH family, group 3 [Brevundimonas
           subvibrioides ATCC 15264]
          Length = 304

 Score =  136 bits (342), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 87/257 (33%), Positives = 140/257 (54%), Gaps = 3/257 (1%)

Query: 27  HRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDAN 86
           +   +   S   +        + FL+G H V AAL NP+RK    L      A       
Sbjct: 48  NPPARAFSSAAPRPSRGKVDADGFLWGRHPVLAALANPARKGMGRLLATEDRAAEIEREG 107

Query: 87  LPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDA--VRNSQLLMVLDHVNDP 144
             +   ++ +  QT+++++   AVHQG+A +  PL   +L+        ++++LD + DP
Sbjct: 108 TANGHKIEVMDAQTLERMLPAGAVHQGMAFKVQPLEGVSLEDLGDPAEGIIVMLDQLTDP 167

Query: 145 HNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHS 204
            N+GAI RSA+AF   GI+   R+SP  +  LAK+A+GA E +P  R++NL+ AL+++  
Sbjct: 168 QNVGAIFRSALAFGARGIVVQDRHSPVLAGALAKAAAGATERLPCARVTNLSRALERLAD 227

Query: 205 WGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALN 264
            G++ +GL  DS++ LE  + +    L++G+EG G+R    E    +A + MPG  ++LN
Sbjct: 228 LGWRAVGLDGDSEELLENALDHRPTVLVMGSEGDGIRRLVAEHCDVLAKIPMPGGFESLN 287

Query: 265 VSNAAAVALYITQN-HF 280
           VSNAAAVALY       
Sbjct: 288 VSNAAAVALYEATRKQR 304


>gi|226326635|ref|ZP_03802153.1| hypothetical protein PROPEN_00485 [Proteus penneri ATCC 35198]
 gi|225204856|gb|EEG87210.1| hypothetical protein PROPEN_00485 [Proteus penneri ATCC 35198]
          Length = 247

 Score =  136 bits (342), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 65/242 (26%), Positives = 99/242 (40%), Gaps = 8/242 (3%)

Query: 48  NLFLYGVHTVSAALNNPSRKIFQLLATKNALARLD---WDANLPHPFPVKTVPPQTIDKI 104
              +YG+H V A L     +  ++   K    R               V+    Q +D  
Sbjct: 3   EEIIYGIHAVKALLERDPARFKEVYVLKGREDRRLTPVIHELEAQGILVQVANRQWLDSQ 62

Query: 105 VGKEAVHQGLALETAPLLSPTLDAVR-----NSQLLMVLDHVNDPHNIGAILRSAVAFSC 159
                    +A           D         +  L+VLD V DPHN+GA LRSA A   
Sbjct: 63  TEGAVHQGIIAKVKPGRQYQEQDLPDLLAKVGTPFLLVLDGVTDPHNLGACLRSADAAGV 122

Query: 160 DGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKP 219
             +I  K  S   +A   K A GA E +P I+++NL   L+ +       +G + ++   
Sbjct: 123 HAVIVPKDRSAQLNATAKKVACGAAESVPLIKVTNLARTLRFLQEENVWIVGTAGEADHT 182

Query: 220 LEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNH 279
           L Q      +AL++GAEG+G+R  T+E    +  + M G + +LNVS A  V L+     
Sbjct: 183 LYQSKLTGPMALVMGAEGEGMRRLTREHCDELISIPMAGTVSSLNVSVATGVCLFEAMRQ 242

Query: 280 FA 281
             
Sbjct: 243 RI 244


>gi|291619082|ref|YP_003521824.1| RlmB [Pantoea ananatis LMG 20103]
 gi|291154112|gb|ADD78696.1| RlmB [Pantoea ananatis LMG 20103]
          Length = 259

 Score =  136 bits (342), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 69/243 (28%), Positives = 110/243 (45%), Gaps = 10/243 (4%)

Query: 48  NLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDW---DANLPHPFPVKTVPPQTIDKI 104
           +  ++G+H V A L    ++  ++   K    R       A       ++    + +D  
Sbjct: 17  SEIIFGIHAVQALLERDPQRFQEVFILKGRDDRRLQPLVTALEAQGIVIQLADRKWLDSQ 76

Query: 105 VGKEAVHQGLALETAPLLSP------TLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFS 158
           V +  VHQG+     P           L        L+VLD V DPHN+GA LRSA A  
Sbjct: 77  V-EGGVHQGIVARVKPGRQYQEGDLPDLLQSLEKPFLLVLDGVTDPHNLGACLRSADAAG 135

Query: 159 CDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKK 218
              +I  K  S   +A   K ASGA E++P IR++NL   L+ +  +    +G + ++  
Sbjct: 136 AHAVIVPKDRSAPLNATAKKVASGAAENVPLIRVTNLARTLRLLQEYNIWVVGTAGEADH 195

Query: 219 PLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQN 278
            + Q      +AL++GAEG+G+R  T+E    +  + M G + +LNVS A  V L+    
Sbjct: 196 TVYQSKMTGPMALVMGAEGEGMRRLTREHCDELISIPMAGSVSSLNVSVATGVCLFEAVR 255

Query: 279 HFA 281
              
Sbjct: 256 QRN 258


>gi|320187058|gb|EFW61769.1| 23S rRNA guanosine-2'-O--methyltransferase [Shigella flexneri CDC
           796-83]
 gi|332087040|gb|EGI92174.1| RNA 2'-O ribose methyltransferase substrate binding family protein
           [Shigella boydii 3594-74]
          Length = 240

 Score =  136 bits (342), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 62/239 (25%), Positives = 103/239 (43%), Gaps = 8/239 (3%)

Query: 51  LYGVHTVSAALNNPSRKIFQLLATKNALARLD---WDANLPHPFPVKTVPPQTIDKIVGK 107
           +YG+H V A L     +  ++   K    +       A       ++    Q +D+    
Sbjct: 2   IYGIHAVQALLERAPERFQEVFILKGREDKRLLPLIHALEAQGVVIQLANRQYLDEKSDG 61

Query: 108 EAVHQGLALETAPLLSPTLDAVR-----NSQLLMVLDHVNDPHNIGAILRSAVAFSCDGI 162
                 +A           D        +   L++LD V DPHN+GA LRSA A     +
Sbjct: 62  AVHQGIIARVKPGRQYQENDLPDLIASLDQPFLLILDGVTDPHNLGACLRSADAAGVHAV 121

Query: 163 ITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQ 222
           I  K  S   +A   K A GA E +P IR++NL   ++ +       +G + ++   L Q
Sbjct: 122 IVPKDRSAQLNATAKKVACGAAESVPLIRVTNLVRTMRMLQEENIWIVGTAGEADHTLYQ 181

Query: 223 EIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHFA 281
                ++AL++GAEG+G+R  T+E    +  + M G + +LNVS A  + L+      +
Sbjct: 182 SKMTGRLALVMGAEGEGMRRLTREHCDELISIPMAGSVSSLNVSVATGICLFEAVRQRS 240


>gi|114567860|ref|YP_755014.1| tRNA/rRNA methyltransferase YacO [Syntrophomonas wolfei subsp.
           wolfei str. Goettingen]
 gi|114338795|gb|ABI69643.1| conserved hypothetical tRNA/rRNA methyltransferase yacO
           [Syntrophomonas wolfei subsp. wolfei str. Goettingen]
          Length = 248

 Score =  136 bits (342), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 58/244 (23%), Positives = 113/244 (46%), Gaps = 14/244 (5%)

Query: 48  NLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWD---ANLPHPFPVKTVPPQTIDKI 104
              ++G++ VS AL    R+++++ A +    +   +           ++ +  + +D++
Sbjct: 2   KELVFGINAVSEALK-GQRRVYKIYAQRERQDKRLEEILTLAREKQLKLQYLEKKKMDEL 60

Query: 105 VGKEAVHQGLALETAPLLSPTL--------DAVRNSQLLMVLDHVNDPHNIGAILRSAVA 156
              E  HQG+  E        L                L++LD + DP N+GAI+R+A  
Sbjct: 61  C--EGKHQGIIAEVERYPYADLGQVLEKLQAQKEKPPFLLLLDGIEDPQNLGAIIRTAEC 118

Query: 157 FSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDS 216
              DGII     S   +  +++ ++GA+EH+  IR +NL + ++ +   GF  +G  + +
Sbjct: 119 AGVDGIIIPSHKSAEVNPTVSRVSAGAVEHMAIIRENNLVNTIKYLKQEGFWVLGADAKA 178

Query: 217 KKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYIT 276
           ++           AL++G EG+G+R   +E    +  + M G + +LN S AAA+ +Y  
Sbjct: 179 RQSYFNTSIPSPTALVIGGEGQGIRRLVRENCDILVRIPMFGQLNSLNASVAAALLIYEV 238

Query: 277 QNHF 280
               
Sbjct: 239 LRQR 242


>gi|307132421|ref|YP_003884437.1| 23S rRNA (Gm2251)-methyltransferase [Dickeya dadantii 3937]
 gi|306529950|gb|ADM99880.1| 23S rRNA (Gm2251)-methyltransferase [Dickeya dadantii 3937]
          Length = 244

 Score =  136 bits (342), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 66/241 (27%), Positives = 104/241 (43%), Gaps = 8/241 (3%)

Query: 48  NLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANL---PHPFPVKTVPPQTIDKI 104
           +  +YG+H V A L    ++  ++   K    R           +   V+    Q +D  
Sbjct: 2   SEIIYGIHAVKALLEQDPQRFLEVFTLKGREDRRLQPLIAELEANGIAVQVANRQWLDDK 61

Query: 105 VGKEAVHQGLALETAPLLSPTLDAVR-----NSQLLMVLDHVNDPHNIGAILRSAVAFSC 159
           V        +A           D        ++  L+VLD V DPHN+GA LRSA A   
Sbjct: 62  VEGAVHQGIVARVKEGRQYQENDLPGLLASLDTPFLLVLDGVTDPHNLGACLRSADAAGV 121

Query: 160 DGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKP 219
             +I  +  S   +A   K A GA E +P IR++NL   L+ +       +G + ++   
Sbjct: 122 HAVIVPRDRSAQLNATAKKVACGAAETVPLIRVTNLARTLRFLQEQNVWIVGTAGEADHT 181

Query: 220 LEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNH 279
           L Q      +AL++GAEG+G+R  T+E    +  + M G + +LNVS A  V L+     
Sbjct: 182 LYQSKLTGPLALVMGAEGEGMRRLTREHCDELISIPMAGSVSSLNVSVATGVCLFEAVRQ 241

Query: 280 F 280
            
Sbjct: 242 R 242


>gi|255066315|ref|ZP_05318170.1| RNA methyltransferase, TrmH family, group 3 [Neisseria sicca ATCC
           29256]
 gi|255049525|gb|EET44989.1| RNA methyltransferase, TrmH family, group 3 [Neisseria sicca ATCC
           29256]
          Length = 249

 Score =  136 bits (342), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 69/239 (28%), Positives = 111/239 (46%), Gaps = 9/239 (3%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLATK---NALARLDWDANLPHPFPVKTVPPQTIDKIVG 106
            +YG H V+A L    + I +L   +   +A  R   +        V       ++ I  
Sbjct: 6   LIYGFHAVNARLWQNPKSITELYVQEGKNDARTRDVLEKAANENVRVHFADADRLNAIS- 64

Query: 107 KEAVHQGLALET-----APLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDG 161
           K A HQG+            L   L+ +    LL++LD + DPHN+GA LR+A A     
Sbjct: 65  KGARHQGVVGFIDASKNHVHLEDVLENLSEPPLLLILDGITDPHNLGACLRTADAMGVHA 124

Query: 162 IITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLE 221
           +I  K  S   +A ++K A GA E +PYI ++NL   L+++  +G   IG        L 
Sbjct: 125 VIAPKDKSAGLNATVSKVACGAAETVPYITVTNLARTLRELKEYGIWIIGTDMGGDSDLY 184

Query: 222 QEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
                D  A ++G EG+G+R  T+E    +  + M G ++++NVS +A + L  T+   
Sbjct: 185 HCDLPDSAAWVMGNEGEGMRRLTREHCDMLVSIPMFGTVESMNVSVSAGMVLSETRRQR 243


>gi|330003381|ref|ZP_08304596.1| RNA methyltransferase, TrmH family, group 3 [Klebsiella sp. MS
           92-3]
 gi|328536991|gb|EGF63283.1| RNA methyltransferase, TrmH family, group 3 [Klebsiella sp. MS
           92-3]
          Length = 255

 Score =  136 bits (342), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 68/243 (27%), Positives = 111/243 (45%), Gaps = 10/243 (4%)

Query: 48  NLFLYGVHTVSAALNNPSRKIFQLLATKNALARLD---WDANLPHPFPVKTVPPQTIDKI 104
           +  +YG+H V A L     +  ++   K    +       A       ++    Q +D+ 
Sbjct: 14  SEMIYGIHAVQALLERAPERFQEVYILKGREDKRLLPLIHALEAQGVVIQLANRQFLDEK 73

Query: 105 VGKEAVHQGLALETAPLLSP------TLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFS 158
             + AVHQG+     P           L A  +   L++LD V DPHN+GA LRSA A  
Sbjct: 74  S-EGAVHQGIIARVKPGRQYQENDLPDLLAQLDQPFLLILDGVTDPHNLGACLRSADAAG 132

Query: 159 CDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKK 218
              +I  K  S   +A   K A GA E++P IR++NL   ++ +       +G + ++  
Sbjct: 133 VHAVIVPKDRSAQLNATAKKVACGAAENVPLIRVTNLARTMRLLQEENVWIVGTAGEADH 192

Query: 219 PLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQN 278
            L Q      +AL++GAEG+G+R  T+E    +  + M G + +LNVS A  + L+    
Sbjct: 193 TLFQSKMTGPMALVMGAEGEGMRRLTREHCDELISIPMAGSVSSLNVSVATGICLFEAVR 252

Query: 279 HFA 281
             +
Sbjct: 253 QRS 255


>gi|254700959|ref|ZP_05162787.1| tRNA/rRNA methyltransferase (SpoU) [Brucella suis bv. 5 str. 513]
 gi|261751478|ref|ZP_05995187.1| tRNA/rRNA methyltransferase [Brucella suis bv. 5 str. 513]
 gi|261741231|gb|EEY29157.1| tRNA/rRNA methyltransferase [Brucella suis bv. 5 str. 513]
          Length = 297

 Score =  136 bits (342), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 47/255 (18%), Positives = 83/255 (32%), Gaps = 4/255 (1%)

Query: 27  HRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDAN 86
           +   K ++S   K +   Q       G+  V  AL    R    + A      +      
Sbjct: 35  NPIVKDLRSLALK-KFRDQQGVFLAEGLKLVIDALEQDWRIKTLVFAKSGKGNKTVEQVA 93

Query: 87  L---PHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDHVND 143
                    V  V  + I  I  ++       +             + + + + LD V D
Sbjct: 94  ARTFAKGGLVLEVTEKVISAITRRDNPQMVAGVFEQQYHQLAGLKPKGNDVYVALDRVRD 153

Query: 144 PHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMH 203
           P N+G ++R A A    G+I     +   S    ++  G++  +P  R S       +  
Sbjct: 154 PGNLGTVIRIADAVGAKGVILIGDTTDPYSLETVRATMGSVFSVPLYRASEADFLNWRKG 213

Query: 204 SWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKAL 263
             G         +         N  + LI+G E +GL          +A +   G   +L
Sbjct: 214 FSGLVVGTHLKGAVDYRTIPYANKPVILIMGNEQQGLPDSLAGACDKLARIPQAGRADSL 273

Query: 264 NVSNAAAVALYITQN 278
           N++ A  V LY  + 
Sbjct: 274 NLAIATGVMLYEIRR 288


>gi|152973051|ref|YP_001338197.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Klebsiella pneumoniae
           subsp. pneumoniae MGH 78578]
 gi|238892665|ref|YP_002917399.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Klebsiella pneumoniae
           NTUH-K2044]
 gi|150957900|gb|ABR79930.1| Gm2251 methyltransferase of 23S rRNA [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
 gi|238544981|dbj|BAH61332.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Klebsiella pneumoniae
           subsp. pneumoniae NTUH-K2044]
          Length = 243

 Score =  136 bits (342), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 68/243 (27%), Positives = 111/243 (45%), Gaps = 10/243 (4%)

Query: 48  NLFLYGVHTVSAALNNPSRKIFQLLATKNALARLD---WDANLPHPFPVKTVPPQTIDKI 104
           +  +YG+H V A L     +  ++   K    +       A       ++    Q +D+ 
Sbjct: 2   SEMIYGIHAVQALLERAPERFQEVYILKGREDKRLLPLIHALEAQGVVIQLANRQFLDEK 61

Query: 105 VGKEAVHQGLALETAPLLSP------TLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFS 158
             + AVHQG+     P           L A  +   L++LD V DPHN+GA LRSA A  
Sbjct: 62  S-EGAVHQGIIARVKPGRQYQENDLPDLLAQLDQPFLLILDGVTDPHNLGACLRSADAAG 120

Query: 159 CDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKK 218
              +I  K  S   +A   K A GA E++P IR++NL   ++ +       +G + ++  
Sbjct: 121 VHAVIVPKDRSAQLNATAKKVACGAAENVPLIRVTNLARTMRLLQEENVWIVGTAGEADH 180

Query: 219 PLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQN 278
            L Q      +AL++GAEG+G+R  T+E    +  + M G + +LNVS A  + L+    
Sbjct: 181 TLFQSKMTGPMALVMGAEGEGMRRLTREHCDELISIPMAGSVSSLNVSVATGICLFEAVR 240

Query: 279 HFA 281
             +
Sbjct: 241 QRS 243


>gi|23501061|ref|NP_697188.1| RNA methyltransferase [Brucella suis 1330]
 gi|148559270|ref|YP_001258183.1| RNA methyltransferase [Brucella ovis ATCC 25840]
 gi|161618138|ref|YP_001592025.1| tRNA/rRNA methyltransferase (SpoU) [Brucella canis ATCC 23365]
 gi|163842420|ref|YP_001626824.1| tRNA/rRNA methyltransferase (SpoU) [Brucella suis ATCC 23445]
 gi|254705329|ref|ZP_05167157.1| tRNA/rRNA methyltransferase (SpoU) [Brucella suis bv. 3 str. 686]
 gi|256368614|ref|YP_003106120.1| RNA methyltransferase, TrmH family [Brucella microti CCM 4915]
 gi|260567212|ref|ZP_05837682.1| tRNA/rRNA methyltransferase [Brucella suis bv. 4 str. 40]
 gi|261756040|ref|ZP_05999749.1| tRNA/rRNA methyltransferase [Brucella suis bv. 3 str. 686]
 gi|294851549|ref|ZP_06792222.1| TrmH family RNA methyltransferase [Brucella sp. NVSL 07-0026]
 gi|23346928|gb|AAN29103.1| RNA methyltransferase, TrmH family [Brucella suis 1330]
 gi|148370527|gb|ABQ60506.1| RNA methyltransferase, TrmH family [Brucella ovis ATCC 25840]
 gi|161334949|gb|ABX61254.1| tRNA/rRNA methyltransferase (SpoU) [Brucella canis ATCC 23365]
 gi|163673143|gb|ABY37254.1| tRNA/rRNA methyltransferase (SpoU) [Brucella suis ATCC 23445]
 gi|255998772|gb|ACU47171.1| RNA methyltransferase, TrmH family [Brucella microti CCM 4915]
 gi|260156730|gb|EEW91810.1| tRNA/rRNA methyltransferase [Brucella suis bv. 4 str. 40]
 gi|261745793|gb|EEY33719.1| tRNA/rRNA methyltransferase [Brucella suis bv. 3 str. 686]
 gi|294820138|gb|EFG37137.1| TrmH family RNA methyltransferase [Brucella sp. NVSL 07-0026]
          Length = 297

 Score =  136 bits (342), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 47/255 (18%), Positives = 84/255 (32%), Gaps = 4/255 (1%)

Query: 27  HRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDAN 86
           +   K ++S   K +   Q       G+  V  AL    R    + A      +      
Sbjct: 35  NPIVKDLRSLALK-KFRDQQGVFLAEGLKLVIDALEQDWRIKTLVFAKSGKGNKTVEQVA 93

Query: 87  L---PHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDHVND 143
                    V  V  + I  I  ++       +             + + + + LD V D
Sbjct: 94  ARTFAKGGLVLEVTEKVISAITRRDNPQMVAGVFEQQYHQLAGLKPKGNDVYVALDRVRD 153

Query: 144 PHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMH 203
           P N+G ++R+A A    G+I     +   S    ++  G++  +P  R S       +  
Sbjct: 154 PGNLGTVIRTADAVGAKGVILIGDTTDPYSLETVRATMGSVFSVPLYRASEADFLNWRKG 213

Query: 204 SWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKAL 263
             G         +         N  + LI+G E +GL          +A +   G   +L
Sbjct: 214 FSGLVVGTHLKGAVDYRTIPYANKPVILIMGNEQQGLPDSLAGACDKLARIPQAGRADSL 273

Query: 264 NVSNAAAVALYITQN 278
           N++ A  V LY  + 
Sbjct: 274 NLAIATGVMLYEIRR 288


>gi|83312248|ref|YP_422512.1| rRNA methylase [Magnetospirillum magneticum AMB-1]
 gi|82947089|dbj|BAE51953.1| rRNA methylase [Magnetospirillum magneticum AMB-1]
          Length = 267

 Score =  136 bits (342), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 104/270 (38%), Positives = 153/270 (56%), Gaps = 11/270 (4%)

Query: 15  LKDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLAT 74
           +K +        H   K  Q             +++LYG+H V AAL NP R+  +L+AT
Sbjct: 1   MKKTEERNRPHGHGKGKPPQHPRGSGGGGGGGSSIWLYGIHAVCAALANPDRRARRLVAT 60

Query: 75  KNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQ- 133
             A   L          PV+T+    ID+++   +VHQG+AL   PL + T++ V     
Sbjct: 61  VEAAKSLP-----ATKVPVETMERSEIDRLLAPGSVHQGVALLVEPLPATTIEDVIRMAD 115

Query: 134 -----LLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIP 188
                L++VLD V DPHN+GAILRSA AF    ++   R++P E+  LAKSASGALE +P
Sbjct: 116 GAPSALVLVLDQVTDPHNVGAILRSAAAFGALAVVAPDRHTPDETGTLAKSASGALERMP 175

Query: 189 YIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETA 248
            +R++N+   L+ +   GF T GL++D+ K L +   + K+ L+LGAEG+G+R  T+E  
Sbjct: 176 LVRVTNVVRTLEDLKKAGFWTAGLAADAPKTLAEANLSGKVVLVLGAEGEGMRRLTREHC 235

Query: 249 TSMAHLHMPGIIKALNVSNAAAVALYITQN 278
             +  L M G +++LNVSNAAAVALY  + 
Sbjct: 236 DHLVRLPMCGEMESLNVSNAAAVALYEMRR 265


>gi|295094033|emb|CBK83124.1| rRNA methylase, putative, group 3 [Coprococcus sp. ART55/1]
          Length = 260

 Score =  136 bits (342), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 51/258 (19%), Positives = 107/258 (41%), Gaps = 11/258 (4%)

Query: 32  KMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSR--KIFQLLATKNALARLDWDANLPH 89
           + + F    +  S  E   + G + V  A  +     K++ L   ++ +           
Sbjct: 2   QNREFENNIKTESDEEAFVIEGRNAVLEAFRSGKTIDKLYVLDGCRDGIVNSIVREAKKQ 61

Query: 90  PFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAV-------RNSQLLMVLDHVN 142
              +  +  + ++++  +   HQG+    A      ++ +              +LD + 
Sbjct: 62  DTVINYLSKEKLNQMS-QAGKHQGVIAHAAAYKYAEIEDMFALAESRGEDPFFFILDEIE 120

Query: 143 DPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKM 202
           DPHN+GAI+R+A      G+I  KR +   +A + K+++GA+ + P  +++N++  ++++
Sbjct: 121 DPHNLGAIIRTANLCGAHGVIIPKRRAVGITATVVKASAGAINYTPVAKVTNISKTIEEL 180

Query: 203 HSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKA 262
              G        D +   +       + L++G EG G+    +E    +  + M G I +
Sbjct: 181 KDRGMWFACADMDGELMYKCN-LTGSLGLVIGNEGSGVSRLVKEKCDYVVSVPMKGDIDS 239

Query: 263 LNVSNAAAVALYITQNHF 280
           LN S AA V  Y      
Sbjct: 240 LNASVAAGVLAYEVVRQR 257


>gi|218768017|ref|YP_002342529.1| putative RNA methylase [Neisseria meningitidis Z2491]
 gi|52783328|sp|Q9JUU8|RLMB_NEIMA RecName: Full=23S rRNA (guanosine-2'-O-)-methyltransferase RlmB;
           AltName: Full=23S rRNA Gm2251 2'-O-methyltransferase
 gi|121052025|emb|CAM08334.1| putative RNA methylase [Neisseria meningitidis Z2491]
          Length = 250

 Score =  136 bits (342), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 70/238 (29%), Positives = 111/238 (46%), Gaps = 9/238 (3%)

Query: 51  LYGVHTVSAALNNPSRKIFQLLATK---NALARLDWDANLPHPFPVKTVPPQTIDKIVGK 107
           +YG H V+A L    + I +L   +   +A  R   +        V       ++ I  K
Sbjct: 7   IYGFHAVNARLWQNPKSIVELYIQEGKSDARTREVLEKAANENIRVYFADADRLNAIS-K 65

Query: 108 EAVHQGLALET-----APLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGI 162
            A HQG+            L   L+ +    LL++LD + DPHN+GA LR+A A     +
Sbjct: 66  GARHQGVVGFIDASKNHVHLEDVLENLSEPPLLLILDGITDPHNLGACLRTADAMGVHAV 125

Query: 163 ITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQ 222
           I  K  S   +A ++K ASGA E +PYI ++NL   L+++  +G   IG        L  
Sbjct: 126 IAPKDKSAGLNATVSKVASGAAETVPYITVTNLARTLRELKEYGIWIIGTDMGGNADLYH 185

Query: 223 EIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
               D  A ++G EG G+R  T+E    +  + M G ++++NVS +A + L  T+   
Sbjct: 186 CDLPDSAAWVMGNEGDGMRRLTREHCDMLVSIPMFGTVESMNVSVSAGMVLSETRRQR 243


>gi|77361394|ref|YP_340969.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Pseudoalteromonas
           haloplanktis TAC125]
 gi|76876305|emb|CAI87527.1| Gm2251 methyltransferase of 23S rRNA [Pseudoalteromonas
           haloplanktis TAC125]
          Length = 247

 Score =  136 bits (342), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 63/243 (25%), Positives = 110/243 (45%), Gaps = 10/243 (4%)

Query: 48  NLFLYGVHTVSAALNNPSRKIFQLLATKNALARL---DWDANLPHPFPVKTVPPQTIDKI 104
           N  ++G H+V A L +   +  ++ A K    +      D  L     V+ +  + +D  
Sbjct: 3   NELIFGFHSVEAILASEPERFVEIYALKGRDDKRSTPIIDEALKFGISVQYMQRKALDSK 62

Query: 105 VGKEAVHQGLALETAPLLSPTLDA------VRNSQLLMVLDHVNDPHNIGAILRSAVAFS 158
              E  HQG+        +             ++  L+VLD + DPHN+GA LRSA A  
Sbjct: 63  SKGE-QHQGIIANVKAAPTFNEKDLDAIIAREDTPFLLVLDGITDPHNLGACLRSADAAG 121

Query: 159 CDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKK 218
              +I  K  S   +    K A GA E +P I+++NL   L+++   G   +G + ++  
Sbjct: 122 VHAVIVPKDRSAKLNGTARKVACGAAETVPLIQVTNLARTLREIKDAGVWVVGTAGETDN 181

Query: 219 PLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQN 278
            +        +A+++GAEG+G+R  T+E    +  + M G + +LNVS A  + L+    
Sbjct: 182 HVFDASLTGPMAIVMGAEGEGMRRLTREHCDLLVKIPMAGTVSSLNVSVATGICLFEVLR 241

Query: 279 HFA 281
             +
Sbjct: 242 QRS 244


>gi|260663516|ref|ZP_05864406.1| rRNA methylase [Lactobacillus fermentum 28-3-CHN]
 gi|260552057|gb|EEX25110.1| rRNA methylase [Lactobacillus fermentum 28-3-CHN]
          Length = 259

 Score =  136 bits (342), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 47/251 (18%), Positives = 95/251 (37%), Gaps = 6/251 (2%)

Query: 27  HRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDAN 86
           +   K+ +    + +   Q     L G H V+ AL    R + +L+ TK  LA       
Sbjct: 10  NARVKEWKKLQTR-KGRKQQGRYLLEGWHLVNEALQAD-RGLHELIGTKEELAAHPDIVA 67

Query: 87  LPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDHVNDPHN 146
                 V +V P  +  +         + +   P L      +  + L +  D V +P N
Sbjct: 68  RFK--EVYSVTPAIMAAVTETVTPQGIMVVADLPDLHQVATDLSGAWLFL--DRVQNPGN 123

Query: 147 IGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWG 206
           +G ++R+A A    G++     +   S  + +S  G+  H+                +  
Sbjct: 124 VGTMVRTADAAGFAGVVAGDGSADLFSPKVVRSMQGSQFHLALYEGDLKKWFEDVKQAGY 183

Query: 207 FQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVS 266
                  + + K           AL++G EG+G+  +  +  T+  ++ M G  ++LNV+
Sbjct: 184 PVYGTQLNPAAKDFRIVTPQGGFALVMGNEGRGMSEELLKQTTANLYIPMRGQAESLNVA 243

Query: 267 NAAAVALYITQ 277
            +A + ++   
Sbjct: 244 VSAGILMFELA 254


>gi|262045387|ref|ZP_06018411.1| 23S rRNA (guanosine-2'-O-)-methyltransferase RlmB [Klebsiella
           pneumoniae subsp. rhinoscleromatis ATCC 13884]
 gi|259037305|gb|EEW38552.1| 23S rRNA (guanosine-2'-O-)-methyltransferase RlmB [Klebsiella
           pneumoniae subsp. rhinoscleromatis ATCC 13884]
          Length = 243

 Score =  136 bits (342), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 62/242 (25%), Positives = 104/242 (42%), Gaps = 8/242 (3%)

Query: 48  NLFLYGVHTVSAALNNPSRKIFQLLATKNALARLD---WDANLPHPFPVKTVPPQTIDKI 104
           +  +YG+H V A L     +  ++   K    +       A       ++    Q +D+ 
Sbjct: 2   SEMIYGIHAVQALLERAPERFQEVYILKGREDKRLLPLIHALEAQGVVIQLANRQFLDEK 61

Query: 105 VGKEAVHQGLALETAPLLSPTLDAVR-----NSQLLMVLDHVNDPHNIGAILRSAVAFSC 159
                    +A           D        +   L++LD V DPHN+GA LRSA A   
Sbjct: 62  SEGVVHQGIIARVKPGRQYQENDLPDLLAQLDQPFLLILDGVTDPHNLGACLRSADAAGV 121

Query: 160 DGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKP 219
             +I  K  S   +A   K A GA E++P IR++NL   ++ +       +G + ++   
Sbjct: 122 HAVIVPKDRSAQLNATAKKVACGAAENVPLIRVTNLARTMRLLQEENVWIVGTAGEADHT 181

Query: 220 LEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNH 279
           L Q      +AL++GAEG+G+R  T+E    +  + M G + +LNVS A  + L+     
Sbjct: 182 LFQSKMTGPMALVMGAEGEGMRRLTREHCDELISIPMAGSVSSLNVSVATGICLFEAVRQ 241

Query: 280 FA 281
            +
Sbjct: 242 RS 243


>gi|254690454|ref|ZP_05153708.1| tRNA/rRNA methyltransferase (SpoU) [Brucella abortus bv. 6 str.
           870]
 gi|254694943|ref|ZP_05156771.1| tRNA/rRNA methyltransferase (SpoU) [Brucella abortus bv. 3 str.
           Tulya]
 gi|256258710|ref|ZP_05464246.1| tRNA/rRNA methyltransferase (SpoU) [Brucella abortus bv. 9 str.
           C68]
 gi|260756006|ref|ZP_05868354.1| tRNA/rRNA methyltransferase [Brucella abortus bv. 6 str. 870]
 gi|260885026|ref|ZP_05896640.1| tRNA/rRNA methyltransferase [Brucella abortus bv. 9 str. C68]
 gi|261215282|ref|ZP_05929563.1| tRNA/rRNA methyltransferase [Brucella abortus bv. 3 str. Tulya]
 gi|297247542|ref|ZP_06931260.1| TrmH family RNA methyltransferase [Brucella abortus bv. 5 str.
           B3196]
 gi|260676114|gb|EEX62935.1| tRNA/rRNA methyltransferase [Brucella abortus bv. 6 str. 870]
 gi|260874554|gb|EEX81623.1| tRNA/rRNA methyltransferase [Brucella abortus bv. 9 str. C68]
 gi|260916889|gb|EEX83750.1| tRNA/rRNA methyltransferase [Brucella abortus bv. 3 str. Tulya]
 gi|297174711|gb|EFH34058.1| TrmH family RNA methyltransferase [Brucella abortus bv. 5 str.
           B3196]
          Length = 297

 Score =  136 bits (342), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 48/255 (18%), Positives = 84/255 (32%), Gaps = 4/255 (1%)

Query: 27  HRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDAN 86
           +   K ++S   K +   Q       G+  V  AL    R    + A      +      
Sbjct: 35  NPIVKDLRSLALK-KFRDQQGVFLAEGLKLVIDALEQDWRIKTLVFAKSGKGNKTVEQVA 93

Query: 87  L---PHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDHVND 143
                    V  V  + I  I  ++       +             + + + + LD V D
Sbjct: 94  ARTFAKGGLVLEVTEKVISAITRRDNPQMVAGVFEQQYHQLAGLKPKGNDVYVALDRVRD 153

Query: 144 PHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMH 203
           P N+G ++R+A A    G+I     +   S    ++  G++  +P  R S       +  
Sbjct: 154 PGNLGTVIRTADAVGAKGVILIGDTTDPYSLETVRATMGSVFSVPLYRASEADFLNWRKG 213

Query: 204 SWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKAL 263
             G         +         N  I LI+G E +GL          +A +   G   +L
Sbjct: 214 FSGLVVGTHLKGAVDYRTIPYANKPIILIMGNEQQGLPDSLAGACDKLARIPQAGRADSL 273

Query: 264 NVSNAAAVALYITQN 278
           N++ A  V LY  + 
Sbjct: 274 NLAIATGVMLYEIRR 288


>gi|255531956|ref|YP_003092328.1| TrmH family RNA methyltransferase [Pedobacter heparinus DSM 2366]
 gi|255344940|gb|ACU04266.1| RNA methyltransferase, TrmH family, group 3 [Pedobacter heparinus
           DSM 2366]
          Length = 254

 Score =  136 bits (342), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 56/252 (22%), Positives = 102/252 (40%), Gaps = 9/252 (3%)

Query: 37  NQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLP-------- 88
           N +     +  N F++G+  V  A+      I  +   +     +  +            
Sbjct: 3   NSRRPARGKESNEFIFGIRAVIEAIKAGKE-IESIYIQRGLTGGIIMELKALLKEVDAPV 61

Query: 89  HPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDHVNDPHNIG 148
           H  PV+ +   T+    G  AV   +  +    + P +     + L+++LD + D  N+G
Sbjct: 62  HNVPVEKLNRMTLKNHQGVIAVISAITFQKIEDIIPAIYEKGETPLVLILDGITDVRNMG 121

Query: 149 AILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQ 208
           AI R+A       I+   + S   +A   K+++GAL  IP  R  NL      +   G Q
Sbjct: 122 AIARTAACAGVHAIVVPSKNSAQINADAIKTSAGALFTIPVCRHPNLHKTALFLQECGLQ 181

Query: 209 TIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNA 268
            +  +  +   +         A+++GAE +G+  +    A  +A + M G I +LNVS +
Sbjct: 182 IVACTEKTNDLIYVPDYTAPTAIVMGAEDEGISNELMRMANHLAKIPMIGEISSLNVSVS 241

Query: 269 AAVALYITQNHF 280
           A + LY      
Sbjct: 242 AGIILYEAIRQR 253


>gi|225851684|ref|YP_002731917.1| tRNA/rRNA methyltransferase SpoU [Brucella melitensis ATCC 23457]
 gi|256112654|ref|ZP_05453575.1| tRNA/rRNA methyltransferase, SpoU [Brucella melitensis bv. 3 str.
           Ether]
 gi|256264805|ref|ZP_05467337.1| tRNA/rRNA methyltransferase [Brucella melitensis bv. 2 str. 63/9]
 gi|265994095|ref|ZP_06106652.1| tRNA/rRNA methyltransferase [Brucella melitensis bv. 3 str. Ether]
 gi|225640049|gb|ACN99962.1| tRNA/rRNA methyltransferase, SpoU [Brucella melitensis ATCC 23457]
 gi|262765076|gb|EEZ10997.1| tRNA/rRNA methyltransferase [Brucella melitensis bv. 3 str. Ether]
 gi|263095215|gb|EEZ18884.1| tRNA/rRNA methyltransferase [Brucella melitensis bv. 2 str. 63/9]
 gi|326408171|gb|ADZ65236.1| tRNA/rRNA methyltransferase SpoU [Brucella melitensis M28]
 gi|326537884|gb|ADZ86099.1| tRNA/rRNA methyltransferase, SpoU [Brucella melitensis M5-90]
          Length = 297

 Score =  136 bits (342), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 48/255 (18%), Positives = 85/255 (33%), Gaps = 4/255 (1%)

Query: 27  HRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDAN 86
           +   K ++S   K +   Q       G+  V  AL    R    + A      +      
Sbjct: 35  NPIVKDLRSLALK-KFRDQQGVFLAEGLKLVIDALEQDWRIKTLVFAKSGKGNKTVEQVA 93

Query: 87  L---PHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDHVND 143
                    V  V  + I  I  ++       +             + + + + LD V D
Sbjct: 94  ARTFAKGGLVLEVTEKVISAITRRDNPQMVAGVFEQQYHQLAGLKPKGNDVYVALDRVRD 153

Query: 144 PHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMH 203
           P N+GA++R+A A    G+I     +   S    ++  G++  +P  R S       +  
Sbjct: 154 PGNLGAVIRTADAVGAKGVILIGDTTDPYSLETVRATMGSVFSVPLYRASEADFLNWRKG 213

Query: 204 SWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKAL 263
             G         +         N  + LI+G E +GL          +A +   G   +L
Sbjct: 214 FSGLVVGTHLKGAVDYRTIPYANKPVILIMGNEQQGLPDSLAGACDKLARIPQAGRADSL 273

Query: 264 NVSNAAAVALYITQN 278
           N++ A  V LY  + 
Sbjct: 274 NLAIATGVMLYEIRR 288


>gi|187776946|ref|ZP_02993419.1| hypothetical protein CLOSPO_00490 [Clostridium sporogenes ATCC
           15579]
 gi|187775605|gb|EDU39407.1| hypothetical protein CLOSPO_00490 [Clostridium sporogenes ATCC
           15579]
          Length = 259

 Score =  136 bits (342), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 55/262 (20%), Positives = 109/262 (41%), Gaps = 9/262 (3%)

Query: 24  RRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDW 83
            ++++  K+++   +K ++ +Q ++  + G      AL + S  + ++   + +L +L+ 
Sbjct: 4   SKDNQLIKEVRKLREK-KYRTQNKSFIVEGFRFFEEALKSNS-SVNKVFIEEKSLNKLEK 61

Query: 84  ---DANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDH 140
                N+ +      V    +  I   E   QG+        +  LD      +L+  D 
Sbjct: 62  LYKKYNINNDIETYVVNYSVLKSISNTE-NPQGIVSVINYFKTEKLDLENGFYILV--DK 118

Query: 141 VNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQ 200
           V DP N+G I+R+A A    GIITTK      +    +S  G++ +IP I   NL     
Sbjct: 119 VQDPGNMGTIIRTAHAAGALGIITTKGTVDVYNEKTLRSTMGSIFYIPIIEDENLETVKS 178

Query: 201 KMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGII 260
              +     +     +    +  +K D + + +G EG G+       +     + MPG  
Sbjct: 179 LQRNGFKLLVSSLDTNSNFYDVNMK-DNMIIAVGNEGNGISEDLNSLSDIKVKIPMPGAA 237

Query: 261 KALNVSNAAAVALYITQNHFAK 282
           ++LNV+ A ++  +       K
Sbjct: 238 ESLNVAVACSIMTFERIRQINK 259


>gi|86605783|ref|YP_474546.1| RNA methyltransferase [Synechococcus sp. JA-3-3Ab]
 gi|86554325|gb|ABC99283.1| RNA methyltransferase, TrmH family [Synechococcus sp. JA-3-3Ab]
          Length = 270

 Score =  136 bits (342), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 44/257 (17%), Positives = 99/257 (38%), Gaps = 4/257 (1%)

Query: 24  RRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDW 83
              +   ++++  + +S+   +     + G H +  AL               A      
Sbjct: 8   SPKNPWIRQLRQLH-RSKGRREQGAFLVEGSHLLEEALGVGWPLRAVCYTFDWAERHPRL 66

Query: 84  DANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDHVND 143
            A+LP     + V  + +  +   E+    +A+  +  ++         +L +V++ + D
Sbjct: 67  LASLPKHLRRQAVSLEVMAALSTTESPEGVVAVAVSRQIASP--PPEALRLGLVVETLQD 124

Query: 144 PHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMH 203
           P N+G+++R   A   DG+  +      E+  + ++++G     P   +S+L   +Q   
Sbjct: 125 PGNLGSLIRVVAATGADGLWLSADSVDPENPKVLRASAGQWFRRPPQVLSDLPAWIQSCR 184

Query: 204 SWGFQTIGLSSDSKKPLEQEI-KNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKA 262
             G Q +  +         +         +LG EG GL+  T + A +   + M   +++
Sbjct: 185 RQGIQVLAATLAPLATCYWDHDLTRPTLFLLGNEGAGLQESTIQLADAQVRIPMAAGVES 244

Query: 263 LNVSNAAAVALYITQNH 279
           LNV+    + LY     
Sbjct: 245 LNVAMTGGLLLYEALRQ 261


>gi|258645874|ref|ZP_05733343.1| RNA methyltransferase, TrmH family, group 3 [Dialister invisus DSM
           15470]
 gi|260403247|gb|EEW96794.1| RNA methyltransferase, TrmH family, group 3 [Dialister invisus DSM
           15470]
          Length = 282

 Score =  136 bits (342), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 66/284 (23%), Positives = 113/284 (39%), Gaps = 14/284 (4%)

Query: 9   SEKIFSLKDSHYA-----KLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNN 63
           + +  SL           K R   +  +  + F+       + E  F+ G ++V  +L  
Sbjct: 2   NNRRVSLDKKERKCDPHEKRRSGDQSIRGERGFS-SGGRRKEEETCFIGGRNSVLESLRA 60

Query: 64  PS-RKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLL 122
              +K+F     K+       +              +T+D++  +   HQG+A    P  
Sbjct: 61  GQVKKVFIKSGKKDGRLLALAEEAERLGVAAIETEERTLDRLT-EGVRHQGVAASLKPYA 119

Query: 123 SPTLD-----AVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLA 177
              L+       R   LL++LD V D  NIGAI+R+A       ++  K  S   +A   
Sbjct: 120 YADLEEVLSSCERKDPLLILLDGVEDVRNIGAIVRTAECAGAAAVLLPKHRSSPVTAAAM 179

Query: 178 KSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEG 237
           K+ASGA  ++P  +I N+     +           +      L Q      + +++GAEG
Sbjct: 180 KTASGAFAYLPVCQIGNI-RQTLEKLKERGFWAVGADMDGGDLYQADLKGPLVIVMGAEG 238

Query: 238 KGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHFA 281
           KG+ P T+        + M G + +LNVS AAA+ +Y       
Sbjct: 239 KGISPLTKRMCDFCVRIPMRGKVSSLNVSVAAALLMYEAVRQRN 282


>gi|240849692|ref|YP_002971080.1| tRNA/rRNA methyltransferase [Bartonella grahamii as4aup]
 gi|240266815|gb|ACS50403.1| tRNA/rRNA methyltransferase [Bartonella grahamii as4aup]
          Length = 289

 Score =  136 bits (342), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 48/275 (17%), Positives = 101/275 (36%), Gaps = 11/275 (4%)

Query: 7   KKSEKIFSLKDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSR 66
            K+ ++  +          ++   K +++ +QK ++ ++       G+  V  AL+    
Sbjct: 9   PKTGRVKEITSL-------SNPIIKDLKALSQK-KNRNREGLFMAEGLKLVIDALDLGWT 60

Query: 67  KIFQLLATK---NALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLS 123
               + +     NA         + +   V     + ++ +  ++     + +       
Sbjct: 61  IQTLIFSKSKIGNAAIENTAARAVANGGFVIKASQKVMESLTRRDNPQTVIGIFKQKWHP 120

Query: 124 PTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGA 183
             +   +   + + LD V DP N+G I+R+A A    G+I     +   S    ++  G+
Sbjct: 121 FEMIKGQIKDVYIALDRVRDPGNLGTIIRTADAVGAKGVILIGETTDPFSTETVRATMGS 180

Query: 184 LEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPK 243
           +  +P  R+          H  G         S      + KN  I L++G E +GL   
Sbjct: 181 IFSVPLYRLDESAFLNWSAHFKGMIVGTHLKGSLDYRTLDFKNGPIILLMGNEKQGLSDL 240

Query: 244 TQETATSMAHLHMPGIIKALNVSNAAAVALYITQN 278
                  +A +   G   +LN++ A AV LY  + 
Sbjct: 241 LTNRCDKLARIPQSGRADSLNLAVATAVMLYEIRR 275


>gi|227515640|ref|ZP_03945689.1| RNA methyltransferase [Lactobacillus fermentum ATCC 14931]
 gi|227086070|gb|EEI21382.1| RNA methyltransferase [Lactobacillus fermentum ATCC 14931]
          Length = 268

 Score =  136 bits (342), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 48/251 (19%), Positives = 95/251 (37%), Gaps = 6/251 (2%)

Query: 27  HRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDAN 86
           +   K+ +    + +   Q     L G H V+ AL    R + +L+ TK  LA       
Sbjct: 19  NARVKEWKKLQTR-KGRKQQGRYLLEGWHLVNEALQAD-RGLHELIGTKEELAAHPDIVA 76

Query: 87  LPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDHVNDPHN 146
                 V +V P  +  +         + +   P L      +  + L +  D V DP N
Sbjct: 77  RFK--EVYSVTPAIMAAVTETVTPQGIMVVADLPDLHQVATDLSGAWLFL--DRVQDPGN 132

Query: 147 IGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWG 206
           +G ++R+A A    G++     +   S  + +S  G+  H+                +  
Sbjct: 133 VGTMVRTADAAGFAGVVAGDGSADLFSPKVVRSMQGSQFHLALYEGDLKKWFEDVKQAGY 192

Query: 207 FQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVS 266
                  + + K           AL++G EG+G+  +  +  T+  ++ M G  ++LNV+
Sbjct: 193 PVYGTQLNPAAKDFRIVTPQGGFALVMGNEGRGMSEELLKQTTANLYIPMRGQAESLNVA 252

Query: 267 NAAAVALYITQ 277
            +A + ++   
Sbjct: 253 VSAGILMFELA 263


>gi|254470423|ref|ZP_05083827.1| RNA methyltransferase, TrmH family, group 3 [Pseudovibrio sp.
           JE062]
 gi|211960734|gb|EEA95930.1| RNA methyltransferase, TrmH family, group 3 [Pseudovibrio sp.
           JE062]
          Length = 289

 Score =  136 bits (342), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 109/269 (40%), Positives = 168/269 (62%), Gaps = 6/269 (2%)

Query: 9   SEKIFSLKDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKI 68
           +++ +  K         +    K  Q      +  ++    ++YG+HT+ AA  NP RK 
Sbjct: 21  NDRPYKKKRPDGKSSGGSFSKGKPWQK-----KSAAEDGPFYIYGLHTIEAAFKNPERKR 75

Query: 69  FQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDA 128
            +L+ T+NAL RL  + NL    PV+   P+ IDK+VGK+AVHQG AL    L     + 
Sbjct: 76  HKLVVTQNALRRL-EERNLKIDVPVEDASPRDIDKLVGKDAVHQGAALLVDALPEYGPEE 134

Query: 129 VRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIP 188
           +++ QL++ LD V DPHN+GAILRSAVA + D ++TT+R++P E  VLAK+ASGAL+ I 
Sbjct: 135 LKDGQLVLALDQVTDPHNVGAILRSAVALNADAVVTTRRHAPEEGPVLAKTASGALDMIK 194

Query: 189 YIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETA 248
           ++RI N++  +++M   G+Q I L S+  + +E     DK  L+LG+EGKG+R   +++ 
Sbjct: 195 HVRIQNMSRFVEEMRDKGYQAIALDSEGPEAVENTAFTDKTLLVLGSEGKGVREGVRKSC 254

Query: 249 TSMAHLHMPGIIKALNVSNAAAVALYITQ 277
            ++A L MPG IK+LNVSNAA ++LY+ +
Sbjct: 255 DTLARLDMPGEIKSLNVSNAAILSLYVAR 283


>gi|184155768|ref|YP_001844108.1| rRNA methylase [Lactobacillus fermentum IFO 3956]
 gi|183227112|dbj|BAG27628.1| rRNA methylase [Lactobacillus fermentum IFO 3956]
          Length = 259

 Score =  136 bits (342), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 48/251 (19%), Positives = 95/251 (37%), Gaps = 6/251 (2%)

Query: 27  HRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDAN 86
           +   K+ +    + +   Q     L G H V+ AL    R + +L+ TK  LA       
Sbjct: 10  NARVKEWKKLQTR-KGRKQQGRYLLEGWHLVNEALQAD-RGLHELIGTKEELAAHPDIVA 67

Query: 87  LPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDHVNDPHN 146
                 V +V P  +  +         + +   P L      +  + L +  D V DP N
Sbjct: 68  RFK--EVYSVTPAIMAAVTETVTPQGIMVVADLPDLHQVATDLSGAWLFL--DRVQDPGN 123

Query: 147 IGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWG 206
           +G ++R+A A    G++     +   S  + +S  G+  H+                +  
Sbjct: 124 VGTMVRTADAAGFAGVVAGDGSADLFSPKVVRSMQGSQFHLALYEGDLKKWFEDVKQAGY 183

Query: 207 FQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVS 266
                  + + K           AL++G EG+G+  +  +  T+  ++ M G  ++LNV+
Sbjct: 184 PVYGTQLNPAAKDFRIVTPQGGFALVMGNEGRGMSEELLKQTTANLYIPMRGQAESLNVA 243

Query: 267 NAAAVALYITQ 277
            +A + ++   
Sbjct: 244 VSAGILMFELA 254


>gi|304436602|ref|ZP_07396571.1| RNA methyltransferase [Selenomonas sp. oral taxon 149 str. 67H29BP]
 gi|304370298|gb|EFM23954.1| RNA methyltransferase [Selenomonas sp. oral taxon 149 str. 67H29BP]
          Length = 272

 Score =  136 bits (342), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 67/259 (25%), Positives = 116/259 (44%), Gaps = 11/259 (4%)

Query: 32  KMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNAL---ARLDWDANLP 88
           K +   + +    +     L G H +  A+    R I ++L   N          D    
Sbjct: 9   KEKHAQRNAVPQEEKAPPILAGRHAIIEAIKAG-RGINRILLADNVRGGGVNELRDLARE 67

Query: 89  HPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDA-------VRNSQLLMVLDHV 141
           H   V TV    +D +V ++  HQG     AP+    ++             LL++LD +
Sbjct: 68  HGITVDTVGRSKLDALVSQDVRHQGAVAYVAPVAYAAVEEIIAGARARGEDPLLLLLDGI 127

Query: 142 NDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQK 201
            DP N+GA+LR+A A    GI+  +R+S   +  +A+ ++GALE++P  RI N+   ++ 
Sbjct: 128 EDPQNLGALLRTADAAGVHGILLPRRHSVPLTETVARVSAGALEYVPVARIGNIAQTMRA 187

Query: 202 MHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIK 261
           +   GF   G     ++  +       + L++G+EG+G+   T++       L M G I 
Sbjct: 188 LKEQGFWIAGADMSGEETYDHANLTGALVLVIGSEGRGMSRLTRDLCDFTVRLPMVGKIN 247

Query: 262 ALNVSNAAAVALYITQNHF 280
           +LN S A A+ +Y  Q   
Sbjct: 248 SLNASVAGAILMYEAQRQR 266


>gi|256060292|ref|ZP_05450465.1| tRNA/rRNA methyltransferase (SpoU) [Brucella neotomae 5K33]
 gi|261324264|ref|ZP_05963461.1| tRNA/rRNA methyltransferase [Brucella neotomae 5K33]
 gi|261300244|gb|EEY03741.1| tRNA/rRNA methyltransferase [Brucella neotomae 5K33]
          Length = 297

 Score =  136 bits (341), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 47/255 (18%), Positives = 84/255 (32%), Gaps = 4/255 (1%)

Query: 27  HRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDAN 86
           +   K ++S   K +   Q       G+  V  AL    R    + A      +      
Sbjct: 35  NPIVKDLRSLALK-KFRDQQGVFLAEGLKLVIDALEQDWRIKTLVFAKSGKGNKTVEQVA 93

Query: 87  ---LPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDHVND 143
                    V  V  + I  I  ++       +             + + + + LD V D
Sbjct: 94  TRTFAKGGLVLEVTEKVISAITRRDNPQMVAGVFEQQYHQLAGLKPKGNDVYVALDRVRD 153

Query: 144 PHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMH 203
           P N+G ++R+A A    G+I     +   S    ++  G++  +P  R S       +  
Sbjct: 154 PGNLGTVIRTADAVGAKGVILIGDTTDPYSLETVRATMGSVFSVPLYRASEADFLNWRKG 213

Query: 204 SWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKAL 263
             G         +         N  + LI+G E +GL          +A +   G   +L
Sbjct: 214 FSGLVVGTHLKGAVDYRTIPYANKPVILIMGNEQQGLPDSLAGACDKLARIPQAGRADSL 273

Query: 264 NVSNAAAVALYITQN 278
           N++ A  V LY  + 
Sbjct: 274 NLAIATGVMLYEIRR 288


>gi|227357121|ref|ZP_03841490.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Proteus mirabilis
           ATCC 29906]
 gi|227162653|gb|EEI47620.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Proteus mirabilis
           ATCC 29906]
          Length = 247

 Score =  136 bits (341), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 67/242 (27%), Positives = 99/242 (40%), Gaps = 8/242 (3%)

Query: 48  NLFLYGVHTVSAALNNPSRKIFQLLATKNALARLD---WDANLPHPFPVKTVPPQTIDKI 104
              +YG+H V A L        ++   K    R       A       V+    Q +D  
Sbjct: 3   EDIIYGIHAVKALLERDPTHFKEVYVLKGREDRRLMPVIHALEEQGILVQVANRQWLDNQ 62

Query: 105 VGKEAVHQGLALETAPLLSPTLDAVR-----NSQLLMVLDHVNDPHNIGAILRSAVAFSC 159
                    +A           D         +  L+VLD V DPHN+GA LRSA A   
Sbjct: 63  TEGAVHQGIIAKVKPSRQYQEQDLPDLLAEVGTPFLLVLDGVTDPHNLGACLRSADAAGV 122

Query: 160 DGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKP 219
             +I  K  S   +A   K A GA E +P IR++NL   L+ +       +G + ++   
Sbjct: 123 HAVIVPKDRSAQLNATAKKVACGAAESVPLIRVTNLARTLRLLQEENIWIVGTAGEADHT 182

Query: 220 LEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNH 279
           L Q      +AL++GAEG+G+R  T+E    +  + M G + +LNVS A  V L+     
Sbjct: 183 LYQSKLTGPLALVMGAEGEGMRRLTREHCDELISIPMAGSVSSLNVSVATGVCLFEAMRQ 242

Query: 280 FA 281
             
Sbjct: 243 RI 244


>gi|15676825|ref|NP_273970.1| RNA methyltransferase [Neisseria meningitidis MC58]
 gi|52783329|sp|Q9JZR3|RLMB_NEIMB RecName: Full=23S rRNA (guanosine-2'-O-)-methyltransferase RlmB;
           AltName: Full=23S rRNA Gm2251 2'-O-methyltransferase
 gi|7226169|gb|AAF41338.1| RNA methyltransferase, TrmH family [Neisseria meningitidis MC58]
 gi|319410266|emb|CBY90607.1| 23S rRNA (guanosine-2'-O-)-methyltransferase RlmB (23S rRNA Gm2251
           2'-O-methyltransferase) [Neisseria meningitidis WUE
           2594]
 gi|325200383|gb|ADY95838.1| RNA methyltransferase, TrmH family, group 3 [Neisseria meningitidis
           H44/76]
          Length = 250

 Score =  136 bits (341), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 69/238 (28%), Positives = 111/238 (46%), Gaps = 9/238 (3%)

Query: 51  LYGVHTVSAALNNPSRKIFQLLATK---NALARLDWDANLPHPFPVKTVPPQTIDKIVGK 107
           +YG H V+A L    + I +L   +   +A  R   +        V       ++ I  K
Sbjct: 7   IYGFHAVNARLWQNPKSIVELYIQEGKSDARTREVLEKAANENIRVYFADADRLNAIS-K 65

Query: 108 EAVHQGLALET-----APLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGI 162
            A HQG+            L   L+ +    LL++LD + DPHN+GA LR+A A     +
Sbjct: 66  GARHQGVVGFIDASKNHVHLEDVLENLSEPPLLLILDGITDPHNLGACLRTADAMGVHAV 125

Query: 163 ITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQ 222
           I  K  S   +A ++K A GA E +PYI ++NL   L+++  +G   IG     +  L  
Sbjct: 126 IAPKDKSAGLNATVSKVACGAAETVPYITVTNLARTLRELKEYGIWIIGTDMSGESDLYH 185

Query: 223 EIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
               D  A ++G EG G+R  T+E    +  + M G ++++NVS +A + L  T+   
Sbjct: 186 CNLPDSAAWVMGNEGDGMRRLTREHCDMLVSIPMFGTVESMNVSVSAGMVLSETRRQR 243


>gi|238926114|ref|ZP_04657874.1| tRNA/rRNA methyltransferase [Selenomonas flueggei ATCC 43531]
 gi|238886004|gb|EEQ49642.1| tRNA/rRNA methyltransferase [Selenomonas flueggei ATCC 43531]
          Length = 272

 Score =  136 bits (341), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 63/240 (26%), Positives = 110/240 (45%), Gaps = 9/240 (3%)

Query: 50  FLYGVHTVSAALNNPS--RKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGK 107
            L G H +  A+       +I      + +      D    H   V TV    +D +V +
Sbjct: 27  ILAGRHAIIEAIKAGRGINRILLADGVRGSGVNELRDLAREHGIMVDTVGRSKLDALVSQ 86

Query: 108 EAVHQGLALETAPLLSPTLDA-------VRNSQLLMVLDHVNDPHNIGAILRSAVAFSCD 160
           +  HQG     AP+    ++             LL++LD + DP N+GA+LR+A A    
Sbjct: 87  DVRHQGAVAYVAPVAYVAVEEVIAGARARGEDPLLLLLDGIEDPQNLGALLRTADAAGVH 146

Query: 161 GIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPL 220
           GI+  +R+S   +  +A+ ++GALE++P  RI N+   ++ +   GF   G     ++  
Sbjct: 147 GILLPRRHSVPLTETVARVSAGALEYVPVARIGNIAQTIRALKEQGFWIAGADMGGEEIY 206

Query: 221 EQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
           ++      + L++G+EG+G+   T++       L M G I +LN S A A+ +Y  Q   
Sbjct: 207 DRANLTGALVLVIGSEGRGMSRLTRDLCDFTVRLPMMGKINSLNASVAGAILMYEAQRQR 266


>gi|261363630|ref|ZP_05976513.1| RNA methyltransferase, TrmH family, group 3 [Neisseria mucosa ATCC
           25996]
 gi|288568160|gb|EFC89720.1| RNA methyltransferase, TrmH family, group 3 [Neisseria mucosa ATCC
           25996]
          Length = 249

 Score =  136 bits (341), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 69/239 (28%), Positives = 111/239 (46%), Gaps = 9/239 (3%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLATK---NALARLDWDANLPHPFPVKTVPPQTIDKIVG 106
            +YG H V+A L    + I +L   +   +A  R   +        V       ++ I  
Sbjct: 6   LIYGFHAVNARLWQNPKSITELYIQEGKNDARTRDVLEKAANENVRVHFADADRLNAIS- 64

Query: 107 KEAVHQGLALET-----APLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDG 161
           K A HQG+            L   L+ +    LL++LD + DPHN+GA LR+A A     
Sbjct: 65  KGARHQGVVGFIDASKNHVHLEDVLENLSEPPLLLILDGITDPHNLGACLRTADAMGVHA 124

Query: 162 IITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLE 221
           +I  K  S   +A ++K A GA E +PYI ++NL   L+++  +G   IG        L 
Sbjct: 125 VIAPKDKSAGLNATVSKVACGAAETVPYITVTNLARTLRELKEYGIWIIGTDMGGDADLY 184

Query: 222 QEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
                D  A ++G EG+G+R  T+E    +  + M G ++++NVS +A + L  T+   
Sbjct: 185 HCDLPDSAAWVMGNEGEGMRRLTREHCDMLVSIPMFGTVESMNVSVSAGMVLSETRRQR 243


>gi|304396947|ref|ZP_07378827.1| RNA methyltransferase, TrmH family, group 3 [Pantoea sp. aB]
 gi|304355743|gb|EFM20110.1| RNA methyltransferase, TrmH family, group 3 [Pantoea sp. aB]
          Length = 244

 Score =  136 bits (341), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 70/243 (28%), Positives = 111/243 (45%), Gaps = 10/243 (4%)

Query: 48  NLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDW---DANLPHPFPVKTVPPQTIDKI 104
           +  ++G+H V A L    ++  ++   K    R       A       ++    + +D  
Sbjct: 2   SEIIFGIHAVQALLERDPQRFQEVFILKGRDDRRLQPVVAALEAQGIVIQLAERKWLDSQ 61

Query: 105 VGKEAVHQGLALETAPLLSP------TLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFS 158
           V +  VHQG+     P           L    +   L+VLD V DPHN+GA LRSA A  
Sbjct: 62  V-EGGVHQGIVARVKPGRQYQEGDLPDLLQSLDKPFLLVLDGVTDPHNLGACLRSADAAG 120

Query: 159 CDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKK 218
              II  K  S   +A   K ASGA E++P IR++NL   L+ +  +    +G + ++  
Sbjct: 121 VHAIIVPKDRSAPLNATAKKVASGAAENVPLIRVTNLARTLRLLQEYNIWVVGTAGEADH 180

Query: 219 PLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQN 278
            + Q      +AL++GAEG+G+R  T+E    +  + M G + +LNVS A  V L+    
Sbjct: 181 TVFQSKMTGPMALVMGAEGEGMRRLTREHCDELISIPMAGSVSSLNVSVATGVCLFEAVR 240

Query: 279 HFA 281
              
Sbjct: 241 QRN 243


>gi|146296777|ref|YP_001180548.1| tRNA/rRNA methyltransferase (SpoU) [Caldicellulosiruptor
           saccharolyticus DSM 8903]
 gi|145410353|gb|ABP67357.1| tRNA/rRNA methyltransferase (SpoU) [Caldicellulosiruptor
           saccharolyticus DSM 8903]
          Length = 271

 Score =  136 bits (341), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 65/284 (22%), Positives = 117/284 (41%), Gaps = 28/284 (9%)

Query: 2   NLISKKKSEKIFSLKDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAAL 61
            LI  K++E +  LK  H                     +H  + +   + GV  V  AL
Sbjct: 8   ELIKSKENECVKRLKKLHDK-------------------KHREEFKVFLVEGVKAVKEAL 48

Query: 62  NNPSRKIFQLLATKNALARLDW-------DANLPHPFPVKTVPPQTIDKIVGKEAVHQGL 114
           +     I  L+ ++ A  + +          N      +  VP +  + I         L
Sbjct: 49  DYAIEDINLLIFSQEASKKYEEFFSRCISLLNSGKLKRIVQVPEKIFEHISTTTTPQGVL 108

Query: 115 ALETAPLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESA 174
           A  +       LD ++    ++V+D V DP N+G I+R A AF  + +IT        + 
Sbjct: 109 AECSFFDK--ELDVLKKHNRVVVIDSVQDPGNLGTIIRCADAFGFECVITVNGTVDVYNP 166

Query: 175 VLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILG 234
            + +SA G++ H+  +R     + L+ ++  GF     +      + +   +D+ A+++G
Sbjct: 167 KVVRSAMGSMFHVDVVRERKKEEVLEALNKRGFALYVTTPYGDVDISKLSVDDRFAIVIG 226

Query: 235 AEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQN 278
            E KG+     E AT    + MPG  ++LN + AAA+ LY  + 
Sbjct: 227 NESKGVDVAFLENATKKVKISMPGKAESLNSAVAAAIVLYELRK 270


>gi|255526051|ref|ZP_05392974.1| tRNA/rRNA methyltransferase (SpoU) [Clostridium carboxidivorans P7]
 gi|255510237|gb|EET86554.1| tRNA/rRNA methyltransferase (SpoU) [Clostridium carboxidivorans P7]
          Length = 260

 Score =  136 bits (341), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 60/281 (21%), Positives = 109/281 (38%), Gaps = 26/281 (9%)

Query: 1   MNLISKKKSEKIFSLKDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAA 60
           M +I+ K +  +  +K     K                   H ++     + G   V  A
Sbjct: 1   MEIITSKDNSLVKEIKKLKEKK-------------------HRTKNNQFLIEGFRFVEEA 41

Query: 61  LNNPSRK--IFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALET 118
           L +  +   IF   + K+     D  + L     +  V  Q +  +   E      A+  
Sbjct: 42  LKSEFQVPMIFVSESHKSRFQSFDIKSKLQKSTKIYWVSEQVLKLLSDTETPQGITAVV- 100

Query: 119 APLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAK 178
               +  L+        +++D V DP N+G I+R+A A    G+I TK      +    +
Sbjct: 101 ---DNKELNVENKEGFYVLVDKVQDPGNMGTIIRTAHASKALGVIITKGTVDIYNEKTLR 157

Query: 179 SASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGK 238
           S  G++ H+P I+ ++L + +  +   GF  +  S ++ K         K  + +G EG 
Sbjct: 158 STMGSIFHVPVIQDNDL-NKVNFLKEKGFNLVASSLNTDKNFYDVDLKGKKIIAVGNEGS 216

Query: 239 GLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNH 279
           G+  +    A     + MPG  ++LNVS AA V ++     
Sbjct: 217 GISDEIYNMADIKVKIPMPGGAESLNVSVAAGVMMFEVIRQ 257


>gi|298368373|ref|ZP_06979691.1| RNA methyltransferase, TrmH family, group 3 [Neisseria sp. oral
           taxon 014 str. F0314]
 gi|298282376|gb|EFI23863.1| RNA methyltransferase, TrmH family, group 3 [Neisseria sp. oral
           taxon 014 str. F0314]
          Length = 249

 Score =  136 bits (341), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 69/239 (28%), Positives = 111/239 (46%), Gaps = 9/239 (3%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLATK---NALARLDWDANLPHPFPVKTVPPQTIDKIVG 106
            +YG H V+A L    + I +L   +   +A  R   +        V       ++ I  
Sbjct: 6   LIYGFHAVNARLWQNPKSITELYIQEGKNDARTRDVLEKAANENVRVHFADADRLNAIS- 64

Query: 107 KEAVHQGLALET-----APLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDG 161
           K A HQG+            L   L+ +    LL++LD + DPHN+GA LR+A A     
Sbjct: 65  KGARHQGVVGFIDASKNHVHLEDVLENLSEPPLLLILDGITDPHNLGACLRTADAMGVHA 124

Query: 162 IITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLE 221
           +I  K  S   +A ++K A GA E +PYI ++NL   L+++  +G   IG        L 
Sbjct: 125 VIAPKDKSAGLNATVSKVACGAAETVPYITVTNLARTLRELKEYGIWIIGTDMGGDADLY 184

Query: 222 QEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
                D  A ++G EG+G+R  T+E    +  + M G ++++NVS +A + L  T+   
Sbjct: 185 HCDLPDSAAWVMGNEGEGMRRLTREHCDMLVSIPMFGTVESMNVSVSAGMVLSETRRQR 243


>gi|224475680|ref|YP_002633286.1| putative rRNA methyltransferase [Staphylococcus carnosus subsp.
           carnosus TM300]
 gi|222420287|emb|CAL27101.1| putative rRNA methyltransferase [Staphylococcus carnosus subsp.
           carnosus TM300]
          Length = 249

 Score =  136 bits (341), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 70/240 (29%), Positives = 116/240 (48%), Gaps = 11/240 (4%)

Query: 50  FLYGVHTVSAALN--NPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGK 107
            + G H V  A+   +P  KI      K                 V+TVP   +D +   
Sbjct: 7   VIVGRHAVKEAITTGHPINKILIQDGVKKQQLEEILKHAKNQKIVVQTVPKSKLDHLA-- 64

Query: 108 EAVHQGLALETAPLLSPTLD-------AVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCD 160
           EA HQG+A   AP     LD              L++LD + DPHN+G+ILR+A A   D
Sbjct: 65  EAPHQGVAALVAPYEYADLDKLLAQLKDKDGLPTLVILDGLEDPHNLGSILRTADAAGVD 124

Query: 161 GIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPL 220
           G+I  KR S + +  +AK+++GA++H+P +R++NL+  + ++   G+   G ++D+    
Sbjct: 125 GVIIPKRRSVALTQTVAKASAGAIQHVPVVRVTNLSQTMDQLKDEGYWIAGTAADNATDY 184

Query: 221 EQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
            Q   +  +A+++G EG G+    +E       + M G I +LN S AA++ +Y      
Sbjct: 185 RQMAADMPLAIVIGNEGHGMSRLVKEKCDFYIKIPMVGHINSLNASVAASLMMYEIYRKR 244


>gi|82779438|ref|YP_405787.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Shigella dysenteriae
           Sd197]
 gi|81243586|gb|ABB64296.1| conserved hypothetical protein [Shigella dysenteriae Sd197]
          Length = 243

 Score =  136 bits (341), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 62/242 (25%), Positives = 104/242 (42%), Gaps = 8/242 (3%)

Query: 48  NLFLYGVHTVSAALNNPSRKIFQLLATKNALARLD---WDANLPHPFPVKTVPPQTIDKI 104
           +  +YG+H V A L     +  ++   K    +       A       ++    Q +D+ 
Sbjct: 2   SEMIYGIHAVQALLERAPERFQEVFILKGREDKRLLPLIHALESQGVVIQLANRQYLDEK 61

Query: 105 VGKEAVHQGLALETAPLLSPTLDAVR-----NSQLLMVLDHVNDPHNIGAILRSAVAFSC 159
                    +A           D        +   L++LD V DPHN+GA LRSA A   
Sbjct: 62  SDGAVHQGIIARVKPGRQYQENDLPDLIASLDQPFLLILDGVTDPHNLGACLRSADAAGV 121

Query: 160 DGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKP 219
             +I  K  S   +A   K A GA E +P IR++NL   ++ +       +G + ++   
Sbjct: 122 HAVIVPKDRSAQLNATAKKVACGAAESVPLIRVTNLARTMRMLQEENIWIVGTAGEADHT 181

Query: 220 LEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNH 279
           L Q     ++AL++GAEG+G+R  T+E    +  + M G + +LNVS A  + L+     
Sbjct: 182 LCQSKMTGRLALVMGAEGEGMRRLTREHCDELISIPMAGSVSSLNVSVATGICLFEAVRQ 241

Query: 280 FA 281
            +
Sbjct: 242 RS 243


>gi|56961913|ref|YP_173635.1| tRNA/rRNA methyltransferase [Bacillus clausii KSM-K16]
 gi|56908147|dbj|BAD62674.1| tRNA/rRNA methyltransferase [Bacillus clausii KSM-K16]
          Length = 263

 Score =  136 bits (341), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 67/268 (25%), Positives = 126/268 (47%), Gaps = 19/268 (7%)

Query: 24  RRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLA---TKNALAR 80
           +R +   KK    + +       +  F+ G + V  A+ +    I ++     ++     
Sbjct: 3   KRTNPQPKKQMKGDNR-------QEEFIVGKNPVIEAIKSGH-PIHKIWIGDQSQKGQMT 54

Query: 81  LDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNS-------Q 133
                       V+T P + +D++VG  + HQG+    A      +DA+           
Sbjct: 55  KLTQLAKEQNVLVQTAPKRKLDQLVGH-SNHQGVVASVAAYEYADMDALFAKAAAAHEAP 113

Query: 134 LLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRIS 193
             +VLD + DPHN+G+I+R+A A    GII  KR S   +  +AK+++GA+E+IP +R++
Sbjct: 114 FFLVLDEIEDPHNLGSIMRTADAVGAHGIIIPKRRSVGLTQTVAKASTGAIEYIPVVRVT 173

Query: 194 NLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAH 253
           NL   + ++   G    G  + ++    +   N  + L++G+EGKG+    +E    +  
Sbjct: 174 NLARTMDELKKQGLWFAGTDAAAEGDYREADYNLPLCLVIGSEGKGISRLIKEKCDFLVS 233

Query: 254 LHMPGIIKALNVSNAAAVALYITQNHFA 281
           + M G + +LN S AA++ +Y   +  A
Sbjct: 234 IPMKGRVTSLNASVAASLLMYEVFHKRA 261


>gi|110636002|ref|YP_676210.1| tRNA/rRNA methyltransferase (SpoU) [Mesorhizobium sp. BNC1]
 gi|110286986|gb|ABG65045.1| tRNA/rRNA methyltransferase (SpoU) [Chelativorans sp. BNC1]
          Length = 286

 Score =  136 bits (341), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 47/257 (18%), Positives = 89/257 (34%), Gaps = 6/257 (2%)

Query: 26  NHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDA 85
           ++   K +++   K +   +       G+  V  AL++    I  L+  K        + 
Sbjct: 21  SNPLVKDIKALTLK-KFRDRERAFMAEGLKLVLDALDSGW-AIRTLIYAKAGRGNAAVEK 78

Query: 86  NLPHPFP----VKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDHV 141
                      V  V  + +  I  ++     + +     L       +   L + LD V
Sbjct: 79  AAARTVAAGGLVLEVSEKVLSAITRRDNPQMVVGVFEQRWLPLKEVTPKGEDLWVALDRV 138

Query: 142 NDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQK 201
            DP N+G I+R+  A    G+I     +   S    ++  G++  +P  R         +
Sbjct: 139 RDPGNLGTIIRTVDAVGARGVILVGECTDPFSVETVRATMGSVFSVPLARADEAAFLAWR 198

Query: 202 MHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIK 261
            H  G         S      +     + L++G E +GL  K  E    +  +   G   
Sbjct: 199 EHFAGLMVGTHLKGSVDYRNVDYSGGPVLLLMGNEQQGLPDKLAEACDRLVRIPQAGRAD 258

Query: 262 ALNVSNAAAVALYITQN 278
           +LN++ A  V LY  + 
Sbjct: 259 SLNLAVATGVMLYEIRR 275


>gi|225873641|ref|YP_002755100.1| RNA methyltransferase, TrmH family, group 3 [Acidobacterium
           capsulatum ATCC 51196]
 gi|225791622|gb|ACO31712.1| RNA methyltransferase, TrmH family, group 3 [Acidobacterium
           capsulatum ATCC 51196]
          Length = 270

 Score =  136 bits (341), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 68/246 (27%), Positives = 106/246 (43%), Gaps = 14/246 (5%)

Query: 48  NLFLYGVHTVSAALNNPSRKIFQLLATKNALAR-------LDWDANLPHPFPVKTVPPQT 100
              LYG+H V  AL   SRK   +  ++               D        ++    + 
Sbjct: 1   MDVLYGLHPVEEALRAGSRKFDHVCVSRERQDHGAAQKLQRIVDLCRSEGVRLRFENREQ 60

Query: 101 IDKIVGKEAVHQGLALETAPLLSPTLDA------VRNSQLLMVLDHVNDPHNIGAILRSA 154
           + ++    A HQG+          T++         +  LL+ LD V DP N+GA+LRSA
Sbjct: 61  LTRMAKTHA-HQGVVAVVRERSFLTIEDLMAAPADGHPHLLLALDGVEDPQNLGALLRSA 119

Query: 155 VAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSS 214
                DG++  +R S   SAV  K+++GA EHI   R+ NL  AL+++       +GL  
Sbjct: 120 DGAGVDGVLLPERRSAPLSAVAVKTSAGAAEHIRIARVVNLVRALEQLKEQNIWCVGLDE 179

Query: 215 DSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
                 +         ++LG EG+GL    ++T   +  + M G + +LNVS A AV LY
Sbjct: 180 RGTMSYDAYDWTTPSVVVLGREGEGLHDLVRKTCDHLVRIPMAGGVSSLNVSAAGAVVLY 239

Query: 275 ITQNHF 280
                 
Sbjct: 240 EAARQR 245


>gi|239998822|ref|ZP_04718746.1| RNA methylase [Neisseria gonorrhoeae 35/02]
 gi|240014263|ref|ZP_04721176.1| RNA methylase [Neisseria gonorrhoeae DGI18]
 gi|240016699|ref|ZP_04723239.1| RNA methylase [Neisseria gonorrhoeae FA6140]
 gi|240121826|ref|ZP_04734788.1| RNA methylase [Neisseria gonorrhoeae PID24-1]
 gi|240125597|ref|ZP_04738483.1| RNA methylase [Neisseria gonorrhoeae SK-92-679]
 gi|268594665|ref|ZP_06128832.1| 23S rRNA (guanosine-2'-O-)-methyltransferase rlmB [Neisseria
           gonorrhoeae 35/02]
 gi|268684185|ref|ZP_06151047.1| 23S rRNA (guanosine-2'-O-)-methyltransferase rlmB [Neisseria
           gonorrhoeae SK-92-679]
 gi|268548054|gb|EEZ43472.1| 23S rRNA (guanosine-2'-O-)-methyltransferase rlmB [Neisseria
           gonorrhoeae 35/02]
 gi|268624469|gb|EEZ56869.1| 23S rRNA (guanosine-2'-O-)-methyltransferase rlmB [Neisseria
           gonorrhoeae SK-92-679]
          Length = 250

 Score =  136 bits (341), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 69/238 (28%), Positives = 110/238 (46%), Gaps = 9/238 (3%)

Query: 51  LYGVHTVSAALNNPSRKIFQLLATK---NALARLDWDANLPHPFPVKTVPPQTIDKIVGK 107
           +YG H V+A L    + I +L   +   +A  R   +        V       ++ I  K
Sbjct: 7   IYGFHAVNARLWQNPKSITELYIQEGKSDARTREVLEKAANENIRVYFADADRLNAIS-K 65

Query: 108 EAVHQGLALET-----APLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGI 162
            A HQG+            L   L+ +    LL++LD + DPHN+GA LR+A A     +
Sbjct: 66  GARHQGVVGFIDASKNHVHLEDVLENLSEPPLLLILDGITDPHNLGACLRTADAMGVHAV 125

Query: 163 ITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQ 222
           I  K  S   +A ++K A GA E +PYI ++NL   L+++  +G   IG        L  
Sbjct: 126 IAPKDKSAGLNATVSKVACGAAETVPYITVTNLARTLRELKEYGIWIIGTDIGGNADLYH 185

Query: 223 EIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
               D  A ++G EG G+R  T+E    +  + M G ++++NVS +A + L  T+   
Sbjct: 186 CNLPDSAAWVMGNEGDGMRRLTREHCDMLVSIPMFGTVESMNVSVSAGMVLSETRRQR 243


>gi|164686508|ref|ZP_02210536.1| hypothetical protein CLOBAR_00073 [Clostridium bartlettii DSM
           16795]
 gi|164604519|gb|EDQ97984.1| hypothetical protein CLOBAR_00073 [Clostridium bartlettii DSM
           16795]
          Length = 248

 Score =  136 bits (341), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 54/242 (22%), Positives = 109/242 (45%), Gaps = 13/242 (5%)

Query: 51  LYGVHTVSAALNNPSRKIFQLLAT---KNALARLDWDANLPHPFPVKTVPPQTIDKIVGK 107
           + G + +  AL +  R I +L+ +   K    +            ++ V    +D+I   
Sbjct: 8   IEGRNPIIEALRSD-RPIDKLMISNTSKEGSIKKIIGMAKEKNVVIQYVDKHKLDEISTS 66

Query: 108 EAVHQGLALETAPLLSPTLDA-------VRNSQLLMVLDHVNDPHNIGAILRSAVAFSCD 160
            + HQG+    +      L+               ++LD + DPHN+G I+R+A A    
Sbjct: 67  HS-HQGVIAVVSDYKYYELEDLLAIARERGEDPFFIILDEITDPHNLGTIIRTADAVGAH 125

Query: 161 GIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPL 220
           G+I  KR S   ++V+AK+++GA+E++P  +++N+ + ++++   G              
Sbjct: 126 GVIIPKRRSVHITSVVAKASAGAVEYVPVCKVTNIANTIKQLKKEGLWIAAA-DMDGGVF 184

Query: 221 EQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
            ++     +AL++G+EG G+    ++    +  + M G + +LN S A  + LY      
Sbjct: 185 YEQDLTGPLALVIGSEGFGVSRLVKQNCDFVVKMPMIGNVSSLNASVAGGILLYEIFRQR 244

Query: 281 AK 282
            K
Sbjct: 245 MK 246


>gi|164687655|ref|ZP_02211683.1| hypothetical protein CLOBAR_01297 [Clostridium bartlettii DSM
           16795]
 gi|164603429|gb|EDQ96894.1| hypothetical protein CLOBAR_01297 [Clostridium bartlettii DSM
           16795]
          Length = 265

 Score =  136 bits (341), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 46/282 (16%), Positives = 112/282 (39%), Gaps = 23/282 (8%)

Query: 2   NLISKKKSEKIFSLKDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAAL 61
           N+I  K ++KI   K                      K++  ++ +   + G   ++ AL
Sbjct: 3   NIIKSKDNDKIKYTKSL-------------------LKTKGRNKEKKFIIEGYRILTLAL 43

Query: 62  NNPSRKIFQLL---ATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALET 118
              ++  +  +     K    ++  +        +     +   ++V  E     LA+  
Sbjct: 44  ECDAKLEYVFINEDFEKKQDHKVLLEELENKNIKIYKTSNKIFSEMVDTENTQGILAVLR 103

Query: 119 APLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAK 178
                   +  ++ + +++LD + DP N+G I+R+A +   D II  K      +  + +
Sbjct: 104 YKERDLVNNINQDDKFVLILDRIQDPGNMGTIIRTADSAGVDAIILLKGCVDIYNPKVIR 163

Query: 179 SASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGK 238
           S  G++     I  +   +A+  + +  F  +     ++    +   + KIAL++G E  
Sbjct: 164 STMGSIF-DMNIIQTTQDEAVDFLKANNFDIVSSYLHTESYYNETTYDGKIALVIGNEAN 222

Query: 239 GLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
           G+  +    +  +  + + G  ++LN + +AA+ +Y  + + 
Sbjct: 223 GINDELISKSDKLVKIPIYGNAESLNAAISAAILMYEIKKYL 264


>gi|225626689|ref|ZP_03784728.1| RNA methyltransferase [Brucella ceti str. Cudo]
 gi|254713278|ref|ZP_05175089.1| tRNA/rRNA methyltransferase (SpoU) [Brucella ceti M644/93/1]
 gi|254716369|ref|ZP_05178180.1| tRNA/rRNA methyltransferase (SpoU) [Brucella ceti M13/05/1]
 gi|256158847|ref|ZP_05456704.1| tRNA/rRNA methyltransferase (SpoU) [Brucella ceti M490/95/1]
 gi|256254228|ref|ZP_05459764.1| tRNA/rRNA methyltransferase (SpoU) [Brucella ceti B1/94]
 gi|260169726|ref|ZP_05756537.1| RNA methyltransferase, TrmH family protein [Brucella sp. F5/99]
 gi|261218151|ref|ZP_05932432.1| tRNA/rRNA methyltransferase [Brucella ceti M13/05/1]
 gi|261221377|ref|ZP_05935658.1| tRNA/rRNA methyltransferase [Brucella ceti B1/94]
 gi|261321001|ref|ZP_05960198.1| tRNA/rRNA methyltransferase [Brucella ceti M644/93/1]
 gi|261759264|ref|ZP_06002973.1| tRNA/rRNA methyltransferase [Brucella sp. F5/99]
 gi|265997338|ref|ZP_06109895.1| tRNA/rRNA methyltransferase [Brucella ceti M490/95/1]
 gi|225618346|gb|EEH15389.1| RNA methyltransferase [Brucella ceti str. Cudo]
 gi|260919961|gb|EEX86614.1| tRNA/rRNA methyltransferase [Brucella ceti B1/94]
 gi|260923240|gb|EEX89808.1| tRNA/rRNA methyltransferase [Brucella ceti M13/05/1]
 gi|261293691|gb|EEX97187.1| tRNA/rRNA methyltransferase [Brucella ceti M644/93/1]
 gi|261739248|gb|EEY27244.1| tRNA/rRNA methyltransferase [Brucella sp. F5/99]
 gi|262551806|gb|EEZ07796.1| tRNA/rRNA methyltransferase [Brucella ceti M490/95/1]
          Length = 297

 Score =  136 bits (341), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 47/255 (18%), Positives = 84/255 (32%), Gaps = 4/255 (1%)

Query: 27  HRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDAN 86
           +   K ++S   K +   Q       G+  V  AL    R    + A      +      
Sbjct: 35  NPIVKDLRSLALK-KFRDQQGVFLAEGLKLVIDALEQDWRIKTLVFAKSGKGNKTVEQVA 93

Query: 87  L---PHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDHVND 143
                    V  V  + I  I  ++       +             + + + + LD V D
Sbjct: 94  ARTFAKDGLVLEVTEKVISAITRRDNPQMVAGVFEQQYHQLAGLKPKGNDVYVALDRVRD 153

Query: 144 PHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMH 203
           P N+G ++R+A A    G+I     +   S    ++  G++  +P  R S       +  
Sbjct: 154 PGNLGTVIRTADAVGAKGVILIGDTTDPYSLETVRATMGSVFSVPLYRASEADFLNWRKG 213

Query: 204 SWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKAL 263
             G         +         N  + LI+G E +GL          +A +   G   +L
Sbjct: 214 FSGLVVGTHLKGAVDYRTIPYANKPVILIMGNEQQGLPDSLAGACDKLARIPQAGRADSL 273

Query: 264 NVSNAAAVALYITQN 278
           N++ A  V LY  + 
Sbjct: 274 NLAIATGVMLYEIRR 288


>gi|238797599|ref|ZP_04641096.1| 23S rRNA (guanosine-2'-O-)-methyltransferase rlmB [Yersinia
           mollaretii ATCC 43969]
 gi|238718596|gb|EEQ10415.1| 23S rRNA (guanosine-2'-O-)-methyltransferase rlmB [Yersinia
           mollaretii ATCC 43969]
          Length = 246

 Score =  136 bits (341), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 66/242 (27%), Positives = 107/242 (44%), Gaps = 8/242 (3%)

Query: 48  NLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDW---DANLPHPFPVKTVPPQTIDKI 104
           +  +YG+H V A L+N  ++  ++   K    R               ++    Q +D  
Sbjct: 2   SEIIYGIHAVKALLDNDPQRFLEVFILKGRDDRRLQPLVAELEAAGLVIQVANRQWLDAQ 61

Query: 105 VGKEAVHQGLALETAPLLSPTLDAVR-----NSQLLMVLDHVNDPHNIGAILRSAVAFSC 159
           V        +A           D            L+VLD V DPHN+GA LRSA A   
Sbjct: 62  VEGGVHQGIVARVREGRQYQENDLPALLKSVEMPFLLVLDGVTDPHNLGACLRSADAAGV 121

Query: 160 DGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKP 219
             +I  +  S   +A+  K ASGA E++P I+++NL   L+ +       +G + ++   
Sbjct: 122 HAVIVPRDRSAQLNAIAKKVASGAAENVPLIKVTNLARTLRVLQEHNVWIVGTAGEADHT 181

Query: 220 LEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNH 279
           L Q      +AL++GAEG+G+R  T+E    +  + M G + +LNVS A  V L+     
Sbjct: 182 LYQSKMTGPMALVMGAEGEGMRRLTREHCDELISIPMAGTVSSLNVSVATGVCLFEAVRQ 241

Query: 280 FA 281
            +
Sbjct: 242 RS 243


>gi|315617593|gb|EFU98199.1| RNA 2'-O ribose methyltransferase substrate binding family protein
           [Escherichia coli 3431]
          Length = 243

 Score =  136 bits (341), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 63/242 (26%), Positives = 105/242 (43%), Gaps = 8/242 (3%)

Query: 48  NLFLYGVHTVSAALNNPSRKIFQLLATKNALARLD---WDANLPHPFPVKTVPPQTIDKI 104
           +  +YG+H V A L     +  ++   K    +       A   H   ++    Q +D+ 
Sbjct: 2   SEMIYGIHAVQALLERAPERFQEVFILKGREDKRLLPLIHALESHGVVIQLANRQYLDEK 61

Query: 105 VGKEAVHQGLALETAPLLSPTLDAVR-----NSQLLMVLDHVNDPHNIGAILRSAVAFSC 159
                    +A           D        +   L++LD V DPHN+GA LRSA A   
Sbjct: 62  SDGGVHQGIIARVKPGRQYQENDLPDLIASLDQPFLLILDGVTDPHNLGACLRSADAAGV 121

Query: 160 DGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKP 219
             +I  K  S   +A   K A GA E +P IR++NL   ++ +       +G + ++   
Sbjct: 122 HAVIVPKDRSAQLNATARKVACGAAESVPLIRVTNLARTMRMLQEENIWIVGTAGEADHT 181

Query: 220 LEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNH 279
           L Q     ++AL++GAEG+G+R  T+E    +  + M G + +LNVS A  + L+     
Sbjct: 182 LYQSKMTGRLALVMGAEGEGMRRLTREHCDELISIPMAGSVSSLNVSVATGICLFEAVRQ 241

Query: 280 FA 281
            +
Sbjct: 242 RS 243


>gi|312135023|ref|YP_004002361.1| tRNA/rRNA methyltransferase (SpoU) [Caldicellulosiruptor owensensis
           OL]
 gi|311775074|gb|ADQ04561.1| tRNA/rRNA methyltransferase (SpoU) [Caldicellulosiruptor owensensis
           OL]
          Length = 270

 Score =  136 bits (341), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 53/284 (18%), Positives = 116/284 (40%), Gaps = 26/284 (9%)

Query: 2   NLISKKKSEKIFSLKDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAAL 61
             IS +++E I  +K  H                     ++  +  +  + G+  V  A+
Sbjct: 7   EFISSRENECIKRVKKLHDK-------------------KYREEFRSFIIEGLKLVKEAI 47

Query: 62  NNPSRKIFQLLATKNALARLDWD----ANLPHPFPVKTV--PPQTIDKIVGKEAVHQGLA 115
           +     I  ++ ++ A  R          L     +K V   P  + + +   +  QG+ 
Sbjct: 48  DYQIECINLVIFSQQAKDRYQEFYWECKRLLEDGKIKRVIEVPDKLFEYIATTSTPQGIL 107

Query: 116 LETAPLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAV 175
            E   +    ++ ++N + ++V D + DP N+G ++R A AF  D ++TTK      +  
Sbjct: 108 AECNFVDK-DINFIKNLKRVVVADKLQDPGNLGTLIRCADAFGFDAVVTTKGTVDIYNPK 166

Query: 176 LAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGA 235
             ++  G+L H+  +R +     ++ +    F     +      + + + + K  +++G 
Sbjct: 167 TIRATMGSLFHLQIMREAEEGKLIKILKDNSFAVYVATPYGDIEISKVVPDKKFCVVIGN 226

Query: 236 EGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNH 279
           E +G+     + A     + M G  ++LN + AA+V LY  +  
Sbjct: 227 ESEGVSDSFAKVAARKIKIPMAGKAESLNAAVAASVVLYELRKR 270


>gi|239830999|ref|ZP_04679328.1| tRNA/rRNA methyltransferase (SpoU) [Ochrobactrum intermedium LMG
           3301]
 gi|239823266|gb|EEQ94834.1| tRNA/rRNA methyltransferase (SpoU) [Ochrobactrum intermedium LMG
           3301]
          Length = 293

 Score =  136 bits (341), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 45/255 (17%), Positives = 88/255 (34%), Gaps = 4/255 (1%)

Query: 27  HRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDAN 86
           +   K ++S   K +   Q       G+  V  AL    R    + A      ++     
Sbjct: 29  NPIVKDLRSLALK-KFRDQQGVFLAEGLKLVIDALEQDWRIKTLVFAKSGKGNKMVEQVA 87

Query: 87  L---PHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDHVND 143
                    V  V  + +  I  ++     + +             + + + + LD V D
Sbjct: 88  ARTFAKGGLVLEVTEKIMAAITRRDNPQMVVGVFEQQYRPLASLKPKGNDVYIALDRVRD 147

Query: 144 PHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMH 203
           P N+G ++R+A A S  G+I     +   S    ++  G++  +P  ++S       +  
Sbjct: 148 PGNLGTVIRTADAVSAKGVILIGDTTDPYSLETVRATMGSVFSMPLYKVSEADFLNWRKG 207

Query: 204 SWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKAL 263
             G         +         N  + L++G E +GL          +A +   G   +L
Sbjct: 208 VSGLVVGTHLKGAVDYRTIPYANKPVVLMMGNEQQGLPDSLAGACDKLARIPQAGRADSL 267

Query: 264 NVSNAAAVALYITQN 278
           N++ A  V LY  + 
Sbjct: 268 NLAIATGVMLYEIRR 282


>gi|295706828|ref|YP_003599903.1| 23S rRNA methyltransferase [Bacillus megaterium DSM 319]
 gi|294804487|gb|ADF41553.1| 23S rRNA methyltransferase [Bacillus megaterium DSM 319]
          Length = 252

 Score =  136 bits (341), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 54/277 (19%), Positives = 104/277 (37%), Gaps = 27/277 (9%)

Query: 1   MNLISKKKSEKIFSLKDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAA 60
           M  I   K+ ++ + K  H                     +   +     + G H V  A
Sbjct: 1   MKQIDSVKNPQVKAWKKLH-------------------NKKDRDKQGLFMVEGFHLVEEA 41

Query: 61  LNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAP 120
           + N    + +L+  ++      W+ +      +  V    I  +   E     +      
Sbjct: 42  IKN-KDCVKELIIRESIEVPAQWNID---GIEITVVNEAIIKLLSDTETPQGII---AVC 94

Query: 121 LLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSA 180
             +   + +  +Q +++LD V DP N+G I+R+A A   D II  +      +  + +S 
Sbjct: 95  FQTKHAEIIHTAQKVLLLDAVQDPGNLGTIIRTADAAGVDAIIVGEGSVDVYNPKVVRST 154

Query: 181 SGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGL 240
            GA+ H+P ++   L                   + K     +  N+  ALI+G EG G+
Sbjct: 155 QGAIFHLPIVKGDLLEMISLLKERGIAVYGTSLQNGKVYTCVKPSNE-FALIVGNEGNGV 213

Query: 241 RPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQ 277
             K  E      ++ + G  ++LNV+ A+ + LY  +
Sbjct: 214 SEKVLEQTDQNLYIPIYGKSESLNVAIASGILLYYLR 250


>gi|238786345|ref|ZP_04630280.1| 23S rRNA (guanosine-2'-O-)-methyltransferase rlmB [Yersinia
           bercovieri ATCC 43970]
 gi|238712744|gb|EEQ04821.1| 23S rRNA (guanosine-2'-O-)-methyltransferase rlmB [Yersinia
           bercovieri ATCC 43970]
          Length = 246

 Score =  136 bits (341), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 67/242 (27%), Positives = 107/242 (44%), Gaps = 8/242 (3%)

Query: 48  NLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANL---PHPFPVKTVPPQTIDKI 104
           +  +YG+H V A L+N  ++  ++   K    R               ++    Q +D  
Sbjct: 2   SEIIYGIHAVKALLDNDPQRFLEVFILKGRDDRRLQPLIAELEAAGLVIQVANRQWLDAQ 61

Query: 105 VGKEAVHQGLALETAPLLSPTLDAVR-----NSQLLMVLDHVNDPHNIGAILRSAVAFSC 159
           V        +A           D            L+VLD V DPHN+GA LRSA A   
Sbjct: 62  VEGGVHQGIVARVREGRQYQENDLPALLKSVEMPFLLVLDGVTDPHNLGACLRSADAAGV 121

Query: 160 DGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKP 219
             +I  +  S   +A+  K ASGA E++P I+++NL   L+ +       +G + ++   
Sbjct: 122 HAVIVPRDRSAQLNAIAKKVASGAAENVPLIKVTNLARTLRVLQEHNVWIVGTAGEADHT 181

Query: 220 LEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNH 279
           L Q      +AL++GAEG+G+R  T+E    +  + M G + +LNVS A  V L+     
Sbjct: 182 LYQSKMTGPMALVMGAEGEGMRRLTREHCDELISIPMAGTVSSLNVSVATGVCLFEAVRQ 241

Query: 280 FA 281
            A
Sbjct: 242 RA 243


>gi|163846264|ref|YP_001634308.1| tRNA/rRNA methyltransferase SpoU [Chloroflexus aurantiacus J-10-fl]
 gi|222524019|ref|YP_002568489.1| tRNA/rRNA methyltransferase SpoU [Chloroflexus sp. Y-400-fl]
 gi|163667553|gb|ABY33919.1| tRNA/rRNA methyltransferase (SpoU) [Chloroflexus aurantiacus
           J-10-fl]
 gi|222447898|gb|ACM52164.1| tRNA/rRNA methyltransferase (SpoU) [Chloroflexus sp. Y-400-fl]
          Length = 261

 Score =  136 bits (341), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 50/255 (19%), Positives = 94/255 (36%), Gaps = 6/255 (2%)

Query: 27  HRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATK---NALARLDW 83
           +   K +++  Q+ +   +     + G+  V+ A+   +     ++A +   ++ A    
Sbjct: 8   NPTIKALRALRQR-KARDEQGRYLIEGIRPVAEAIQCGAPLDMLVVAPELLNSSFAHELI 66

Query: 84  DANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDHVND 143
           D        + TV       +  K+   QGLA       +P  +        +VL  V D
Sbjct: 67  DTYAAGGGKILTVSAAVFSSLADKD-NPQGLAAVGRIHYTPLPNLSPAPVGWVVLVEVAD 125

Query: 144 PHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMH 203
           P N+G ILR+A      G+I     +        +++ GAL     I  ++  D L    
Sbjct: 126 PGNLGTILRTADGAGFSGVILVGATTDPFDPAAVRASMGALF-SQQIARTSWPDLLTWAR 184

Query: 204 SWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKAL 263
                 +G S               + L+LG+E  GL  +       +  + M G   +L
Sbjct: 185 QHRIALVGSSDRGASDYRATTYPRPLLLVLGSERHGLTDEQLAACDLVVRIPMRGRSDSL 244

Query: 264 NVSNAAAVALYITQN 278
           N++ AA + +Y    
Sbjct: 245 NLAVAAGILMYEATR 259


>gi|317164111|gb|ADV07652.1| RNA methylase [Neisseria gonorrhoeae TCDC-NG08107]
          Length = 255

 Score =  136 bits (341), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 69/238 (28%), Positives = 110/238 (46%), Gaps = 9/238 (3%)

Query: 51  LYGVHTVSAALNNPSRKIFQLLATK---NALARLDWDANLPHPFPVKTVPPQTIDKIVGK 107
           +YG H V+A L    + I +L   +   +A  R   +        V       ++ I  K
Sbjct: 12  IYGFHAVNARLWQNPKSITELYIQEGKSDARTREVLEKAANENIRVYFADADRLNAIS-K 70

Query: 108 EAVHQGLALET-----APLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGI 162
            A HQG+            L   L+ +    LL++LD + DPHN+GA LR+A A     +
Sbjct: 71  GARHQGVVGFIDASKNHVHLEDVLENLSEPPLLLILDGITDPHNLGACLRTADAMGVHAV 130

Query: 163 ITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQ 222
           I  K  S   +A ++K A GA E +PYI ++NL   L+++  +G   IG        L  
Sbjct: 131 IAPKDKSAGLNATVSKVACGAAETVPYITVTNLARTLRELKEYGIWIIGTDIGGNADLYH 190

Query: 223 EIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
               D  A ++G EG G+R  T+E    +  + M G ++++NVS +A + L  T+   
Sbjct: 191 CNLPDSAAWVMGNEGDGMRRLTREHCDMLVSIPMFGTVESMNVSVSAGMVLSETRRQR 248


>gi|49474842|ref|YP_032883.1| tRNA/rRNA methyltransferase [Bartonella henselae str. Houston-1]
 gi|49237647|emb|CAF26827.1| tRNA/rRNA methyltransferase [Bartonella henselae str. Houston-1]
          Length = 287

 Score =  136 bits (341), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 48/275 (17%), Positives = 100/275 (36%), Gaps = 11/275 (4%)

Query: 7   KKSEKIFSLKDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSR 66
            K+ K+  +          ++   K +++ +QK ++ ++       G+  V  ALN   +
Sbjct: 9   PKTGKVKEITSL-------SNPIIKDLKALSQK-KNRNREGLFMAEGLKLVIDALNLGWK 60

Query: 67  KIFQLLATKNALARLDWDANL---PHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLS 123
               + +          +       +   V     + ++ I  ++     + +      S
Sbjct: 61  IQTLIFSKSKISNTAIENTAAHTVANGGLVIKASQKVMESIARRDNPQTVIGIFKQQWQS 120

Query: 124 PTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGA 183
             +   +   + + LD V DP N+G I+R+A A    G+I     +   S    ++  G+
Sbjct: 121 LEMITGQAEDVYVALDRVRDPGNLGTIIRTADAVGAKGVILIGETTDPFSPETVRATMGS 180

Query: 184 LEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPK 243
           +  +P  R           H  G         S      + KN  + L++G E +GL   
Sbjct: 181 IFSVPLYRFDESAFLNWSTHFKGMIVGTHLKGSIDYRTIDFKNGPVILLMGNEKQGLPDI 240

Query: 244 TQETATSMAHLHMPGIIKALNVSNAAAVALYITQN 278
                  +A +   G   +LN++ A A+ LY  + 
Sbjct: 241 LANCCDKLARIPQSGRADSLNLAVATAIMLYEIRR 275


>gi|320530261|ref|ZP_08031330.1| RNA methyltransferase, TrmH family, group 3 [Selenomonas artemidis
           F0399]
 gi|320137476|gb|EFW29389.1| RNA methyltransferase, TrmH family, group 3 [Selenomonas artemidis
           F0399]
          Length = 265

 Score =  135 bits (340), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 65/241 (26%), Positives = 108/241 (44%), Gaps = 11/241 (4%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLATKNAL--ARLDWDANLPHPFPVKTVPPQTIDKIVGK 107
            L G H ++ A+    R I ++L         R   D    H   V  V    +D    +
Sbjct: 19  ILAGRHAITEAIKAG-RGINRILIADGMHGGVRELRDLARAHDITVDIVSRAKLDA-AAE 76

Query: 108 EAVHQGLALETAPLLSPTLDA-------VRNSQLLMVLDHVNDPHNIGAILRSAVAFSCD 160
            A H G+    AP+    ++             LL++LD + DPHN+GA+LR+A A    
Sbjct: 77  GARHGGMLAYAAPVSYVPVEEIISSVRARGEEPLLLLLDGIEDPHNLGALLRTADAAGVH 136

Query: 161 GIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPL 220
           GI+  +R+S   +  +A+ ++GALE++P  RI N+   ++ +   GF   G         
Sbjct: 137 GILLPRRHSVPLTETVARVSAGALEYVPVARIGNIAQTIRALKEDGFWIAGADMAGSDTY 196

Query: 221 EQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
           ++      + L++G+EG+G+   T+E       L M G I +LN S A A+ +Y      
Sbjct: 197 DKANLTGALVLVIGSEGRGMSRLTRELCDFTVRLPMRGKINSLNASVAGAILMYEAMRQR 256

Query: 281 A 281
            
Sbjct: 257 T 257


>gi|320162047|ref|YP_004175272.1| putative RNA methyltransferase [Anaerolinea thermophila UNI-1]
 gi|319995901|dbj|BAJ64672.1| putative RNA methyltransferase [Anaerolinea thermophila UNI-1]
          Length = 265

 Score =  135 bits (340), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 48/272 (17%), Positives = 95/272 (34%), Gaps = 15/272 (5%)

Query: 10  EKIFSLKDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIF 69
           EKI SL          ++   + +++  Q+     +       GV  V   +    + + 
Sbjct: 4   EKITSL----------HNPRIQSIRALIQRREERRERGWFVAEGVRLVEEGVQAGWQAVM 53

Query: 70  QLLATKNALARLDWDANL-PHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDA 128
            L +   +         L      V  VP   + +I   E     L +    +       
Sbjct: 54  ALYSADLSARGQALLPALHAQGAEVFEVPASLLKQISDTETPQGILTVFARRVY----SL 109

Query: 129 VRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIP 188
                 +++ D++ DP N+G +LRSA A     +  T     + S  + ++  GA   +P
Sbjct: 110 PEPLDFVVIADNLRDPGNLGTLLRSAAAAGAQTVWLTPGTVDAFSPKVLRAGMGAHFRLP 169

Query: 189 YIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETA 248
              +S       +    G       +++  P         +AL++G E +G   + +   
Sbjct: 170 VQEVSLEWMRDFRHQHPGMHLYLAEAENGTPCWDTDLTQPLALVIGGEAEGASLEMRALV 229

Query: 249 TSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
                + MPG  ++LN + AA + L+      
Sbjct: 230 DGNITIPMPGKSESLNAAVAAGILLFEVVRQR 261


>gi|309787684|ref|ZP_07682295.1| RNA 2'-O ribose methyltransferase substrate binding family protein
           [Shigella dysenteriae 1617]
 gi|308924434|gb|EFP69930.1| RNA 2'-O ribose methyltransferase substrate binding family protein
           [Shigella dysenteriae 1617]
          Length = 240

 Score =  135 bits (340), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 62/239 (25%), Positives = 103/239 (43%), Gaps = 8/239 (3%)

Query: 51  LYGVHTVSAALNNPSRKIFQLLATKNALARLD---WDANLPHPFPVKTVPPQTIDKIVGK 107
           +YG+H V A L     +  ++   K    +       A       ++    Q +D+    
Sbjct: 2   IYGIHAVQALLERAPERFQEVFILKGREDKRLLPLIHALESQGVVIQLANRQYLDEKSDG 61

Query: 108 EAVHQGLALETAPLLSPTLDAVR-----NSQLLMVLDHVNDPHNIGAILRSAVAFSCDGI 162
                 +A           D        +   L++LD V DPHN+GA LRSA A     +
Sbjct: 62  AVHQGIIARVKPGRQYQENDLPDLIASLDQPFLLILDGVTDPHNLGACLRSADAAGVHAV 121

Query: 163 ITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQ 222
           I  K  S   +A   K A GA E +P IR++NL   ++ +       +G + ++   L Q
Sbjct: 122 IVPKDRSAQLNATAKKVACGAAESVPLIRVTNLARTMRMLQEENIWIVGTAGEADHTLCQ 181

Query: 223 EIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHFA 281
                ++AL++GAEG+G+R  T+E    +  + M G + +LNVS A  + L+      +
Sbjct: 182 SKMTGRLALVMGAEGEGMRRLTREHCDELISIPMAGSVSSLNVSVATGICLFEAVRQRS 240


>gi|294501480|ref|YP_003565180.1| 23S rRNA methyltransferase [Bacillus megaterium QM B1551]
 gi|294351417|gb|ADE71746.1| 23S rRNA methyltransferase [Bacillus megaterium QM B1551]
          Length = 252

 Score =  135 bits (340), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 52/277 (18%), Positives = 104/277 (37%), Gaps = 27/277 (9%)

Query: 1   MNLISKKKSEKIFSLKDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAA 60
           M  I   K+ ++ + K  H                     +   +     + G H V  A
Sbjct: 1   MKQIDSVKNPQVKAWKKLH-------------------NKKDRDKQGLFMVEGFHLVEEA 41

Query: 61  LNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAP 120
           + N    + +L+  ++      W+ +      +  V    I  +   E     +      
Sbjct: 42  IKN-KDCVKELIIRESIEVPAQWNID---GIEITVVNEAIIKLLSDTETPQGII---AVC 94

Query: 121 LLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSA 180
             +   + +  +Q +++LD V DP N+G I+R+A A   + II  +      +  + +S 
Sbjct: 95  FQTKHAEIIHTAQKVLLLDAVQDPGNLGTIIRTADAAGVEAIIVGEGSVDVYNPKVVRST 154

Query: 181 SGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGL 240
            GA+ H+P ++   L                   + K     +  N+  AL++G EG G+
Sbjct: 155 QGAIFHLPIVKGDLLEMISLLKEREIAVYGTSLQNGKVYTCVKPSNE-FALVVGNEGNGV 213

Query: 241 RPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQ 277
             K  E      ++ + G  ++LNV+ A+ + LY  +
Sbjct: 214 SEKVLEQTDQNLYIPIYGKSESLNVAIASGILLYYLR 250


>gi|238787548|ref|ZP_04631346.1| 23S rRNA (guanosine-2'-O-)-methyltransferase rlmB [Yersinia
           frederiksenii ATCC 33641]
 gi|238724335|gb|EEQ15977.1| 23S rRNA (guanosine-2'-O-)-methyltransferase rlmB [Yersinia
           frederiksenii ATCC 33641]
          Length = 246

 Score =  135 bits (340), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 67/242 (27%), Positives = 108/242 (44%), Gaps = 8/242 (3%)

Query: 48  NLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDW---DANLPHPFPVKTVPPQTIDKI 104
           +  +YG+H V A L+N  ++  ++   K    R               ++    Q +D  
Sbjct: 2   SEIIYGIHAVKALLDNDPQRFLEVFILKGRDDRRLQPLISELEAAGLVIQVASRQWLDSQ 61

Query: 105 VGKEAVHQGLALETAPLLSPTLDAVR-----NSQLLMVLDHVNDPHNIGAILRSAVAFSC 159
           V        +A           D         +  L+VLD V DPHN+GA LRSA A   
Sbjct: 62  VEGGVHQGIVARVREGRQYQENDLPALLASVETPFLLVLDGVTDPHNLGACLRSADAAGV 121

Query: 160 DGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKP 219
             +I  +  S   +A+  K ASGA E++P I+++NL   L+ +       +G + ++   
Sbjct: 122 HAVIVPRDRSAQLNAIAKKVASGAAENVPLIKVTNLARTLRVLQEHNVWIVGTAGEADHT 181

Query: 220 LEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNH 279
           L Q      +AL++GAEG+G+R  T+E    +  + M G + +LNVS A  V L+     
Sbjct: 182 LYQSKMTGPMALVMGAEGEGMRRLTREHCDELISIPMAGSVSSLNVSVATGVCLFEAVRQ 241

Query: 280 FA 281
            A
Sbjct: 242 RA 243


>gi|312793386|ref|YP_004026309.1| tRNA/rRNA methyltransferase (SpoU) [Caldicellulosiruptor
           kristjanssonii 177R1B]
 gi|312180526|gb|ADQ40696.1| tRNA/rRNA methyltransferase (SpoU) [Caldicellulosiruptor
           kristjanssonii 177R1B]
          Length = 270

 Score =  135 bits (340), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 50/284 (17%), Positives = 117/284 (41%), Gaps = 26/284 (9%)

Query: 2   NLISKKKSEKIFSLKDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAAL 61
             IS +++E I  +K  H                     ++  +  +  + G+  V  A+
Sbjct: 7   EFISSRENECIKRVKKLHDK-------------------KYREEFRSFIIEGLKLVKEAI 47

Query: 62  NNPSRKIFQLLATKNALARLDWD----ANLPHPFPVKTV--PPQTIDKIVGKEAVHQGLA 115
           +     I  ++ ++ A  R          L     ++ V   P  + + +   +  QG+ 
Sbjct: 48  DYQIECINLVMFSQQAKDRYQEFYWECKRLLEDGKIERVIEVPDKLFEYITTTSTPQGIL 107

Query: 116 LETAPLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAV 175
            E   +    ++ ++N + ++V + + DP N+G ++R A AF  D ++TTK      +  
Sbjct: 108 AECNFVDKG-INFIKNLRRVVVANKLQDPGNLGTLIRCADAFGFDAVVTTKGTVDIYNPK 166

Query: 176 LAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGA 235
             ++  G+L H+  +R +     ++ +    F     +      + + + + +  +++G 
Sbjct: 167 TIRATMGSLFHMQIMREAEEGKLIKILKDNSFAVYVATPYGDIEISKIVPDKRFCVVIGN 226

Query: 236 EGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNH 279
           E +G+     + AT    + M G  ++LN + AA++ LY  +  
Sbjct: 227 ESEGVSDSFAKMATRKIKIPMAGKAESLNAAVAASIVLYELRKR 270


>gi|149276383|ref|ZP_01882527.1| putative tRNA:rRNA methyltransferase [Pedobacter sp. BAL39]
 gi|149232903|gb|EDM38278.1| putative tRNA:rRNA methyltransferase [Pedobacter sp. BAL39]
          Length = 255

 Score =  135 bits (340), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 57/255 (22%), Positives = 108/255 (42%), Gaps = 13/255 (5%)

Query: 37  NQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDA-NLPHPF--PV 93
           N +     +  N F++G+ +V  A+      I  +   +     +  +   L      PV
Sbjct: 3   NSRRPARPKENNEFIFGIRSVIEAIKAGKD-IESIYIQRGLTGGIILELKALLKDVDAPV 61

Query: 94  KTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAV-------RNSQLLMVLDHVNDPHN 146
             VP + ++++   +  HQG+    + +    ++ +         + L+++LD + D  N
Sbjct: 62  HNVPVEKLNRMT--QKNHQGVIAVISSITFQKIEDIIPAVYEKGETPLILILDGITDVRN 119

Query: 147 IGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWG 206
           +GAI R+A       I+   + S   +A   K+++GAL  IP  R  NL      +   G
Sbjct: 120 MGAIARTAACAGVHAIVVPTKNSAQINADAIKTSAGALFTIPVCRHPNLHKTALFLQECG 179

Query: 207 FQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVS 266
            Q +  +  +   +         A+++GAE +G+  +    A  +A + M G I +LNVS
Sbjct: 180 LQIVACTEKTNDLIYAPDYTTPTAIVMGAEDEGISNEIMRMANHLAKIPMIGEISSLNVS 239

Query: 267 NAAAVALYITQNHFA 281
            +A V LY       
Sbjct: 240 VSAGVILYEAIRQRT 254


>gi|221133725|ref|ZP_03560030.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Glaciecola sp.
           HTCC2999]
          Length = 247

 Score =  135 bits (340), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 69/243 (28%), Positives = 113/243 (46%), Gaps = 8/243 (3%)

Query: 46  PENLFLYGVHTVSAALNNPSRKIFQLLATK---NALARLDWDANLPHPFPVKTVPPQTID 102
            +  +LYG+H ++A L    ++I +L   K   +       +        ++    + +D
Sbjct: 3   QQQDWLYGIHALTAVLEREPQRILELYIAKGRDDERLHKLINLARKEGISIQFCNKKVLD 62

Query: 103 KIVGKEAVHQGLA--LETAPLLSPTLDA---VRNSQLLMVLDHVNDPHNIGAILRSAVAF 157
                E+    +A       L    LD          L+VLD V DPHN+GA+LRSA A 
Sbjct: 63  DKSKGESHQGVVARAYPAKVLTETDLDTIISQSAKPFLLVLDGVTDPHNLGAVLRSADAA 122

Query: 158 SCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSK 217
             D +I  K  S S +A + K A GA + IP I+++NL   L ++       +G + +++
Sbjct: 123 GVDAVIVPKDKSASLNATVRKVACGAADVIPLIQVTNLARTLSELQEQQIWVVGTAGEAR 182

Query: 218 KPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQ 277
           + +        +AL++GAEGKG+R  T+E    +  L M G + +LNVS A  + LY   
Sbjct: 183 QSVFDCDMAGPVALVMGAEGKGMRRLTRERCDELIKLPMLGTVSSLNVSVATGICLYEIV 242

Query: 278 NHF 280
              
Sbjct: 243 RQR 245


>gi|88858913|ref|ZP_01133554.1| Gm2251 methyltransferase of 23S rRNA [Pseudoalteromonas tunicata
           D2]
 gi|88819139|gb|EAR28953.1| Gm2251 methyltransferase of 23S rRNA [Pseudoalteromonas tunicata
           D2]
          Length = 248

 Score =  135 bits (340), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 70/243 (28%), Positives = 112/243 (46%), Gaps = 10/243 (4%)

Query: 48  NLFLYGVHTVSAALNNPSRKIFQLLATKNA-LARLDWDANLPH--PFPVKTVPPQTIDKI 104
           N  ++G H+V A L     +  ++ A K     RL+    L       V+ +  +T+D+ 
Sbjct: 3   NELIFGFHSVEAILAKEPERFIEIYALKGREDKRLNPILELAEQFGVSVQFMHRKTLDEK 62

Query: 105 VGKEAVHQGLALETAPLLSPTLDA------VRNSQLLMVLDHVNDPHNIGAILRSAVAFS 158
              E  HQGL  +     + +            +  L+VLD V DPHN+GA LRSA A  
Sbjct: 63  ADGE-QHQGLIAKVKAGKTYSEKDLDEIIARHETPFLLVLDGVTDPHNLGACLRSADAAG 121

Query: 159 CDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKK 218
              +I  K  S   + V  K A GA E +P + ++NL   L+++   G   IG + ++  
Sbjct: 122 VHAVIVPKDNSAKLNGVARKVACGAAETVPLVHVTNLARTLREIKDAGVWVIGTAGETDT 181

Query: 219 PLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQN 278
            +        IAL++GAEG G+R  T+E   ++  + M G + +LNVS A  + L+    
Sbjct: 182 HVFDAKLTGPIALVMGAEGTGMRRLTREHCDTLVKIPMVGTVSSLNVSVATGICLFEILR 241

Query: 279 HFA 281
              
Sbjct: 242 QRN 244


>gi|326791660|ref|YP_004309481.1| tRNA/rRNA methyltransferase (SpoU) [Clostridium lentocellum DSM
           5427]
 gi|326542424|gb|ADZ84283.1| tRNA/rRNA methyltransferase (SpoU) [Clostridium lentocellum DSM
           5427]
          Length = 263

 Score =  135 bits (340), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 49/260 (18%), Positives = 92/260 (35%), Gaps = 7/260 (2%)

Query: 24  RRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDW 83
              +   K ++   +K           + G+  V         KI  L+ T     +   
Sbjct: 8   SPQNNVIKNIKELQKKKSARKSEGLFVIEGIRGVKEI--PSHVKIKYLITTSEVDEKELG 65

Query: 84  DANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDHVND 143
                    V     + I   +      QG            +     +   +VL+++ D
Sbjct: 66  AVKAEERLEVS----KEIYNSISDTQSPQGAMAVAYMPTYDLVHFNIEAGHYLVLENLQD 121

Query: 144 PHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQK-M 202
           P N+G I+R+A AF   G+  TK      S  + +S   +L H+P +    +   +    
Sbjct: 122 PGNLGTIIRTAHAFDFKGVFITKGSVDLYSPKVVRSTMSSLFHVPIVIEEEIDTYMDFLK 181

Query: 203 HSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKA 262
                          KP+      +K+A+I+G EG G+  + +E +     + MPG  ++
Sbjct: 182 QKGVTLYTTALIPGAKPIYDVTFEEKVAIIIGNEGNGVSERVKEASDHTVIIPMPGAAES 241

Query: 263 LNVSNAAAVALYITQNHFAK 282
           LN + A ++ +Y       K
Sbjct: 242 LNAAIATSICMYEITRQCQK 261


>gi|187935194|ref|YP_001884456.1| RNA methyltransferase, TrmH family, group 3 [Clostridium botulinum
           B str. Eklund 17B]
 gi|187723347|gb|ACD24568.1| RNA methyltransferase, TrmH family, group 3 [Clostridium botulinum
           B str. Eklund 17B]
          Length = 286

 Score =  135 bits (340), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 71/291 (24%), Positives = 126/291 (43%), Gaps = 21/291 (7%)

Query: 7   KKSEKIFSLKDSHYAKLRRNHRDYKKM---QSFNQKSRHTS--QPENLFLYGVHTVSAAL 61
           +++ K  + +D    K R N++  K+        + + + +  +     + G + V  AL
Sbjct: 2   RENTKAGNKRD----KNRENNKGNKREINKNRVVENNSYDNSFEEREDIIIGRNAVLEAL 57

Query: 62  NNPSRKIFQLLATKNAL---ARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALET 118
               R I  L  + + L                 +K V  + +D +    AVHQG+    
Sbjct: 58  KA-ERTIETLYISNSKLEGSINAIISKAKDKKILIKEVDKRKLDSMC-NNAVHQGVIARV 115

Query: 119 APLLSPTL-------DAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPS 171
            P     +       +    +  +++LD V DPHN+G+I+R+A  F   GII  KR S S
Sbjct: 116 TPYEYSEVSDILELAEKKGENPFIVILDEVEDPHNLGSIIRTAELFGVHGIIIPKRRSAS 175

Query: 172 ESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIAL 231
            + ++ KS+ GA+EH+   R++NL   + ++   G    G    +++   Q       A+
Sbjct: 176 VTTMVYKSSVGAIEHVKVARVTNLNSVIDELKEKGIWVYGTDIRAEEYSYQTDFGGACAI 235

Query: 232 ILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHFAK 282
           I+G EGKG+   T +    +  + M G I +LN S A  + +Y       K
Sbjct: 236 IIGNEGKGISKLTLKKCDKLIKIPMVGKINSLNASVAGGIIMYEVLKGRLK 286


>gi|254804813|ref|YP_003083034.1| putative RNA methyltransferase [Neisseria meningitidis alpha14]
 gi|254668355|emb|CBA05407.1| putative RNA methyltransferase [Neisseria meningitidis alpha14]
          Length = 250

 Score =  135 bits (340), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 68/238 (28%), Positives = 109/238 (45%), Gaps = 9/238 (3%)

Query: 51  LYGVHTVSAALNNPSRKIFQLLATK---NALARLDWDANLPHPFPVKTVPPQTIDKIVGK 107
           +YG H V+A L    + I +L   +   +   R   +        V       ++ I  K
Sbjct: 7   IYGFHAVNARLWQNPKSIVELYVQEGKNDVRTREVLEKAANENIRVYFADADRLNAIS-K 65

Query: 108 EAVHQGLALET-----APLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGI 162
            A HQG+            L   L+ +    LL++LD + DPHN+GA LR+A A     +
Sbjct: 66  GARHQGVVGFIDASKNHVHLEDVLENLSEPPLLLILDGITDPHNLGACLRTADAMGVHAV 125

Query: 163 ITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQ 222
           I  K  S   +A ++K A GA E +PYI ++NL   L+++  +G   IG        L  
Sbjct: 126 IAPKDKSAGLNATVSKVACGAAETVPYITVTNLARTLRELKEYGIWIIGTDMGGDADLYH 185

Query: 223 EIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
               D  A ++G EG G+R  T+E    +  + M G ++++NVS +A + L  T+   
Sbjct: 186 CNLPDSAAWVMGNEGDGMRRLTREHCDMLVSIPMFGTVESMNVSVSAGMVLSETRRQR 243


>gi|225024199|ref|ZP_03713391.1| hypothetical protein EIKCOROL_01071 [Eikenella corrodens ATCC
           23834]
 gi|224943224|gb|EEG24433.1| hypothetical protein EIKCOROL_01071 [Eikenella corrodens ATCC
           23834]
          Length = 248

 Score =  135 bits (340), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 64/239 (26%), Positives = 106/239 (44%), Gaps = 7/239 (2%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLA---TKNALARLDWDANLPHPFPVKTVPPQTIDKIVG 106
            +YG H V+A L    + + +L A     +   +   +       PV  V    +D +  
Sbjct: 6   LIYGFHAVNARLWQNPKSLTELYALSGRHDTRMQQALEKAAQENIPVHFVEAARLDNLCR 65

Query: 107 KEAVH----QGLALETAPLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGI 162
                       A      L   LD +    LL++LD + DPHN+GA LR A A     +
Sbjct: 66  HARHQGIAGFIDASHNHVHLDDVLDNLTEPPLLLILDGITDPHNLGACLRVADAMGVHAV 125

Query: 163 ITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQ 222
           I  K  S   +A ++K A GA E +PYI ++NL   L+++       +G     +  L  
Sbjct: 126 IAPKNRSVGLNATVSKVACGAAETVPYIAVTNLARTLRELKERDIWIVGTDMGGEADLFH 185

Query: 223 EIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHFA 281
                 +A ++G EG+G+R  T+E   ++  + M G +++LNVS +  + L  T+   A
Sbjct: 186 YDIPAAVAWVMGNEGEGMRRLTREHCDALVSIPMLGTVESLNVSVSTGMVLAETRRQRA 244


>gi|187934593|ref|YP_001886663.1| RNA methyltransferase, TrmH family [Clostridium botulinum B str.
           Eklund 17B]
 gi|187722746|gb|ACD23967.1| RNA methyltransferase, TrmH family [Clostridium botulinum B str.
           Eklund 17B]
          Length = 260

 Score =  135 bits (340), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 50/257 (19%), Positives = 100/257 (38%), Gaps = 6/257 (2%)

Query: 24  RRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLD- 82
            + +  YK+ +   ++ ++ ++     + G   V  A+       + +L         + 
Sbjct: 6   SKENTIYKEAKKLKER-KNRNKINKYVIEGFRLVDEAIKASLDIDYLILTQVGYEKLDNY 64

Query: 83  WDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDHVN 142
            + +      V  +       +   E     +A+      +            +  D V 
Sbjct: 65  INKDKIEKQKVYCITDNLFKDLTSTENPQGIIAIVNMENKNLDF----QGDFYLFCDKVQ 120

Query: 143 DPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKM 202
           DP N+G I+R+A A   +GII +K      +    +S  G+L ++P     N    ++ +
Sbjct: 121 DPGNLGTIIRTAHAAGVNGIILSKGTVDIYNEKTIRSTMGSLFYMPIYYDDNEFSLIKSL 180

Query: 203 HSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKA 262
              GF+ I  S +S K   +E    K  L +G EG G+  +  + A     + MPG  ++
Sbjct: 181 KKDGFKLIVTSLESSKDFFKEDLKGKTILTVGNEGNGVSNEVLDLADRRVKIPMPGGAES 240

Query: 263 LNVSNAAAVALYITQNH 279
           LNV+ A ++ +Y     
Sbjct: 241 LNVAIATSIIIYEKIRQ 257


>gi|200386744|ref|ZP_03213356.1| RNA methyltransferase, TrmH family, group 3 [Salmonella enterica
           subsp. enterica serovar Virchow str. SL491]
 gi|199603842|gb|EDZ02387.1| RNA methyltransferase, TrmH family, group 3 [Salmonella enterica
           subsp. enterica serovar Virchow str. SL491]
          Length = 243

 Score =  135 bits (340), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 68/243 (27%), Positives = 110/243 (45%), Gaps = 10/243 (4%)

Query: 48  NLFLYGVHTVSAALNNPSRKIFQLLATKNALARLD---WDANLPHPFPVKTVPPQTIDKI 104
           +  +YG+H V A L     +  ++   K    +       A       ++    Q +D+ 
Sbjct: 2   SEMIYGIHAVQALLERAPERFQEVFILKGREDKRLLPLIHALESQGVVIQLANRQYLDEK 61

Query: 105 VGKEAVHQGLALETAPLLSP------TLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFS 158
               AVHQG+     P           L A+ +   L++LD V DPHN+GA LRSA A  
Sbjct: 62  SD-GAVHQGIIARVKPGRQYQENDLPDLIALHDRPFLLILDGVTDPHNLGACLRSADAAG 120

Query: 159 CDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKK 218
              +I  K  S   +A   K A GA E +P IR++NL   ++ +       +G + ++  
Sbjct: 121 VHAVIVPKDRSAQLNATAKKVACGAAESVPLIRVTNLARTMRMLQEENIWIVGTAGEADH 180

Query: 219 PLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQN 278
            L Q     ++AL++GAEG+G+R  T+E    +  + M G + +LNVS A  + L+    
Sbjct: 181 TLYQSKMPGRMALVMGAEGEGIRRLTREHCDELISIPMAGSVSSLNVSVATGICLFEAVR 240

Query: 279 HFA 281
              
Sbjct: 241 QRT 243


>gi|311281268|ref|YP_003943499.1| RNA methyltransferase, TrmH family, group 3 [Enterobacter cloacae
           SCF1]
 gi|308750463|gb|ADO50215.1| RNA methyltransferase, TrmH family, group 3 [Enterobacter cloacae
           SCF1]
          Length = 243

 Score =  135 bits (340), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 68/242 (28%), Positives = 112/242 (46%), Gaps = 10/242 (4%)

Query: 48  NLFLYGVHTVSAALNNPSRKIFQLLATKNALARLD---WDANLPHPFPVKTVPPQTIDKI 104
           +  +YG+H V A L     +  ++   K    +       A       ++    Q +D+ 
Sbjct: 2   SEMIYGIHAVQALLERAPERFQEVFILKGREDKRLLPLIHALEAQGVVIQVASRQYLDEK 61

Query: 105 VGKEAVHQGLALETAPLLSP------TLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFS 158
             + AVHQG+     P           L A  ++  L++LD V DPHN+GA LRSA A  
Sbjct: 62  S-EGAVHQGIIARVKPGRQYQENDLPDLLAQFDNPFLLILDGVTDPHNLGACLRSADAAG 120

Query: 159 CDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKK 218
              +I  K  S   +A   K A GA E++P IR++NL   ++ +       +G + ++  
Sbjct: 121 VHAVIVPKDRSAQLNATAKKVACGAAENVPLIRVTNLARTMRLLQEENVWIVGTAGEADH 180

Query: 219 PLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQN 278
            L Q     ++AL++GAEG+G+R  T+E    +  + M G + +LNVS A  + L+    
Sbjct: 181 TLYQSKMTGRLALVMGAEGEGMRRLTREHCDELISIPMAGSVSSLNVSVATGICLFEAVR 240

Query: 279 HF 280
             
Sbjct: 241 QR 242


>gi|170767082|ref|ZP_02901535.1| RNA methyltransferase, TrmH family, group 3 [Escherichia albertii
           TW07627]
 gi|170124520|gb|EDS93451.1| RNA methyltransferase, TrmH family, group 3 [Escherichia albertii
           TW07627]
          Length = 243

 Score =  135 bits (340), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 63/242 (26%), Positives = 105/242 (43%), Gaps = 8/242 (3%)

Query: 48  NLFLYGVHTVSAALNNPSRKIFQLLATKNALARLD---WDANLPHPFPVKTVPPQTIDKI 104
           +  +YG+H V A L     +  ++   K    +       A   H   ++    Q +D+ 
Sbjct: 2   SEMIYGIHAVQALLERAPERFQEVFILKGREDKRLLPLIHALESHGVVIQLANRQYLDEK 61

Query: 105 VGKEAVHQGLALETAPLLSPTLDAVR-----NSQLLMVLDHVNDPHNIGAILRSAVAFSC 159
                    +A           D        +   L++LD V DPHN+GA LRSA A   
Sbjct: 62  SDGGVHQGIIARVKPGRQYQENDLPDLIASLDQSFLLILDGVTDPHNLGACLRSADAAGV 121

Query: 160 DGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKP 219
             +I  K  S   +A   K A GA E +P IR++NL   ++ +       +G + ++   
Sbjct: 122 HAVIVPKDRSAQLNATARKVACGAAESVPLIRVTNLARTMRMLQEENIWIVGTAGEADHT 181

Query: 220 LEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNH 279
           L Q     ++AL++GAEG+G+R  T+E    +  + M G + +LNVS A  + L+     
Sbjct: 182 LYQSKMTGRLALVMGAEGEGMRRLTREHCDELISIPMAGSVSSLNVSVATGICLFEAVRQ 241

Query: 280 FA 281
            +
Sbjct: 242 RS 243


>gi|261418277|ref|YP_003251959.1| tRNA/rRNA methyltransferase (SpoU) [Geobacillus sp. Y412MC61]
 gi|319767763|ref|YP_004133264.1| tRNA/rRNA methyltransferase (SpoU) [Geobacillus sp. Y412MC52]
 gi|261374734|gb|ACX77477.1| tRNA/rRNA methyltransferase (SpoU) [Geobacillus sp. Y412MC61]
 gi|317112629|gb|ADU95121.1| tRNA/rRNA methyltransferase (SpoU) [Geobacillus sp. Y412MC52]
          Length = 251

 Score =  135 bits (340), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 57/277 (20%), Positives = 106/277 (38%), Gaps = 29/277 (10%)

Query: 1   MNLISKKKSEKIFSLKDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAA 60
           M  I   K+ ++   K                        +   +     L G H V  A
Sbjct: 1   MKRIESPKNARVKQWKKLLTK-------------------KGRDETGLFLLEGFHLVEEA 41

Query: 61  LNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAP 120
           + + +  + +L+  +       W+       PV  V    +  I   E      A     
Sbjct: 42  IKSNA-PLVELIVDERTAVPPGWNV---TGVPVTIVTEAVMKAISSTETPQGIAA--VCR 95

Query: 121 LLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSA 180
            LS  L+ V+ + L+   D V DP N+G ++R+A A   D +I  +  +   +  + ++ 
Sbjct: 96  QLSTELEGVKTALLI---DAVQDPGNLGTMIRTADAAGIDAVILGEGCADLYNPKVVRAT 152

Query: 181 SGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGL 240
            G+L H+P ++       + +    G    G + ++        ++   AL+ G EG G+
Sbjct: 153 QGSLFHLPVVKGDLA-QWIARFKEQGIPVYGTALENAVDYRTVPQSPSFALLFGNEGSGV 211

Query: 241 RPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQ 277
           RP      T   ++ + G  ++LNV+ AA + LY  Q
Sbjct: 212 RPDLLRLTTENVYIPIYGRAESLNVAVAAGILLYSLQ 248


>gi|125623434|ref|YP_001031917.1| rRNA methyltransferase [Lactococcus lactis subsp. cremoris MG1363]
 gi|124492242|emb|CAL97171.1| rRNA methyltransferase [Lactococcus lactis subsp. cremoris MG1363]
 gi|300070181|gb|ADJ59581.1| rRNA methyltransferase [Lactococcus lactis subsp. cremoris NZ9000]
          Length = 252

 Score =  135 bits (340), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 56/277 (20%), Positives = 104/277 (37%), Gaps = 30/277 (10%)

Query: 1   MNLISKKKSEKIFSLKDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAA 60
           M +IS K ++K+   +     K R+N                     +  + G H +  A
Sbjct: 1   MEIISSKDNKKVKEARKLLTKKYRKN---------------------SYLIEGFHLLEEA 39

Query: 61  LNNPSRKIFQLLATKNALARLDWDANLPH---PFPVKTVPPQTIDKIVGKEAVHQGLALE 117
           L      I Q+   +N LA+L              V  V    +  +   E+    +A  
Sbjct: 40  LKAGH-SIKQIFVEENKLAKLTAMIGSEKSLTDLSVNLVSKDVLKSLADSESPQGLIAEV 98

Query: 118 TAPLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLA 177
                     A +     ++L++V DP N+G ++R+A A     +I     +   S  + 
Sbjct: 99  AIIEEVIDFSASK----FLLLENVQDPGNVGTMIRTADAAGFSAVILLGETADLYSPKVM 154

Query: 178 KSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEG 237
           +S  G+  H+   R++          +         S +    +        AL++G EG
Sbjct: 155 RSMQGSNFHLAIARMNEEECFAALKQAKISILTTTLSANSVSYKTVE-ESSFALVMGNEG 213

Query: 238 KGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
            G+     E+A  + H+ MPG  ++LNV+ AA + ++
Sbjct: 214 AGVSDFAVESADKLVHIDMPGQAESLNVAVAAGILMF 250


>gi|219849653|ref|YP_002464086.1| tRNA/rRNA methyltransferase SpoU [Chloroflexus aggregans DSM 9485]
 gi|219543912|gb|ACL25650.1| tRNA/rRNA methyltransferase (SpoU) [Chloroflexus aggregans DSM
           9485]
          Length = 261

 Score =  135 bits (340), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 48/256 (18%), Positives = 94/256 (36%), Gaps = 8/256 (3%)

Query: 27  HRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKN----ALARLD 82
           +   K +++  Q+ +   +     + G+  V  A+   +  +  ++   +    + A   
Sbjct: 8   NPTIKMLRALRQR-KARDEQGRYLIEGIRLVGEAIQCGA-PLEMIIVAPDLLTSSFAHEL 65

Query: 83  WDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDHVN 142
            +  +     V TV  + +  +  KE    G+        +P  D V      + L  V 
Sbjct: 66  VEHYIAGGGRVLTVSAEVLGSLASKEHPQ-GIIGVGRARYTPLADLVAGVNGWVALVDVA 124

Query: 143 DPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKM 202
           DP N+G ILR+A      G+I              +++ GAL     I  +   + L   
Sbjct: 125 DPGNLGTILRTADGAGFSGVILIGSTVDPFDPAAVRASMGALF-SQQIARAGWDELLAWR 183

Query: 203 HSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKA 262
            +     IG S               + L+LG+E +GL  +      ++  + M G   +
Sbjct: 184 QARSLPVIGSSDRGTVDYRTATYPRPLILVLGSERQGLSDEQLAACDTVVRIPMRGRSDS 243

Query: 263 LNVSNAAAVALYITQN 278
           LN++ AA + +Y    
Sbjct: 244 LNLAVAAGILMYEITR 259


>gi|324112223|gb|EGC06201.1| RNA methyltransferase [Escherichia fergusonii B253]
 gi|325499715|gb|EGC97574.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Escherichia
           fergusonii ECD227]
          Length = 243

 Score =  135 bits (340), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 62/242 (25%), Positives = 104/242 (42%), Gaps = 8/242 (3%)

Query: 48  NLFLYGVHTVSAALNNPSRKIFQLLATKNALARLD---WDANLPHPFPVKTVPPQTIDKI 104
           +  +YG+H V A L     +  ++   K    +       A       ++    Q +D+ 
Sbjct: 2   SEMIYGIHAVQALLERAPERFQEVFILKGREDKRLLPLIHALESQGVVIQLANRQYLDEK 61

Query: 105 VGKEAVHQGLALETAPLLSPTLDAVR-----NSQLLMVLDHVNDPHNIGAILRSAVAFSC 159
                    +A           D        +   L++LD V DPHN+GA LRSA A   
Sbjct: 62  SDGAVHQGIIARVKPGRQYQENDLPDLLASLDQPFLLILDGVTDPHNLGACLRSADAAGV 121

Query: 160 DGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKP 219
             +I  K  S   +A   K A GA E +P IR++NL   ++ +       +G + ++   
Sbjct: 122 HAVIVPKDRSAQLNATAKKVACGAAESVPLIRVTNLARTMRMLQEENIWIVGTAGEADHT 181

Query: 220 LEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNH 279
           L Q     ++AL++GAEG+G+R  T+E    +  + M G + +LNVS A  + L+     
Sbjct: 182 LYQSKMTGRLALVMGAEGEGMRRLTREHCDELISIPMAGSVSSLNVSVATGICLFEAVRQ 241

Query: 280 FA 281
            +
Sbjct: 242 RS 243


>gi|302386867|ref|YP_003822689.1| tRNA/rRNA methyltransferase (SpoU) [Clostridium saccharolyticum
           WM1]
 gi|302197495|gb|ADL05066.1| tRNA/rRNA methyltransferase (SpoU) [Clostridium saccharolyticum
           WM1]
          Length = 259

 Score =  135 bits (340), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 47/258 (18%), Positives = 107/258 (41%), Gaps = 5/258 (1%)

Query: 24  RRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDW 83
              +   K++ + ++K +           G+         P+ +I  L  +++ + + + 
Sbjct: 4   SSANARVKQVMNLSKKVKARKTSGLFVTEGLRMFKEI---PADRIDSLFVSEDFI-KDEA 59

Query: 84  DANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAP-LLSPTLDAVRNSQLLMVLDHVN 142
              L      +TV  +    +   +     LAL       +  L A      LMVL+++ 
Sbjct: 60  HKRLLAGMKYETVSREVFKVMSDTQTPQGILALVRQHAFRTEDLLAAPGPAFLMVLENIQ 119

Query: 143 DPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKM 202
           DP N+G ILR+       G++ ++  +   +  + +S  G++  +P++   +L  +L+ +
Sbjct: 120 DPGNLGTILRAGEGAGITGVLMSETTADIYNPKVIRSTMGSVFRVPFVYTEDLPASLKAL 179

Query: 203 HSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKA 262
            + G +      + +   E+E        ++G E  GL  +T   A +   + M G +++
Sbjct: 180 KAGGVRLYAAHLNGRNNYEKEDYTVDTGFLVGNEANGLTDETAALADACVKIPMKGKVES 239

Query: 263 LNVSNAAAVALYITQNHF 280
           LN + AA+V ++      
Sbjct: 240 LNAAVAASVLMFEAARQR 257


>gi|183985047|ref|YP_001853338.1| tRNA/rRNA methyltransferase [Mycobacterium marinum M]
 gi|254806447|sp|B2HJ20|Y5079_MYCMM RecName: Full=Uncharacterized tRNA/rRNA methyltransferase MMAR_5079
 gi|183178373|gb|ACC43483.1| tRNA/rRNA methyltransferase [Mycobacterium marinum M]
          Length = 310

 Score =  135 bits (340), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 73/269 (27%), Positives = 123/269 (45%), Gaps = 10/269 (3%)

Query: 21  AKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNP-SRKIFQLLATKNALA 79
           A +R NH   K+ ++  ++       E   + G + V   L          +     A  
Sbjct: 41  AHMRPNHPAAKRAKAQQRRPARGRTDETETVLGRNPVLECLRAGVPSTALYVALGVEADE 100

Query: 80  RLDWDANLPH--PFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDA------VRN 131
           RL    +       P+  VP   +D++     +HQG+AL+  P      D          
Sbjct: 101 RLTESVSRAADSGIPILEVPRTDLDRMTANH-LHQGIALQVPPYNYAHPDDLLAAALDTP 159

Query: 132 SQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIR 191
             LL+ LD+++DP N+GAI+RS  AF   G++  +R S S +AV  ++++GA   +P  R
Sbjct: 160 PALLVALDNISDPRNLGAIVRSVAAFGGHGVLIPQRRSASVTAVAWRTSAGAAARMPVAR 219

Query: 192 ISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSM 251
            +NLT AL+     G + +GL +     ++    +D I +++G+EGKGL    ++T   +
Sbjct: 220 ATNLTRALKDWADRGVRVVGLDAGGDTAIDDLDGSDPIVVVVGSEGKGLSRLVRQTCDEV 279

Query: 252 AHLHMPGIIKALNVSNAAAVALYITQNHF 280
             + M G  ++LN S AA V L       
Sbjct: 280 VSVPMAGPTESLNASVAAGVVLAEIARQR 308


>gi|118619334|ref|YP_907666.1| tRNA/rRNA methyltransferase [Mycobacterium ulcerans Agy99]
 gi|254803872|sp|A0PV26|Y4155_MYCUA RecName: Full=Uncharacterized tRNA/rRNA methyltransferase MUL_4155
 gi|118571444|gb|ABL06195.1| tRNA/rRNA methyltransferase [Mycobacterium ulcerans Agy99]
          Length = 310

 Score =  135 bits (340), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 73/269 (27%), Positives = 123/269 (45%), Gaps = 10/269 (3%)

Query: 21  AKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNP-SRKIFQLLATKNALA 79
           A +R NH   K+ ++  ++       E   + G + V   L          +     A  
Sbjct: 41  AHMRPNHPAAKRAKAQQRRPARGRTDETETVLGRNPVLECLRAGVPSTALYVALGVEADE 100

Query: 80  RLDWDANLPH--PFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDA------VRN 131
           RL    +       P+  VP   +D++     +HQG+AL+  P      D          
Sbjct: 101 RLTESVSRAADSGIPILEVPRTDLDRMTANH-LHQGIALQVPPYNYAHPDDLLAAALDTP 159

Query: 132 SQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIR 191
             LL+ LD+++DP N+GAI+RS  AF   G++  +R S S +AV  ++++GA   +P  R
Sbjct: 160 PALLVALDNISDPRNLGAIVRSVAAFGGHGVLIPQRRSASVTAVAWRTSAGAAARMPVAR 219

Query: 192 ISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSM 251
            +NLT AL+     G + +GL +     ++    +D I +++G+EGKGL    ++T   +
Sbjct: 220 ATNLTRALKDWADRGVRVVGLDAGGDTAIDDLDGSDPIVVVVGSEGKGLSRLVRQTCDEV 279

Query: 252 AHLHMPGIIKALNVSNAAAVALYITQNHF 280
             + M G  ++LN S AA V L       
Sbjct: 280 VSVPMAGPTESLNASVAAGVVLAEIARQR 308


>gi|15804769|ref|NP_290810.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Escherichia coli
           O157:H7 EDL933]
 gi|15834410|ref|NP_313183.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Escherichia coli
           O157:H7 str. Sakai]
 gi|16132002|ref|NP_418601.1| 23S rRNA (Gm2251)-methyltransferase [Escherichia coli str. K-12
           substr. MG1655]
 gi|24115535|ref|NP_710045.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Shigella flexneri 2a
           str. 301]
 gi|26251072|ref|NP_757112.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Escherichia coli
           CFT073]
 gi|30065552|ref|NP_839723.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Shigella flexneri 2a
           str. 2457T]
 gi|74314665|ref|YP_313084.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Shigella sonnei
           Ss046]
 gi|89110900|ref|AP_004680.1| 23S rRNA (Gm2251)-methyltransferase [Escherichia coli str. K-12
           substr. W3110]
 gi|91213729|ref|YP_543715.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Escherichia coli
           UTI89]
 gi|110644537|ref|YP_672267.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Escherichia coli 536]
 gi|110808098|ref|YP_691618.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Shigella flexneri 5
           str. 8401]
 gi|117626526|ref|YP_859849.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Escherichia coli APEC
           O1]
 gi|157158474|ref|YP_001465680.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Escherichia coli
           E24377A]
 gi|157163645|ref|YP_001460963.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Escherichia coli HS]
 gi|168751468|ref|ZP_02776490.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli
           O157:H7 str. EC4113]
 gi|168754751|ref|ZP_02779758.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli
           O157:H7 str. EC4401]
 gi|168760422|ref|ZP_02785429.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli
           O157:H7 str. EC4501]
 gi|168766459|ref|ZP_02791466.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli
           O157:H7 str. EC4486]
 gi|168774107|ref|ZP_02799114.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli
           O157:H7 str. EC4196]
 gi|168780612|ref|ZP_02805619.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli
           O157:H7 str. EC4076]
 gi|168784817|ref|ZP_02809824.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli
           O157:H7 str. EC869]
 gi|168801835|ref|ZP_02826842.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli
           O157:H7 str. EC508]
 gi|170021810|ref|YP_001726764.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Escherichia coli ATCC
           8739]
 gi|170083626|ref|YP_001732946.1| 23S rRNA (Gm2251)-methyltransferase [Escherichia coli str. K-12
           substr. DH10B]
 gi|170679577|ref|YP_001746575.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Escherichia coli
           SMS-3-5]
 gi|188494408|ref|ZP_03001678.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli
           53638]
 gi|191165658|ref|ZP_03027498.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli B7A]
 gi|191170707|ref|ZP_03032259.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli F11]
 gi|191174517|ref|ZP_03036015.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli F11]
 gi|193066002|ref|ZP_03047060.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli E22]
 gi|193070849|ref|ZP_03051781.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli
           E110019]
 gi|194426679|ref|ZP_03059233.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli B171]
 gi|194434585|ref|ZP_03066842.1| RNA methyltransferase, TrmH family, group 3 [Shigella dysenteriae
           1012]
 gi|194439536|ref|ZP_03071610.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli
           101-1]
 gi|195935970|ref|ZP_03081352.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Escherichia coli
           O157:H7 str. EC4024]
 gi|208806918|ref|ZP_03249255.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli
           O157:H7 str. EC4206]
 gi|208813496|ref|ZP_03254825.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli
           O157:H7 str. EC4045]
 gi|208818601|ref|ZP_03258921.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli
           O157:H7 str. EC4042]
 gi|209399233|ref|YP_002273722.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli
           O157:H7 str. EC4115]
 gi|215489524|ref|YP_002331955.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Escherichia coli
           O127:H6 str. E2348/69]
 gi|217326510|ref|ZP_03442594.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli
           O157:H7 str. TW14588]
 gi|218551450|ref|YP_002385242.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Escherichia
           fergusonii ATCC 35469]
 gi|218556732|ref|YP_002389646.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Escherichia coli
           IAI1]
 gi|218561339|ref|YP_002394252.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Escherichia coli S88]
 gi|218692514|ref|YP_002400726.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Escherichia coli
           ED1a]
 gi|218697929|ref|YP_002405596.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Escherichia coli
           55989]
 gi|218702877|ref|YP_002410506.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Escherichia coli
           IAI39]
 gi|218707791|ref|YP_002415310.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Escherichia coli
           UMN026]
 gi|227886777|ref|ZP_04004582.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Escherichia coli
           83972]
 gi|237703847|ref|ZP_04534328.1| RNA methyltransferase [Escherichia sp. 3_2_53FAA]
 gi|238903287|ref|YP_002929083.1| 23S rRNA (Gm2251)-methyltransferase [Escherichia coli BW2952]
 gi|253775195|ref|YP_003038026.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|254037194|ref|ZP_04871271.1| 23S rRNA-methyltransferase [Escherichia sp. 1_1_43]
 gi|254164109|ref|YP_003047217.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Escherichia coli B
           str. REL606]
 gi|254796199|ref|YP_003081036.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Escherichia coli
           O157:H7 str. TW14359]
 gi|256019825|ref|ZP_05433690.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Shigella sp. D9]
 gi|256025115|ref|ZP_05438980.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Escherichia sp.
           4_1_40B]
 gi|260847010|ref|YP_003224788.1| 23S rRNA (Gm2251)-methyltransferase [Escherichia coli O103:H2 str.
           12009]
 gi|260858333|ref|YP_003232224.1| 23S rRNA (Gm2251)-methyltransferase [Escherichia coli O26:H11 str.
           11368]
 gi|261225300|ref|ZP_05939581.1| 23S rRNA (Gm2251)-methyltransferase [Escherichia coli O157:H7 str.
           FRIK2000]
 gi|261255448|ref|ZP_05947981.1| 23S rRNA (Gm2251)-methyltransferase [Escherichia coli O157:H7 str.
           FRIK966]
 gi|291285592|ref|YP_003502410.1| 23S rRNA (guanosine-2'-O-)-methyltransferase rlmB [Escherichia coli
           O55:H7 str. CB9615]
 gi|293402807|ref|ZP_06646904.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Escherichia coli
           FVEC1412]
 gi|293407907|ref|ZP_06651747.1| RNA methyltransferase [Escherichia coli B354]
 gi|293476491|ref|ZP_06664899.1| RNA methyltransferase [Escherichia coli B088]
 gi|298378337|ref|ZP_06988221.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Escherichia coli
           FVEC1302]
 gi|300816519|ref|ZP_07096740.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli MS
           107-1]
 gi|300821273|ref|ZP_07101421.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli MS
           119-7]
 gi|300899718|ref|ZP_07117944.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli MS
           198-1]
 gi|300906010|ref|ZP_07123734.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli MS
           84-1]
 gi|300920795|ref|ZP_07137196.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli MS
           115-1]
 gi|300922413|ref|ZP_07138533.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli MS
           182-1]
 gi|300929288|ref|ZP_07144764.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli MS
           187-1]
 gi|300940667|ref|ZP_07155228.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli MS
           21-1]
 gi|300949140|ref|ZP_07163182.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli MS
           116-1]
 gi|300955237|ref|ZP_07167630.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli MS
           175-1]
 gi|300987255|ref|ZP_07178084.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli MS
           45-1]
 gi|300988642|ref|ZP_07178782.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli MS
           200-1]
 gi|301023421|ref|ZP_07187204.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli MS
           69-1]
 gi|301028002|ref|ZP_07191286.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli MS
           196-1]
 gi|301045987|ref|ZP_07193170.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli MS
           185-1]
 gi|301302597|ref|ZP_07208727.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli MS
           124-1]
 gi|301325944|ref|ZP_07219365.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli MS
           78-1]
 gi|301646627|ref|ZP_07246493.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli MS
           146-1]
 gi|306815605|ref|ZP_07449754.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Escherichia coli
           NC101]
 gi|307140874|ref|ZP_07500230.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Escherichia coli
           H736]
 gi|307314872|ref|ZP_07594464.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli W]
 gi|309796991|ref|ZP_07691391.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli MS
           145-7]
 gi|312965854|ref|ZP_07780080.1| RNA 2'-O ribose methyltransferase substrate binding family protein
           [Escherichia coli 2362-75]
 gi|312974012|ref|ZP_07788183.1| RNA 2'-O ribose methyltransferase substrate binding family protein
           [Escherichia coli 1827-70]
 gi|331644927|ref|ZP_08346044.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli H736]
 gi|331656008|ref|ZP_08356996.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli M718]
 gi|331660755|ref|ZP_08361687.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli
           TA206]
 gi|331665844|ref|ZP_08366738.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli
           TA143]
 gi|331671085|ref|ZP_08371918.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli
           TA271]
 gi|331671329|ref|ZP_08372127.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli
           TA280]
 gi|331680310|ref|ZP_08380969.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli H591]
 gi|331681199|ref|ZP_08381836.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli H299]
 gi|332280964|ref|ZP_08393377.1| 23S rRNA ()-methyltransferase [Shigella sp. D9]
 gi|52783780|sp|P63177|RLMB_ECOLI RecName: Full=23S rRNA (guanosine-2'-O-)-methyltransferase RlmB;
           AltName: Full=23S rRNA Gm2251 2'-O-methyltransferase
 gi|52783781|sp|P63179|RLMB_ECO57 RecName: Full=23S rRNA (guanosine-2'-O-)-methyltransferase RlmB;
           AltName: Full=23S rRNA Gm2251 2'-O-methyltransferase
 gi|52783782|sp|P63180|RLMB_SHIFL RecName: Full=23S rRNA (guanosine-2'-O-)-methyltransferase RlmB;
           AltName: Full=23S rRNA Gm2251 2'-O-methyltransferase
 gi|54039247|sp|P63178|RLMB_ECOL6 RecName: Full=23S rRNA (guanosine-2'-O-)-methyltransferase RlmB;
           AltName: Full=23S rRNA Gm2251 2'-O-methyltransferase
 gi|12519168|gb|AAG59376.1|AE005651_5 orf, hypothetical protein [Escherichia coli O157:H7 str. EDL933]
 gi|26111504|gb|AAN83686.1|AE016771_197 Hypothetical tRNA/rRNA methyltransferase yjfH [Escherichia coli
           CFT073]
 gi|537021|gb|AAA97076.1| ORF_o243 [Escherichia coli str. K-12 substr. MG1655]
 gi|1790623|gb|AAC77137.1| 23S rRNA (Gm2251)-methyltransferase [Escherichia coli str. K-12
           substr. MG1655]
 gi|13364633|dbj|BAB38579.1| hypothetical protein [Escherichia coli O157:H7 str. Sakai]
 gi|24054863|gb|AAN45752.1| orf, conserved hypothetical protein [Shigella flexneri 2a str. 301]
 gi|30043816|gb|AAP19535.1| hypothetical protein S4603 [Shigella flexneri 2a str. 2457T]
 gi|73858142|gb|AAZ90849.1| conserved hypothetical protein [Shigella sonnei Ss046]
 gi|85676931|dbj|BAE78181.1| 23S rRNA (Gm2251)-methyltransferase [Escherichia coli str. K12
           substr. W3110]
 gi|91075303|gb|ABE10184.1| hypothetical tRNA/rRNA methyltransferase YjfH [Escherichia coli
           UTI89]
 gi|110346129|gb|ABG72366.1| hypothetical tRNA/rRNA methyltransferase YjfH [Escherichia coli
           536]
 gi|110617646|gb|ABF06313.1| conserved hypothetical protein [Shigella flexneri 5 str. 8401]
 gi|115515650|gb|ABJ03725.1| conserved hypothetical protein [Escherichia coli APEC O1]
 gi|157069325|gb|ABV08580.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli HS]
 gi|157080504|gb|ABV20212.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli
           E24377A]
 gi|169756738|gb|ACA79437.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli ATCC
           8739]
 gi|169891461|gb|ACB05168.1| 23S rRNA (Gm2251)-methyltransferase [Escherichia coli str. K-12
           substr. DH10B]
 gi|170517295|gb|ACB15473.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli
           SMS-3-5]
 gi|187770173|gb|EDU34017.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli
           O157:H7 str. EC4196]
 gi|188014500|gb|EDU52622.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli
           O157:H7 str. EC4113]
 gi|188489607|gb|EDU64710.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli
           53638]
 gi|189001755|gb|EDU70741.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli
           O157:H7 str. EC4076]
 gi|189357886|gb|EDU76305.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli
           O157:H7 str. EC4401]
 gi|189364243|gb|EDU82662.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli
           O157:H7 str. EC4486]
 gi|189368907|gb|EDU87323.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli
           O157:H7 str. EC4501]
 gi|189374953|gb|EDU93369.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli
           O157:H7 str. EC869]
 gi|189376090|gb|EDU94506.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli
           O157:H7 str. EC508]
 gi|190904353|gb|EDV64062.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli B7A]
 gi|190905197|gb|EDV64838.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli F11]
 gi|190908931|gb|EDV68518.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli F11]
 gi|192926325|gb|EDV80961.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli E22]
 gi|192955795|gb|EDV86266.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli
           E110019]
 gi|194415418|gb|EDX31686.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli B171]
 gi|194417170|gb|EDX33282.1| RNA methyltransferase, TrmH family, group 3 [Shigella dysenteriae
           1012]
 gi|194421535|gb|EDX37548.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli
           101-1]
 gi|208726719|gb|EDZ76320.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli
           O157:H7 str. EC4206]
 gi|208734773|gb|EDZ83460.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli
           O157:H7 str. EC4045]
 gi|208738724|gb|EDZ86406.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli
           O157:H7 str. EC4042]
 gi|209160633|gb|ACI38066.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli
           O157:H7 str. EC4115]
 gi|209750198|gb|ACI73406.1| hypothetical protein ECs5156 [Escherichia coli]
 gi|209750200|gb|ACI73407.1| hypothetical protein ECs5156 [Escherichia coli]
 gi|209750202|gb|ACI73408.1| hypothetical protein ECs5156 [Escherichia coli]
 gi|209750204|gb|ACI73409.1| hypothetical protein ECs5156 [Escherichia coli]
 gi|209750206|gb|ACI73410.1| hypothetical protein ECs5156 [Escherichia coli]
 gi|215267596|emb|CAS12051.1| 23S rRNA (Gm2251)-methyltransferase [Escherichia coli O127:H6 str.
           E2348/69]
 gi|217322731|gb|EEC31155.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli
           O157:H7 str. TW14588]
 gi|218354661|emb|CAV01659.1| 23S rRNA (Gm2251)-methyltransferase [Escherichia coli 55989]
 gi|218358992|emb|CAQ91652.1| 23S rRNA (Gm2251)-methyltransferase [Escherichia fergusonii ATCC
           35469]
 gi|218363501|emb|CAR01155.1| 23S rRNA (Gm2251)-methyltransferase [Escherichia coli IAI1]
 gi|218368108|emb|CAR05915.1| 23S rRNA (Gm2251)-methyltransferase [Escherichia coli S88]
 gi|218372863|emb|CAR20743.1| 23S rRNA (Gm2251)-methyltransferase [Escherichia coli IAI39]
 gi|218430078|emb|CAR10923.1| 23S rRNA (Gm2251)-methyltransferase [Escherichia coli ED1a]
 gi|218434888|emb|CAR15826.1| 23S rRNA (Gm2251)-methyltransferase [Escherichia coli UMN026]
 gi|222035950|emb|CAP78695.1| 23S rRNA [Escherichia coli LF82]
 gi|226840300|gb|EEH72302.1| 23S rRNA-methyltransferase [Escherichia sp. 1_1_43]
 gi|226901759|gb|EEH88018.1| RNA methyltransferase [Escherichia sp. 3_2_53FAA]
 gi|227836350|gb|EEJ46816.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Escherichia coli
           83972]
 gi|238859752|gb|ACR61750.1| 23S rRNA (Gm2251)-methyltransferase [Escherichia coli BW2952]
 gi|242379702|emb|CAQ34526.1| 23S rRNA 2'-O-ribose G2251 methyltransferase monomer, subunit of
           23S rRNA 2'-O-ribose G2251 methyltransferase
           [Escherichia coli BL21(DE3)]
 gi|253326239|gb|ACT30841.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|253976010|gb|ACT41681.1| 23S rRNA (Gm2251)-methyltransferase [Escherichia coli B str.
           REL606]
 gi|253980166|gb|ACT45836.1| 23S rRNA (Gm2251)-methyltransferase [Escherichia coli BL21(DE3)]
 gi|254595599|gb|ACT74960.1| 23S rRNA (Gm2251)-methyltransferase [Escherichia coli O157:H7 str.
           TW14359]
 gi|257756982|dbj|BAI28484.1| 23S rRNA (Gm2251)-methyltransferase [Escherichia coli O26:H11 str.
           11368]
 gi|257762157|dbj|BAI33654.1| 23S rRNA (Gm2251)-methyltransferase [Escherichia coli O103:H2 str.
           12009]
 gi|260450993|gb|ACX41415.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli DH1]
 gi|281181276|dbj|BAI57606.1| putative RNA methyltransferase [Escherichia coli SE15]
 gi|281603642|gb|ADA76626.1| 23S rRNA (guanosine-2'-O-)-methyltransferase rlmB [Shigella
           flexneri 2002017]
 gi|284924362|emb|CBG37478.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Escherichia coli 042]
 gi|290765465|gb|ADD59426.1| 23S rRNA (guanosine-2'-O-)-methyltransferase rlmB [Escherichia coli
           O55:H7 str. CB9615]
 gi|291320944|gb|EFE60386.1| RNA methyltransferase [Escherichia coli B088]
 gi|291429722|gb|EFF02736.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Escherichia coli
           FVEC1412]
 gi|291472158|gb|EFF14640.1| RNA methyltransferase [Escherichia coli B354]
 gi|294489951|gb|ADE88707.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli
           IHE3034]
 gi|298280671|gb|EFI22172.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Escherichia coli
           FVEC1302]
 gi|299878912|gb|EFI87123.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli MS
           196-1]
 gi|300302030|gb|EFJ58415.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli MS
           185-1]
 gi|300305875|gb|EFJ60395.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli MS
           200-1]
 gi|300317814|gb|EFJ67598.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli MS
           175-1]
 gi|300356729|gb|EFJ72599.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli MS
           198-1]
 gi|300397008|gb|EFJ80546.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli MS
           69-1]
 gi|300402177|gb|EFJ85715.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli MS
           84-1]
 gi|300407732|gb|EFJ91270.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli MS
           45-1]
 gi|300412218|gb|EFJ95528.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli MS
           115-1]
 gi|300421232|gb|EFK04543.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli MS
           182-1]
 gi|300451388|gb|EFK15008.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli MS
           116-1]
 gi|300454555|gb|EFK18048.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli MS
           21-1]
 gi|300462781|gb|EFK26274.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli MS
           187-1]
 gi|300526162|gb|EFK47231.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli MS
           119-7]
 gi|300530749|gb|EFK51811.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli MS
           107-1]
 gi|300842122|gb|EFK69882.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli MS
           124-1]
 gi|300847297|gb|EFK75057.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli MS
           78-1]
 gi|301075174|gb|EFK89980.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli MS
           146-1]
 gi|305851267|gb|EFM51722.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Escherichia coli
           NC101]
 gi|306905675|gb|EFN36204.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli W]
 gi|307556347|gb|ADN49122.1| 23S rRNA (Gm2251)-methyltransferase [Escherichia coli ABU 83972]
 gi|307629252|gb|ADN73556.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Escherichia coli
           UM146]
 gi|308119404|gb|EFO56666.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli MS
           145-7]
 gi|310331546|gb|EFP98802.1| RNA 2'-O ribose methyltransferase substrate binding family protein
           [Escherichia coli 1827-70]
 gi|312289097|gb|EFR16991.1| RNA 2'-O ribose methyltransferase substrate binding family protein
           [Escherichia coli 2362-75]
 gi|312948829|gb|ADR29656.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Escherichia coli
           O83:H1 str. NRG 857C]
 gi|313646345|gb|EFS10807.1| RNA 2'-O ribose methyltransferase substrate binding family protein
           [Shigella flexneri 2a str. 2457T]
 gi|315063494|gb|ADT77821.1| 23S rRNA (Gm2251)-methyltransferase [Escherichia coli W]
 gi|315138734|dbj|BAJ45893.1| 23S rRNA (guanosine-2'-O-)-methyltransferase RlmB [Escherichia coli
           DH1]
 gi|315255525|gb|EFU35493.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli MS
           85-1]
 gi|315288461|gb|EFU47859.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli MS
           110-3]
 gi|315293538|gb|EFU52890.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli MS
           153-1]
 gi|315299061|gb|EFU58315.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli MS
           16-3]
 gi|320180693|gb|EFW55620.1| 23S rRNA guanosine-2'-O--methyltransferase [Shigella boydii ATCC
           9905]
 gi|320193560|gb|EFW68197.1| 23S rRNA guanosine-2'-O--methyltransferase [Escherichia coli
           WV_060327]
 gi|320200690|gb|EFW75276.1| 23S rRNA guanosine-2'-O--methyltransferase [Escherichia coli
           EC4100B]
 gi|320644307|gb|EFX13372.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Escherichia coli
           O157:H- str. 493-89]
 gi|320649625|gb|EFX18149.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Escherichia coli
           O157:H- str. H 2687]
 gi|320655021|gb|EFX22982.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Escherichia coli
           O55:H7 str. 3256-97 TW 07815]
 gi|320660528|gb|EFX27989.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Escherichia coli
           O55:H7 str. USDA 5905]
 gi|320665797|gb|EFX32834.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Escherichia coli
           O157:H7 str. LSU-61]
 gi|323156003|gb|EFZ42165.1| RNA 2'-O ribose methyltransferase substrate binding family protein
           [Escherichia coli EPECa14]
 gi|323161969|gb|EFZ47841.1| RNA 2'-O ribose methyltransferase substrate binding family protein
           [Escherichia coli E128010]
 gi|323166663|gb|EFZ52421.1| RNA 2'-O ribose methyltransferase substrate binding family protein
           [Shigella sonnei 53G]
 gi|323189941|gb|EFZ75219.1| RNA 2'-O ribose methyltransferase substrate binding family protein
           [Escherichia coli RN587/1]
 gi|323380427|gb|ADX52695.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli KO11]
 gi|323935410|gb|EGB31754.1| RNA methyltransferase [Escherichia coli E1520]
 gi|323940099|gb|EGB36293.1| RNA methyltransferase [Escherichia coli E482]
 gi|323946028|gb|EGB42065.1| RNA methyltransferase [Escherichia coli H120]
 gi|323950751|gb|EGB46629.1| RNA methyltransferase [Escherichia coli H252]
 gi|323955467|gb|EGB51231.1| RNA methyltransferase [Escherichia coli H263]
 gi|323960329|gb|EGB55969.1| RNA methyltransferase [Escherichia coli H489]
 gi|323965566|gb|EGB61020.1| RNA methyltransferase [Escherichia coli M863]
 gi|323970565|gb|EGB65824.1| RNA methyltransferase [Escherichia coli TA007]
 gi|324005243|gb|EGB74462.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli MS
           57-2]
 gi|324013823|gb|EGB83042.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli MS
           60-1]
 gi|324019358|gb|EGB88577.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli MS
           117-3]
 gi|324118745|gb|EGC12637.1| RNA methyltransferase [Escherichia coli E1167]
 gi|326346655|gb|EGD70389.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli
           O157:H7 str. 1044]
 gi|327250120|gb|EGE61839.1| RNA 2'-O ribose methyltransferase substrate binding family protein
           [Escherichia coli STEC_7v]
 gi|331035902|gb|EGI08140.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli H736]
 gi|331046362|gb|EGI18452.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli M718]
 gi|331051797|gb|EGI23836.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli
           TA206]
 gi|331056895|gb|EGI28889.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli
           TA143]
 gi|331061674|gb|EGI33600.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli
           TA271]
 gi|331071174|gb|EGI42531.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli
           TA280]
 gi|331071773|gb|EGI43109.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli H591]
 gi|331081420|gb|EGI52581.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli H299]
 gi|332083177|gb|EGI88408.1| RNA 2'-O ribose methyltransferase substrate binding family protein
           [Shigella boydii 5216-82]
 gi|332103316|gb|EGJ06662.1| 23S rRNA ()-methyltransferase [Shigella sp. D9]
 gi|332346257|gb|AEE59591.1| conserved hypothetical protein [Escherichia coli UMNK88]
 gi|332749056|gb|EGJ79479.1| RNA 2'-O ribose methyltransferase substrate binding family protein
           [Shigella flexneri K-671]
 gi|332749325|gb|EGJ79746.1| RNA 2'-O ribose methyltransferase substrate binding family protein
           [Shigella flexneri 4343-70]
 gi|332763228|gb|EGJ93471.1| 23S rRNA 2'-O-ribose methyltransferase [Shigella flexneri 2930-71]
 gi|333010329|gb|EGK29762.1| RNA 2'-O ribose methyltransferase substrate binding family protein
           [Shigella flexneri VA-6]
 gi|333011163|gb|EGK30577.1| RNA 2'-O ribose methyltransferase substrate binding family protein
           [Shigella flexneri K-272]
          Length = 243

 Score =  135 bits (340), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 62/242 (25%), Positives = 104/242 (42%), Gaps = 8/242 (3%)

Query: 48  NLFLYGVHTVSAALNNPSRKIFQLLATKNALARLD---WDANLPHPFPVKTVPPQTIDKI 104
           +  +YG+H V A L     +  ++   K    +       A       ++    Q +D+ 
Sbjct: 2   SEMIYGIHAVQALLERAPERFQEVFILKGREDKRLLPLIHALESQGVVIQLANRQYLDEK 61

Query: 105 VGKEAVHQGLALETAPLLSPTLDAVR-----NSQLLMVLDHVNDPHNIGAILRSAVAFSC 159
                    +A           D        +   L++LD V DPHN+GA LRSA A   
Sbjct: 62  SDGAVHQGIIARVKPGRQYQENDLPDLIASLDQPFLLILDGVTDPHNLGACLRSADAAGV 121

Query: 160 DGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKP 219
             +I  K  S   +A   K A GA E +P IR++NL   ++ +       +G + ++   
Sbjct: 122 HAVIVPKDRSAQLNATAKKVACGAAESVPLIRVTNLARTMRMLQEENIWIVGTAGEADHT 181

Query: 220 LEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNH 279
           L Q     ++AL++GAEG+G+R  T+E    +  + M G + +LNVS A  + L+     
Sbjct: 182 LYQSKMTGRLALVMGAEGEGMRRLTREHCDELISIPMAGSVSSLNVSVATGICLFEAVRQ 241

Query: 280 FA 281
            +
Sbjct: 242 RS 243


>gi|323975479|gb|EGB70580.1| RNA methyltransferase [Escherichia coli TW10509]
          Length = 243

 Score =  135 bits (340), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 62/242 (25%), Positives = 103/242 (42%), Gaps = 8/242 (3%)

Query: 48  NLFLYGVHTVSAALNNPSRKIFQLLATKNALARLD---WDANLPHPFPVKTVPPQTIDKI 104
           +  +YG+H V A L     +  ++   K    +       A       ++    Q +D+ 
Sbjct: 2   SEMIYGIHAVQALLERAPERFQEVFILKGREDKRLLPLIHALESQGVVIQLANRQYLDEK 61

Query: 105 VGKEAVHQGLALETAPLLSPTLDAVR-----NSQLLMVLDHVNDPHNIGAILRSAVAFSC 159
                    +A           D            L++LD V DPHN+GA LRSA A   
Sbjct: 62  SDGAVHQGIIARVKPGRQYQENDLPDLIASLEQPFLLILDGVTDPHNLGACLRSADAAGV 121

Query: 160 DGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKP 219
             +I  K  S   +A   K A GA E +P IR++NL   ++ +       +G + ++   
Sbjct: 122 HAVIVPKDRSAQLNATAKKVACGAAESVPLIRVTNLARTMRMLQEENIWIVGTAGEADHT 181

Query: 220 LEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNH 279
           L Q     ++AL++GAEG+G+R  T+E    +  + M G + +LNVS A  + L+     
Sbjct: 182 LYQSKMTGRLALVMGAEGEGMRRLTREHCDELISIPMAGSVSSLNVSVATGICLFEAVRQ 241

Query: 280 FA 281
            +
Sbjct: 242 RS 243


>gi|306844418|ref|ZP_07477008.1| tRNA/rRNA methyltransferase [Brucella sp. BO1]
 gi|306275231|gb|EFM56981.1| tRNA/rRNA methyltransferase [Brucella sp. BO1]
          Length = 297

 Score =  135 bits (340), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 46/255 (18%), Positives = 84/255 (32%), Gaps = 4/255 (1%)

Query: 27  HRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDAN 86
           +   K ++S   K +   Q       G+  V  AL    R    + A      +      
Sbjct: 35  NPIVKDLRSLALK-KFRDQQGVFLAEGLKLVIDALEQDWRIKTLVFAKSGKGNKTVEQVA 93

Query: 87  L---PHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDHVND 143
                    V  V  + I  I  ++       +             + + + + LD V D
Sbjct: 94  ARTFAKGGLVLEVTEKVISAITRRDNPQMVAGVFEQQYHQLASLKPKGNDVYIALDRVRD 153

Query: 144 PHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMH 203
           P N+G ++R+A A    G+I     +   S    ++  G++  +P  R S       +  
Sbjct: 154 PGNLGTVIRTADAVGAKGVILIGDTTDPYSLETVRATMGSVFSVPLYRASEADFLNWRKG 213

Query: 204 SWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKAL 263
             G         +         N  + L++G E +GL          +A +   G   +L
Sbjct: 214 FSGLIVGTHLKGAVDYRTIPYANKPVILMMGNEQQGLPDSLAGACDKLARIPQAGRADSL 273

Query: 264 NVSNAAAVALYITQN 278
           N++ A  V LY  + 
Sbjct: 274 NLAIATGVMLYEIRR 288


>gi|169829514|ref|YP_001699672.1| putative tRNA/rRNA methyltransferase [Lysinibacillus sphaericus
           C3-41]
 gi|168994002|gb|ACA41542.1| Hypothetical tRNA/rRNA methyltransferase [Lysinibacillus sphaericus
           C3-41]
          Length = 254

 Score =  135 bits (340), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 47/274 (17%), Positives = 95/274 (34%), Gaps = 24/274 (8%)

Query: 1   MNLISKKKSEKIFSLKDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAA 60
           M  I   +                  +   K  +      +   +     + G H +  A
Sbjct: 1   MKRIESTQ------------------NALVKYWKKLATTRKERERSGEFIVEGFHLIEEA 42

Query: 61  LNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAP 120
           L +   ++ Q++  +     + W  +      V +V  +   +    + V          
Sbjct: 43  LKH-KEQVLQIIVREGVDLPMLWPIDGIAIVEVTSVVAKEFAETETSQGVFAICKQPV-- 99

Query: 121 LLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSA 180
                 +A  + + ++++D V DP NIG ++R+A A   D +I  K  +   +    ++A
Sbjct: 100 ---LEEEAKTSWRKVLLIDAVQDPGNIGTMIRTADAAGLDAVILGKGCADIYNPKTLRAA 156

Query: 181 SGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGL 240
            G+  HIP +R                       +   P          A+I+G EG G+
Sbjct: 157 QGSHFHIPVVREELTECVDFLQDQGVPVFGTALDEDAVPYSDIHHTGAFAIIMGNEGSGI 216

Query: 241 RPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
           +P+          + + G  ++LNV+ A  + LY
Sbjct: 217 QPQLLAMTDQNIIIPILGQAESLNVAVATGIVLY 250


>gi|293417683|ref|ZP_06660305.1| RNA methyltransferase [Escherichia coli B185]
 gi|291430401|gb|EFF03399.1| RNA methyltransferase [Escherichia coli B185]
          Length = 243

 Score =  135 bits (340), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 62/242 (25%), Positives = 104/242 (42%), Gaps = 8/242 (3%)

Query: 48  NLFLYGVHTVSAALNNPSRKIFQLLATKNALARLD---WDANLPHPFPVKTVPPQTIDKI 104
           +  +YG+H V A L     +  ++   K    +       A       ++    Q +D+ 
Sbjct: 2   SEMIYGIHAVQALLERAPERFQEVFILKGREDKRLLPLIHALESQGVVIQLANRQYLDEK 61

Query: 105 VGKEAVHQGLALETAPLLSPTLDAVR-----NSQLLMVLDHVNDPHNIGAILRSAVAFSC 159
                    +A           D        +   L++LD V DPHN+GA LRSA A   
Sbjct: 62  SDGAVHQGIIARVKPGRQYQENDLPELIASLDQPFLLILDGVTDPHNLGACLRSADAAGV 121

Query: 160 DGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKP 219
             +I  K  S   +A   K A GA E +P IR++NL   ++ +       +G + ++   
Sbjct: 122 HAVIVPKDRSAQLNATAKKVACGAAESVPLIRVTNLARTMRMLQEENIWIVGTAGEADHT 181

Query: 220 LEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNH 279
           L Q     ++AL++GAEG+G+R  T+E    +  + M G + +LNVS A  + L+     
Sbjct: 182 LYQSKMTGRLALVMGAEGEGMRRLTREHCDELISIPMAGSVSSLNVSVATGICLFEAVRQ 241

Query: 280 FA 281
            +
Sbjct: 242 RS 243


>gi|332665335|ref|YP_004448123.1| tRNA/rRNA methyltransferase SpoU [Haliscomenobacter hydrossis DSM
           1100]
 gi|332334149|gb|AEE51250.1| tRNA/rRNA methyltransferase (SpoU) [Haliscomenobacter hydrossis DSM
           1100]
          Length = 268

 Score =  135 bits (340), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 53/259 (20%), Positives = 101/259 (38%), Gaps = 4/259 (1%)

Query: 26  NHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATK-NALARLDWD 84
            +   K +    +K+R   +       G+  V  AL         L   +  + A L   
Sbjct: 11  QNPLIKNIGILLEKARERRKQGLFVAEGLIEVGMALRAGYEVEQLLYDPEITSFAALQSL 70

Query: 85  ANLPHPFP--VKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDHVN 142
             LP   P  +  V    ++KI  +  V   +A+   P  +    +   + L++VL+ V 
Sbjct: 71  PKLPANLPQKLIEVSGSVMEKIAYRANVPNVVAVLKTPERALNNFSPGKNPLILVLETVE 130

Query: 143 DPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKM 202
            P N+GAILR+A A     +      +   +  + +++ GA+  +P   ++   DAL  +
Sbjct: 131 KPGNLGAILRTADAAGVHAVFLCDPQTDWYNPNVIRASLGAVFTVPVFTVAAA-DALNWL 189

Query: 203 HSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKA 262
                  +    ++  P      +  IA ++G E  G+     E A     + M G + +
Sbjct: 190 QMHKIAILATHLEASYPYFDCDLSGAIAFVMGTEANGISNFWVEAAQQRVIIPMHGQVDS 249

Query: 263 LNVSNAAAVALYITQNHFA 281
           +NVS + A+ L+       
Sbjct: 250 MNVSVSTAILLFEALRQRK 268


>gi|238795294|ref|ZP_04638873.1| 23S rRNA (guanosine-2'-O-)-methyltransferase rlmB [Yersinia
           intermedia ATCC 29909]
 gi|238725379|gb|EEQ16954.1| 23S rRNA (guanosine-2'-O-)-methyltransferase rlmB [Yersinia
           intermedia ATCC 29909]
          Length = 246

 Score =  135 bits (340), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 67/242 (27%), Positives = 108/242 (44%), Gaps = 8/242 (3%)

Query: 48  NLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDW---DANLPHPFPVKTVPPQTIDKI 104
           +  +YG+H V A L+N  ++  ++   K    R               ++    Q +D  
Sbjct: 2   SEIIYGIHAVKALLDNDPQRFLEVFILKGRDDRRLQPLVAELEAAGLVIQVASRQWLDSQ 61

Query: 105 VGKEAVHQGLALETAPLLSPTLDAVR-----NSQLLMVLDHVNDPHNIGAILRSAVAFSC 159
           V        +A           D        +   L+VLD V DPHN+GA LRSA A   
Sbjct: 62  VEGGVHQGIVARVREGRQYQENDLPALLESVDMPFLLVLDGVTDPHNLGACLRSADAAGV 121

Query: 160 DGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKP 219
             +I  +  S   +A+  K ASGA E++P I+++NL   L+ +       +G + ++   
Sbjct: 122 HAVIVPRDRSAQLNAIAKKVASGAAENVPLIKVTNLARTLRLLQEHNVWIVGTAGEADHT 181

Query: 220 LEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNH 279
           L Q      +AL++GAEG+G+R  T+E    +  + M G + +LNVS A  V L+     
Sbjct: 182 LYQSKMTGPMALVMGAEGEGMRRLTREHCDELISIPMAGTVSSLNVSVATGVCLFEVVRQ 241

Query: 280 FA 281
            A
Sbjct: 242 RA 243


>gi|329119920|ref|ZP_08248594.1| 23S rRNA (guanosine-2'-O-)-methyltransferase RlmB [Neisseria
           bacilliformis ATCC BAA-1200]
 gi|327464076|gb|EGF10387.1| 23S rRNA (guanosine-2'-O-)-methyltransferase RlmB [Neisseria
           bacilliformis ATCC BAA-1200]
          Length = 276

 Score =  135 bits (340), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 72/239 (30%), Positives = 114/239 (47%), Gaps = 9/239 (3%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLATKN---ALARLDWDANLPHPFPVKTVPPQTIDKIVG 106
            +YG H V+A L    + I +L   ++   A  R   +        V       ++ I  
Sbjct: 32  LIYGFHAVNARLWQNPKSITELYVQQDKSDARTREVLEKAADENVRVHFADASRLNAIA- 90

Query: 107 KEAVHQGLALET-----APLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDG 161
           K A HQG+A           L   LD +R    L+VLD + DPHN+GA LR+A A     
Sbjct: 91  KGARHQGVAGFIDASRNHVHLEDVLDNLREPPFLLVLDGITDPHNLGACLRTADAMGVHA 150

Query: 162 IITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLE 221
           +I  K  S   +A ++K A GA E +PYI ++NL   L ++  +G   IG  +  +  L 
Sbjct: 151 VIAPKDKSAGLNATVSKVACGAAETVPYITVTNLARTLCELKEYGIWIIGTDTGGESDLY 210

Query: 222 QEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
                D +A ++G EG+G+R  T+E    +  + M G ++++NVS +A + L  T+   
Sbjct: 211 HTDLPDSVAWVMGNEGEGMRRLTREHCDMLVAIPMFGTVESMNVSVSAGMVLGETRRQR 269


>gi|254718366|ref|ZP_05180177.1| tRNA/rRNA methyltransferase (SpoU) [Brucella sp. 83/13]
 gi|265983327|ref|ZP_06096062.1| tRNA/rRNA methyltransferase [Brucella sp. 83/13]
 gi|306839597|ref|ZP_07472401.1| tRNA/rRNA methyltransferase [Brucella sp. NF 2653]
 gi|264661919|gb|EEZ32180.1| tRNA/rRNA methyltransferase [Brucella sp. 83/13]
 gi|306405295|gb|EFM61570.1| tRNA/rRNA methyltransferase [Brucella sp. NF 2653]
          Length = 297

 Score =  135 bits (340), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 46/255 (18%), Positives = 84/255 (32%), Gaps = 4/255 (1%)

Query: 27  HRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDAN 86
           +   K ++S   K +   Q       G+  V  AL    R    + A      +      
Sbjct: 35  NPIVKDLRSLALK-KFRDQQGVFLAEGLKLVIDALEQDWRIKTLVFAKSGKGNKTVEQVA 93

Query: 87  L---PHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDHVND 143
                    V  V  + I  I  ++       +             + + + + LD V D
Sbjct: 94  ARTFAKGGLVLEVTEKVISAITRRDNPQMVAGVFEQQYHQLASLKPKGNDVYVALDRVRD 153

Query: 144 PHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMH 203
           P N+G ++R+A A    G+I     +   S    ++  G++  +P  R S       +  
Sbjct: 154 PGNLGTVIRTADAVGAKGVILIGDTTDPYSLETVRATMGSVFSVPLYRASEADFLNWRKG 213

Query: 204 SWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKAL 263
             G         +         N  + L++G E +GL          +A +   G   +L
Sbjct: 214 FSGLVVGTHLKGAVDYRTIPYANKPVILMMGNEQQGLPDSLAGACDKLARIPQAGRADSL 273

Query: 264 NVSNAAAVALYITQN 278
           N++ A  V LY  + 
Sbjct: 274 NLAIATGVMLYEIRR 288


>gi|291295473|ref|YP_003506871.1| tRNA/rRNA methyltransferase (SpoU) [Meiothermus ruber DSM 1279]
 gi|290470432|gb|ADD27851.1| tRNA/rRNA methyltransferase (SpoU) [Meiothermus ruber DSM 1279]
          Length = 266

 Score =  135 bits (340), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 49/256 (19%), Positives = 85/256 (33%), Gaps = 5/256 (1%)

Query: 27  HRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATK--NALARLDWD 84
           +   K      ++ ++  +     + G   +  AL      I            AR    
Sbjct: 8   NPRIKAAAELKER-KNRERTGTFLIEGAREIERALAAGLEVIEAYCGEPLSPEEARAVAH 66

Query: 85  ANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDHVNDP 144
            +      V  +    + KI  +E     LA+   P  S       ++ LL+V   +  P
Sbjct: 67  LSRALGLEVHELSEAALKKISSREHPAGVLAVARMPRPSLAAFQPSSNALLLVSVGLEKP 126

Query: 145 HNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHS 204
            N+GA+LRSA A   D ++           V+    S  +        +     L  +  
Sbjct: 127 GNLGALLRSADAAGADAVLVAGGVDLYSPQVIRN--STGVVFSLPTFAAPEQAVLDWLLQ 184

Query: 205 WGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALN 264
                +  +  + +          +A++LG E +GL     E A     + M G   +LN
Sbjct: 185 HNIPIVATTPHTHQTYWDVDLRGPVAIVLGTEHQGLSQTWLERAARKVRIPMQGQADSLN 244

Query: 265 VSNAAAVALYITQNHF 280
           VS  AA+ LY      
Sbjct: 245 VSVTAALMLYEAVRQR 260


>gi|194098420|ref|YP_002001479.1| RNA methylase [Neisseria gonorrhoeae NCCP11945]
 gi|193933710|gb|ACF29534.1| RNA methylase [Neisseria gonorrhoeae NCCP11945]
          Length = 250

 Score =  135 bits (340), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 69/238 (28%), Positives = 110/238 (46%), Gaps = 9/238 (3%)

Query: 51  LYGVHTVSAALNNPSRKIFQLLATK---NALARLDWDANLPHPFPVKTVPPQTIDKIVGK 107
           +YG H V+A L    + I +L   +   +A  R   +        V       ++ I  K
Sbjct: 7   IYGFHAVNARLWQNPKSITELYIQEGKSDARTREVLEKAANENIRVYFADADRLNAIS-K 65

Query: 108 EAVHQGLALET-----APLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGI 162
            A HQG+            L   L+ +    LL++LD + DPHN+GA LR+A A     +
Sbjct: 66  GARHQGVVGFIDASKNHVHLEGILENLSEPPLLLILDGITDPHNLGACLRTADAMGVHAV 125

Query: 163 ITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQ 222
           I  K  S   +A ++K A GA E +PYI ++NL   L+++  +G   IG        L  
Sbjct: 126 IAPKDKSAGLNATVSKVACGAAETVPYITVTNLARTLRELKEYGIWIIGTDIGGNADLYH 185

Query: 223 EIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
               D  A ++G EG G+R  T+E    +  + M G ++++NVS +A + L  T+   
Sbjct: 186 CNLPDSAAWVMGNEGDGMRRLTREHCDMLVSIPMFGTVESMNVSVSAGMVLSETRRQR 243


>gi|306842563|ref|ZP_07475214.1| tRNA/rRNA methyltransferase [Brucella sp. BO2]
 gi|306287419|gb|EFM58899.1| tRNA/rRNA methyltransferase [Brucella sp. BO2]
          Length = 297

 Score =  135 bits (339), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 47/255 (18%), Positives = 84/255 (32%), Gaps = 4/255 (1%)

Query: 27  HRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDAN 86
           +   K ++S   K +   Q       G+  V  AL    R    + A      +      
Sbjct: 35  NPIVKDLRSLALK-KFRDQQGVFLAEGLKLVIDALEQDWRIKTLVFAKSGKGNKTVEQVA 93

Query: 87  L---PHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDHVND 143
                    V  V  + I  I  ++       +             + + + + LD V D
Sbjct: 94  ARTFAKGGLVLEVTEKVISAITRRDNPQMVAGVFEQQYHQLASLKPKGNDVYIALDRVRD 153

Query: 144 PHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMH 203
           P N+G I+R+A A    G+I     +   S    ++  G++  +P  R S       +  
Sbjct: 154 PGNLGTIIRTADAVGAKGVILIGDTTDPYSLETVRATMGSVFSVPLYRASEADFLNWRKG 213

Query: 204 SWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKAL 263
             G         +         N  + L++G E +GL          +A +   G   +L
Sbjct: 214 FSGLVVGTHLKGAVDYRTIPYANKPVILMMGNEQQGLPDSLAGACDKLARIPQAGRADSL 273

Query: 264 NVSNAAAVALYITQN 278
           N++ A  V LY  + 
Sbjct: 274 NLAIATGVMLYEIRR 288


>gi|296100947|ref|YP_003611093.1| 23S rRNA 2'-O-methyltransferase [Enterobacter cloacae subsp.
           cloacae ATCC 13047]
 gi|295055406|gb|ADF60144.1| 23S rRNA 2'-O-methyltransferase [Enterobacter cloacae subsp.
           cloacae ATCC 13047]
          Length = 244

 Score =  135 bits (339), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 61/243 (25%), Positives = 105/243 (43%), Gaps = 8/243 (3%)

Query: 48  NLFLYGVHTVSAALNNPSRKIFQLLATKNALARLD---WDANLPHPFPVKTVPPQTIDKI 104
           +  +YG+H V A L     +  ++   K    +       A       ++    Q +D+ 
Sbjct: 2   SEMIYGIHAVQALLERAPERFQEVFILKGREDKRLMPLIHALEAQGVVIQLANRQFLDEK 61

Query: 105 VGKEAVHQGLALETAPLLSPTLDAVR-----NSQLLMVLDHVNDPHNIGAILRSAVAFSC 159
                    +A           D        ++   ++LD V DPHN+GA LRSA A   
Sbjct: 62  SEGAVHQGIIARVKPGRQYQENDLPDLIAALDNPFFLILDGVTDPHNLGACLRSADAAGV 121

Query: 160 DGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKP 219
             +I  K  S   +A   K A GA E++P IR++NL   ++ +       +G + ++   
Sbjct: 122 HAVIVPKDRSAQLNATAKKVACGAAENVPLIRVTNLARTMRMLQEENIWIVGTAGEADHT 181

Query: 220 LEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNH 279
           L Q     ++AL++GAEG+G+R  T+E    +  + M G + +LNVS A  + L+     
Sbjct: 182 LYQSKMTGRLALVMGAEGEGMRRLTREHCDELISIPMAGSVSSLNVSVATGICLFEAVRQ 241

Query: 280 FAK 282
             +
Sbjct: 242 RGE 244


>gi|269798074|ref|YP_003311974.1| RNA methyltransferase, TrmH family, group 3 [Veillonella parvula
           DSM 2008]
 gi|269094703|gb|ACZ24694.1| RNA methyltransferase, TrmH family, group 3 [Veillonella parvula
           DSM 2008]
          Length = 243

 Score =  135 bits (339), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 62/239 (25%), Positives = 116/239 (48%), Gaps = 10/239 (4%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLATKNALA---RLDWDANLPHPFPVKTVPPQTIDKIVG 106
           ++ G + V  AL +  R I ++L +++ +        D        V+  P + ++K   
Sbjct: 4   YIVGRNAVKEALKSG-RSIQRILVSEDRVKTGLADIVDLAKSQGIEVRPTPVKQMNKY-D 61

Query: 107 KEAVHQGLALETAPLLSPTL-----DAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDG 161
            E  HQG+    + +    L     +      LL++ D V DPHN+GAI+R+A       
Sbjct: 62  LEVPHQGVIALVSAVQFKELGEVLQETTHEVPLLILTDGVEDPHNMGAIIRTAECAGATA 121

Query: 162 IITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLE 221
           ++  KR++   +A +AK+++GA+E IP ++I N+T  ++++   GF  +G   +  + L 
Sbjct: 122 VLIPKRHNAPINATVAKTSAGAIEQIPLVQIGNVTQTIKQLQKQGFWVMGAHMEGDRTLY 181

Query: 222 QEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
           +        +++G EGKG+    +E    +  + M G + +LN S AAAV +Y      
Sbjct: 182 EADMTIPTVIVIGNEGKGISRVVKEACDFLVTIPMYGNLNSLNASVAAAVLMYEAVRQR 240


>gi|269797956|ref|YP_003311856.1| tRNA/rRNA methyltransferase (SpoU) [Veillonella parvula DSM 2008]
 gi|269094585|gb|ACZ24576.1| tRNA/rRNA methyltransferase (SpoU) [Veillonella parvula DSM 2008]
          Length = 264

 Score =  135 bits (339), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 59/282 (20%), Positives = 101/282 (35%), Gaps = 22/282 (7%)

Query: 1   MNLISKKKSEKIFSLKDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVS-- 58
           M  I  K                  +++  K++ S  Q+ ++  +     + G+ ++   
Sbjct: 1   MEFIQSK------------------DNKTIKRIISLRQR-KNRQKNGEYIVEGIRSIRDI 41

Query: 59  AALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALET 118
           AA+      + +    ++       D +     P         DK V      QG+    
Sbjct: 42  AAMGAVKTIVIRESKAQDKNILDLLDLDTVQSVPKYIAQDPVFDK-VDNTVNGQGVVAIV 100

Query: 119 APLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAK 178
           +              L + LD V DP N+G I+R+AVA    GI   K      +    +
Sbjct: 101 SKPTYDIESISIVDGLYITLDGVQDPGNLGTIIRTAVAAGVKGIFLMKGTVDPFNDKTVR 160

Query: 179 SASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGK 238
           S   AL  IP      LT     +      +   + +   P        +  L+LG EG 
Sbjct: 161 STMSALHKIPLYEDITLTLLHDMVTESNMTSYVTALEHSNPYHTVRYAKRTMLVLGNEGN 220

Query: 239 GLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
           G+ P+     T+   + M G +++LNVS AAA+ +Y  Q   
Sbjct: 221 GVTPEVMNLCTNRIMIPMYGDMESLNVSVAAALCMYKVQEQL 262


>gi|332160030|ref|YP_004296607.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Yersinia
           enterocolitica subsp. palearctica 105.5R(r)]
 gi|318607412|emb|CBY28910.1| 23s rRNA (guanosine-2'-O-)-methyltransferase rlmB [Yersinia
           enterocolitica subsp. palearctica Y11]
 gi|325664260|gb|ADZ40904.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Yersinia
           enterocolitica subsp. palearctica 105.5R(r)]
 gi|330862086|emb|CBX72252.1| 23S rRNA (guanosine-2'-O-)-methyltransferase rlmB [Yersinia
           enterocolitica W22703]
          Length = 246

 Score =  135 bits (339), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 68/242 (28%), Positives = 110/242 (45%), Gaps = 8/242 (3%)

Query: 48  NLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANL---PHPFPVKTVPPQTIDKI 104
           +  +YG+H+V A L+N  ++  ++   K    R               ++    Q +D  
Sbjct: 2   SEIIYGIHSVKALLDNDPQRFLEVFILKGRDDRRLQPLIAELEAAGLVIQVASRQWLDSQ 61

Query: 105 VGKEAVHQGLALETAPLLSPTLDAVR-----NSQLLMVLDHVNDPHNIGAILRSAVAFSC 159
           V        +A           D         + LL+VLD V DPHN+GA LRSA A   
Sbjct: 62  VEGGVHQGIVARVREGRQYQENDLPALLESVETPLLLVLDGVTDPHNLGACLRSADAAGV 121

Query: 160 DGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKP 219
             +I  +  S   +A+  K ASGA E++P I+++NL   L+ +       +G + ++   
Sbjct: 122 HAVIVPRDRSAQLNAIAKKVASGAAENVPLIKVTNLARTLRVLQEHNVWIVGTAGEADHT 181

Query: 220 LEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNH 279
           L Q      +AL++GAEG+G+R  T+E    +  + M G + +LNVS A  V L+     
Sbjct: 182 LYQSKMTGPMALVMGAEGEGMRRLTREHCDELISIPMAGSVSSLNVSVATGVCLFEAVRQ 241

Query: 280 FA 281
            A
Sbjct: 242 RA 243


>gi|168188126|ref|ZP_02622761.1| rRNA methylase [Clostridium botulinum C str. Eklund]
 gi|169294044|gb|EDS76177.1| rRNA methylase [Clostridium botulinum C str. Eklund]
          Length = 261

 Score =  135 bits (339), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 57/281 (20%), Positives = 102/281 (36%), Gaps = 26/281 (9%)

Query: 1   MNLISKKKSEKIFSLKDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAA 60
           MNLI  K +  I  ++                     +K ++  Q E   + G   V  A
Sbjct: 1   MNLIESKDNTLIKYVRKL-------------------RKKKYRVQEEKFLVEGFRFVEEA 41

Query: 61  LNNPSRKIFQLLAT--KNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALET 118
           L +  +    L+    K      +    +     +  V  + + ++              
Sbjct: 42  LKSTFKISHVLVGESAKEKCNSFNIFNIVSENTKISLVKDEILKELCETNNPQG----II 97

Query: 119 APLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAK 178
           A + +  ++    S   ++ D V DP N+G I+RSA A    G+I TK      +    +
Sbjct: 98  AIVDNKIINIEDKSGFYVLADKVQDPGNMGTIIRSANASGALGVIVTKGTVDIYNDKTLR 157

Query: 179 SASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGK 238
           S  G++  IP I  +          S GF+ I  S D++          K+ + +G EG 
Sbjct: 158 STMGSIFKIPIIEDNEFEIINVLK-SKGFKLIVSSLDTENNFFDIDLTGKVIICVGNEGN 216

Query: 239 GLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNH 279
           G+  +          + MPG  ++LN   AA++ +Y     
Sbjct: 217 GVSDEVYSLGDEKVKIPMPGNAESLNAGVAASIMMYEVVRQ 257


>gi|282896219|ref|ZP_06304242.1| tRNA/rRNA methyltransferase (SpoU) [Raphidiopsis brookii D9]
 gi|281198908|gb|EFA73786.1| tRNA/rRNA methyltransferase (SpoU) [Raphidiopsis brookii D9]
          Length = 263

 Score =  135 bits (339), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 47/256 (18%), Positives = 103/256 (40%), Gaps = 8/256 (3%)

Query: 26  NHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAA--LNNPSRKIFQLLATKNALARLDW 83
            +   K+++  +  ++   + +   L G H ++ A  +N P   +   +  +N+ + L  
Sbjct: 6   QNPLVKQIRKLH-SAKERHKQQLFVLEGTHLIAEACSVNYPLETVCCTIDWQNSHSELWQ 64

Query: 84  DANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDHVND 143
           +        V+ V  + +  +    A         A +     + +  + L + L+ + D
Sbjct: 65  NVCNA-CHRVEIVSQEVLAAM----ATTVQPDGVVAMVKRCEENPIPITGLALALETIQD 119

Query: 144 PHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMH 203
           P N+G I+R+A A    G+  +      +   + ++++G    +      NL D +Q   
Sbjct: 120 PGNLGTIIRTAAAVDASGLWLSNDSVDLDHPKVLRASAGQWFRLKKQVSHNLKDTVQDCQ 179

Query: 204 SWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKAL 263
             G Q +     ++    Q   +    ++LG EG GL       A     + +   +++L
Sbjct: 180 RGGMQVVATLPTAELTYWQVDWSLPSLILLGNEGAGLSDDLATMANIQVKIPLSPQVESL 239

Query: 264 NVSNAAAVALYITQNH 279
           NV+ +AA+ LY  Q  
Sbjct: 240 NVAISAALILYEAQRQ 255


>gi|282850301|ref|ZP_06259680.1| RNA methyltransferase, TrmH family, group 3 [Veillonella parvula
           ATCC 17745]
 gi|294793809|ref|ZP_06758946.1| RNA methyltransferase, TrmH family, group 3 [Veillonella sp.
           3_1_44]
 gi|282579794|gb|EFB85198.1| RNA methyltransferase, TrmH family, group 3 [Veillonella parvula
           ATCC 17745]
 gi|294455379|gb|EFG23751.1| RNA methyltransferase, TrmH family, group 3 [Veillonella sp.
           3_1_44]
          Length = 243

 Score =  135 bits (339), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 61/238 (25%), Positives = 111/238 (46%), Gaps = 8/238 (3%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPH--PFPVKTVPPQTIDKIVGK 107
           ++ G + V  AL +       L++       L    NL       V+  P + ++K    
Sbjct: 4   YIVGRNAVKEALKSGRSIQRILVSEDKVKTGLADIVNLAKSQGIEVRPTPVKQMNKY-DL 62

Query: 108 EAVHQGLALETAPLLSPTL-----DAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGI 162
           E  HQG+    + +    L     +      LL++ D V DPHN+GAI+R+A       +
Sbjct: 63  EVPHQGVIALVSAVQFKELGEVLQETTHEVPLLILTDGVEDPHNMGAIIRTAECAGATAV 122

Query: 163 ITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQ 222
           +  KR++   +A +AK+++GA+E IP ++I N+   ++++   GF  +G   +  + L +
Sbjct: 123 LIPKRHNAPINATVAKTSAGAIEQIPLVQIGNVVQTIKQLQKQGFWVMGAHMEGDRTLYE 182

Query: 223 EIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
                   +++G EGKG+    +E    +  + M G + +LN S AAAV +Y      
Sbjct: 183 ADMTIPTVIVIGNEGKGISRVVKEACDFLVTIPMYGNLNSLNASVAAAVLMYEAVRQR 240


>gi|15895625|ref|NP_348974.1| rRNA methylase [Clostridium acetobutylicum ATCC 824]
 gi|15025369|gb|AAK80314.1|AE007736_4 RRNA methylase, YSGA B.subtilis ortholog [Clostridium
           acetobutylicum ATCC 824]
 gi|325509773|gb|ADZ21409.1| RRNA methylase [Clostridium acetobutylicum EA 2018]
          Length = 261

 Score =  135 bits (339), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 56/258 (21%), Positives = 109/258 (42%), Gaps = 9/258 (3%)

Query: 24  RRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDW 83
            + +   K+++  N+K +H    ++  + G+  V  AL +   KI  L  ++    +   
Sbjct: 7   SKENSIIKEVKKLNEK-KHRDLKKSFIVEGLRFVREALESD-FKIQYLFVSEKNYDKFIL 64

Query: 84  DANL---PHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDH 140
                     F V  V    +  I   +          A +    +         M++D 
Sbjct: 65  KELKELIKKEFQVIKVTESILKDICNTQTPQG----IVAVVQYKEVAWKLTKGFYMLVDK 120

Query: 141 VNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQ 200
           V DP N+G I+R+A A    G+I TK      +    ++  G++  IP I   +    ++
Sbjct: 121 VQDPGNMGTIIRTANAAGALGVIITKGTVDIYNNKTLRATMGSIFKIPIIFEDDNFSKIK 180

Query: 201 KMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGII 260
           ++   GF+ I  S D++        N+K+ + +G EG G+  K  + + +   + MPG +
Sbjct: 181 ELKKNGFKIIASSLDTEHNFYDVSLNEKLIIAVGNEGNGISDKIVDISDTKVKIPMPGNV 240

Query: 261 KALNVSNAAAVALYITQN 278
           ++LNV  AAA+ ++    
Sbjct: 241 ESLNVGVAAAIMMFEYVR 258


>gi|320190688|gb|EFW65338.1| 23S rRNA guanosine-2'-O--methyltransferase [Escherichia coli
           O157:H7 str. EC1212]
 gi|323171612|gb|EFZ57258.1| RNA 2'-O ribose methyltransferase substrate binding family protein
           [Escherichia coli LT-68]
 gi|323182286|gb|EFZ67696.1| RNA 2'-O ribose methyltransferase substrate binding family protein
           [Escherichia coli 1357]
 gi|326345488|gb|EGD69231.1| 23S rRNA guanosine-2'-O--methyltransferase [Escherichia coli
           O157:H7 str. 1125]
 gi|332083729|gb|EGI88947.1| RNA 2'-O ribose methyltransferase substrate binding family protein
           [Shigella dysenteriae 155-74]
 gi|332761878|gb|EGJ92152.1| RNA 2'-O ribose methyltransferase substrate binding family protein
           [Shigella flexneri 2747-71]
 gi|333009255|gb|EGK28711.1| RNA 2'-O ribose methyltransferase substrate binding family protein
           [Shigella flexneri K-218]
 gi|333011990|gb|EGK31375.1| RNA 2'-O ribose methyltransferase substrate binding family protein
           [Shigella flexneri K-304]
 gi|333012643|gb|EGK32023.1| RNA 2'-O ribose methyltransferase substrate binding family protein
           [Shigella flexneri K-227]
          Length = 240

 Score =  135 bits (339), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 62/239 (25%), Positives = 103/239 (43%), Gaps = 8/239 (3%)

Query: 51  LYGVHTVSAALNNPSRKIFQLLATKNALARLD---WDANLPHPFPVKTVPPQTIDKIVGK 107
           +YG+H V A L     +  ++   K    +       A       ++    Q +D+    
Sbjct: 2   IYGIHAVQALLERAPERFQEVFILKGREDKRLLPLIHALESQGVVIQLANRQYLDEKSDG 61

Query: 108 EAVHQGLALETAPLLSPTLDAVR-----NSQLLMVLDHVNDPHNIGAILRSAVAFSCDGI 162
                 +A           D        +   L++LD V DPHN+GA LRSA A     +
Sbjct: 62  AVHQGIIARVKPGRQYQENDLPDLIASLDQPFLLILDGVTDPHNLGACLRSADAAGVHAV 121

Query: 163 ITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQ 222
           I  K  S   +A   K A GA E +P IR++NL   ++ +       +G + ++   L Q
Sbjct: 122 IVPKDRSAQLNATAKKVACGAAESVPLIRVTNLARTMRMLQEENIWIVGTAGEADHTLYQ 181

Query: 223 EIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHFA 281
                ++AL++GAEG+G+R  T+E    +  + M G + +LNVS A  + L+      +
Sbjct: 182 SKMTGRLALVMGAEGEGMRRLTREHCDELISIPMAGSVSSLNVSVATGICLFEAVRQRS 240


>gi|168181825|ref|ZP_02616489.1| RNA methyltransferase, TrmH family [Clostridium botulinum Bf]
 gi|237796588|ref|YP_002864140.1| TrmH family RNA methyltransferase [Clostridium botulinum Ba4 str.
           657]
 gi|182675129|gb|EDT87090.1| RNA methyltransferase, TrmH family [Clostridium botulinum Bf]
 gi|229263217|gb|ACQ54250.1| RNA methyltransferase, TrmH family [Clostridium botulinum Ba4 str.
           657]
          Length = 259

 Score =  135 bits (339), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 54/262 (20%), Positives = 108/262 (41%), Gaps = 9/262 (3%)

Query: 24  RRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDW 83
            ++++  K+++   +K ++ +Q ++  + G      AL + S  + ++   + +L +L+ 
Sbjct: 4   SKDNQLIKEVRKLREK-KYRTQNKSFIIEGFRFFEEALKSNS-SVNKVFIEEKSLNKLEE 61

Query: 84  ---DANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDH 140
                N+ +      V    +  I G     QG+           LD      +L+  D 
Sbjct: 62  LYKKYNINNDIETYVVSYSVLKSI-GNTENPQGIVSVINYFKKEKLDLQNGFYILV--DK 118

Query: 141 VNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQ 200
           V DP N+G I+R+A A    G+ITTK      +    +S  G++ +IP I   NL     
Sbjct: 119 VQDPGNMGTIIRTAHAAGALGVITTKGTVDIYNEKTLRSTMGSIFYIPIIEDENLEVVKS 178

Query: 201 KMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGII 260
                    +     +    +  +K+D + + +G EG G+       +     + MPG  
Sbjct: 179 LQKKGFKLLVSSLDTNSNFYDVNMKDD-MIIAVGNEGNGISEVLNTLSDIKVKIPMPGAA 237

Query: 261 KALNVSNAAAVALYITQNHFAK 282
           ++LNV+ A ++  +       K
Sbjct: 238 ESLNVAVACSIMTFERIRQINK 259


>gi|82699065|ref|YP_413639.1| tRNA/rRNA methyltransferase SpoU [Brucella melitensis biovar
           Abortus 2308]
 gi|189023403|ref|YP_001934171.1| tRNA/rRNA methyltransferase (SpoU) [Brucella abortus S19]
 gi|237814620|ref|ZP_04593618.1| tRNA/rRNA methyltransferase (SpoU) [Brucella abortus str. 2308 A]
 gi|254696574|ref|ZP_05158402.1| tRNA/rRNA methyltransferase (SpoU) [Brucella abortus bv. 2 str.
           86/8/59]
 gi|254731487|ref|ZP_05190065.1| tRNA/rRNA methyltransferase (SpoU) [Brucella abortus bv. 4 str.
           292]
 gi|260546424|ref|ZP_05822164.1| tRNA/rRNA methyltransferase [Brucella abortus NCTC 8038]
 gi|260759230|ref|ZP_05871578.1| tRNA/rRNA methyltransferase [Brucella abortus bv. 4 str. 292]
 gi|260760952|ref|ZP_05873295.1| tRNA/rRNA methyltransferase [Brucella abortus bv. 2 str. 86/8/59]
 gi|82615166|emb|CAJ10105.1| tRNA/rRNA methyltransferase (SpoU) [Brucella melitensis biovar
           Abortus 2308]
 gi|189018975|gb|ACD71697.1| tRNA/rRNA methyltransferase (SpoU) [Brucella abortus S19]
 gi|237789457|gb|EEP63667.1| tRNA/rRNA methyltransferase (SpoU) [Brucella abortus str. 2308 A]
 gi|260096531|gb|EEW80407.1| tRNA/rRNA methyltransferase [Brucella abortus NCTC 8038]
 gi|260669548|gb|EEX56488.1| tRNA/rRNA methyltransferase [Brucella abortus bv. 4 str. 292]
 gi|260671384|gb|EEX58205.1| tRNA/rRNA methyltransferase [Brucella abortus bv. 2 str. 86/8/59]
          Length = 297

 Score =  135 bits (339), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 48/255 (18%), Positives = 85/255 (33%), Gaps = 4/255 (1%)

Query: 27  HRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDAN 86
           +   K ++S   K +   Q       G+  V  AL    R    + A      +      
Sbjct: 35  NPIVKDLRSLALK-KFRDQQGVFLAEGLKLVIDALEQDWRIKTLVFAKSGKGNKTVEQVA 93

Query: 87  L---PHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDHVND 143
                    V  V  + I  I  ++ +     +             + + + + LD V D
Sbjct: 94  ARTFAKGGLVLEVTEKVISAITRRDNLQMVAGVFEQQYHQLAGLKPKGNDVYVALDRVRD 153

Query: 144 PHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMH 203
           P N+G ++R+A A    G+I     +   S    ++  G++  +P  R S       +  
Sbjct: 154 PGNLGTVIRTADAVGAKGVILIGDTTDPYSLETVRATMGSVFSVPLYRASEADFLNWRKG 213

Query: 204 SWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKAL 263
             G         +         N  I LI+G E +GL          +A +   G   +L
Sbjct: 214 FSGLVVGTHLKGAVDYRTIPYANKPIILIMGNEQQGLPDSLAGACDKLARIPQAGRADSL 273

Query: 264 NVSNAAAVALYITQN 278
           N++ A  V LY  + 
Sbjct: 274 NLAIATGVMLYEIRR 288


>gi|288941318|ref|YP_003443558.1| TrmH family RNA methyltransferase [Allochromatium vinosum DSM 180]
 gi|288896690|gb|ADC62526.1| RNA methyltransferase, TrmH family, group 3 [Allochromatium vinosum
           DSM 180]
          Length = 247

 Score =  135 bits (339), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 69/240 (28%), Positives = 109/240 (45%), Gaps = 11/240 (4%)

Query: 51  LYGVHTVSAALNNPSRKIFQLLATKNALAR---LDWDANLPHPFPVKTVPPQTIDKIVGK 107
           + G+H+V AAL   +  + ++   +    R      D        ++ V    +++    
Sbjct: 7   VGGIHSVRAALKFGAEGVDEVWLERARRDRRLQELADLAREAGIRLRQVERAELER-AAA 65

Query: 108 EAVHQGLALETAPLLSPT-------LDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCD 160
              HQG         S T       LD +     L++LD V DPHN+GA LR+A A    
Sbjct: 66  GVNHQGALAWVRVPSSRTESDLAALLDRLDVPPFLLLLDEVQDPHNLGACLRTAEAVGVQ 125

Query: 161 GIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPL 220
            +I  K  +   + V+ K ASGA E +PY++++NL   +  +   G   IG + ++   L
Sbjct: 126 AVIAPKDNAVGLTPVVCKVASGAAETLPYVQVTNLARVMDALKERGIWLIGAAGEASDEL 185

Query: 221 EQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
                   + L++GAEG GLR  T+E    +  L M G +++LNVS AA V LY      
Sbjct: 186 YAADLTGPLGLVMGAEGSGLRRLTRERCDRLVRLPMCGQVESLNVSVAAGVCLYEALRQR 245


>gi|212709961|ref|ZP_03318089.1| hypothetical protein PROVALCAL_01012 [Providencia alcalifaciens DSM
           30120]
 gi|212687370|gb|EEB46898.1| hypothetical protein PROVALCAL_01012 [Providencia alcalifaciens DSM
           30120]
          Length = 245

 Score =  135 bits (339), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 72/243 (29%), Positives = 110/243 (45%), Gaps = 10/243 (4%)

Query: 48  NLFLYGVHTVSAALNNPSRKIFQLLATKNALARL---DWDANLPHPFPVKTVPPQTIDKI 104
           +  +YG+H V A L    ++I ++   K    R               V+    Q +D  
Sbjct: 2   SEIIYGIHAVKALLERSPQRIKEVYILKGREDRRLMPIVHEIEALGIVVQVANRQWMDAQ 61

Query: 105 VGKEAVHQGLALETAPLLSP------TLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFS 158
             + AVHQG+     P           L     S  L++LD V DPHN+GA LRSA A  
Sbjct: 62  T-EGAVHQGIIANVLPGKQYQEGDLPDLLESTESPFLLILDGVTDPHNLGACLRSADAAG 120

Query: 159 CDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKK 218
              +I  K  S   +A   K A GA E++P IR++NL   L+ +  +    +G + ++  
Sbjct: 121 VHAVIVPKDKSAQLNATAKKVACGAAENVPLIRVTNLARTLRLLQEYNVWIVGTAGEADH 180

Query: 219 PLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQN 278
            L Q      +AL++GAEG+G+R  T+E    +  + M G + +LNVS A  V L+    
Sbjct: 181 NLYQSKLTGSVALVMGAEGEGMRRLTREHCDELISIPMAGSVSSLNVSVATGVCLFEAVR 240

Query: 279 HFA 281
              
Sbjct: 241 QRI 243


>gi|121634735|ref|YP_974980.1| putative RNA methylase [Neisseria meningitidis FAM18]
 gi|120866441|emb|CAM10187.1| putative RNA methylase [Neisseria meningitidis FAM18]
 gi|254672232|emb|CBA05193.1| putative tRNA/rRNA methyltransferase [Neisseria meningitidis
           alpha275]
 gi|325130080|gb|EGC52867.1| RNA methyltransferase, TrmH family, group 3 [Neisseria meningitidis
           OX99.30304]
 gi|325132185|gb|EGC54881.1| RNA methyltransferase, TrmH family, group 3 [Neisseria meningitidis
           M6190]
 gi|325134100|gb|EGC56753.1| RNA methyltransferase, TrmH family, group 3 [Neisseria meningitidis
           M13399]
 gi|325136132|gb|EGC58741.1| RNA methyltransferase, TrmH family, group 3 [Neisseria meningitidis
           M0579]
 gi|325138117|gb|EGC60690.1| RNA methyltransferase, TrmH family, group 3 [Neisseria meningitidis
           ES14902]
 gi|325142210|gb|EGC64631.1| RNA methyltransferase, TrmH family, group 3 [Neisseria meningitidis
           961-5945]
 gi|325198165|gb|ADY93621.1| RNA methyltransferase, TrmH family, group 3 [Neisseria meningitidis
           G2136]
 gi|325206236|gb|ADZ01689.1| RNA methyltransferase, TrmH family, group 3 [Neisseria meningitidis
           M04-240196]
 gi|325207967|gb|ADZ03419.1| RNA methyltransferase, TrmH family, group 3 [Neisseria meningitidis
           NZ-05/33]
          Length = 250

 Score =  135 bits (339), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 69/238 (28%), Positives = 110/238 (46%), Gaps = 9/238 (3%)

Query: 51  LYGVHTVSAALNNPSRKIFQLLATK---NALARLDWDANLPHPFPVKTVPPQTIDKIVGK 107
           +YG H V+A L    + I +L   +   +   R   +        V       ++ I  K
Sbjct: 7   IYGFHAVNARLWQNPKSIVELYVQEGKNDVRTREVLEKAANENIRVYFADADRLNAIS-K 65

Query: 108 EAVHQGLALET-----APLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGI 162
            A HQG+            L   L+ +    LL++LD + DPHN+GA LR+A A     +
Sbjct: 66  GARHQGVVGFIDASKNHVHLEDVLENLSEPPLLLILDGITDPHNLGACLRTADAMGVHAV 125

Query: 163 ITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQ 222
           I  K  S   +A ++K ASGA E +PYI ++NL   L+++  +G   IG        L  
Sbjct: 126 IAPKDKSAGLNATVSKVASGAAETVPYITVTNLARTLRELKEYGIWIIGTDMGGNADLYH 185

Query: 223 EIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
               D  A ++G EG G+R  T+E    +  + M G ++++NVS +A + L  T+   
Sbjct: 186 CDLPDSAAWVMGNEGDGMRRLTREHCDMLVSIPMFGTVESMNVSVSAGMVLSETRRQR 243


>gi|332521021|ref|ZP_08397481.1| tRNA/rRNA methyltransferase (SpoU) [Lacinutrix algicola 5H-3-7-4]
 gi|332043551|gb|EGI79747.1| tRNA/rRNA methyltransferase (SpoU) [Lacinutrix algicola 5H-3-7-4]
          Length = 266

 Score =  135 bits (339), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 46/256 (17%), Positives = 87/256 (33%), Gaps = 3/256 (1%)

Query: 26  NHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDA 85
            +   K++     KSR   +     + G+  ++ AL         L   +          
Sbjct: 10  QNTLVKQIVLLKDKSRERKKTGLFIVEGLREITLALKGNYNLKTILFYPELCDVNTLESL 69

Query: 86  NLPHPFPVKTVPPQTIDKIVGKEAVHQGLAL-ETAPLLSPTLDAVRNSQLLMVLDHVNDP 144
                  +  +      KI  +E     +A+ +T       L     + L++V +    P
Sbjct: 70  GNL-NAEIIEISKDVYTKIAYRETTEGIIAIAKTKENNFENLSFNTKNPLILVAEAPEKP 128

Query: 145 HNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHS 204
            NIGAILR+A A + D +I                +S        I   +    +  ++S
Sbjct: 129 GNIGAILRTADAANIDAVII-ANPKTDLYNPNIIRSSVGCLFTNQIATGSTEAIINFLNS 187

Query: 205 WGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALN 264
            G           +   ++      A+++G E  GL    +  A     + M G I ++N
Sbjct: 188 KGINIYAAILQESQEYHKQDFTTPTAIVVGTEATGLSNYWRNAAKKNIKIPMQGAIDSMN 247

Query: 265 VSNAAAVALYITQNHF 280
           VS AA + ++  +   
Sbjct: 248 VSVAAGILIFEAKRQR 263


>gi|294672913|ref|YP_003573529.1| TrmH family RNA methyltransferase [Prevotella ruminicola 23]
 gi|294472688|gb|ADE82077.1| RNA methyltransferase, TrmH family [Prevotella ruminicola 23]
          Length = 247

 Score =  135 bits (339), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 47/256 (18%), Positives = 96/256 (37%), Gaps = 20/256 (7%)

Query: 26  NHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDA 85
            +   K + +  QKS    +     + G   +          + + +  KN         
Sbjct: 10  QNAKIKHVVALQQKSSLRREEGLFVVEGQREIEHCKACGYEVVEEYIRDKN--------- 60

Query: 86  NLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDHVNDPH 145
                     V PQ  +K+  + +    +A+      +     ++ S L++VL+ V  P 
Sbjct: 61  ----------VSPQVYEKMAYRGSTEGHIAVVRCKEHTLEKLQLKESPLIVVLESVEKPG 110

Query: 146 NIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSW 205
           N+GAILRSA A   D +I     +   +  + +++ G +       + +  + +  +   
Sbjct: 111 NLGAILRSAEAAGIDALIVCDPLTDMYNPNVIRASIGGVF-CVPTAVCSSQECIAFLKEH 169

Query: 206 GFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNV 265
           G + +                   A+++G E  GL  + +E A +   + M G + +LNV
Sbjct: 170 GIKILTAQLQDSYEYYDYDMTQGTAIVMGTESTGLTNQWREAADAHIRIPMLGRLDSLNV 229

Query: 266 SNAAAVALYITQNHFA 281
           S +AA+ +Y       
Sbjct: 230 SVSAAILMYEAVRQRN 245


>gi|153855859|ref|ZP_01996834.1| hypothetical protein DORLON_02856 [Dorea longicatena DSM 13814]
 gi|149751827|gb|EDM61758.1| hypothetical protein DORLON_02856 [Dorea longicatena DSM 13814]
          Length = 265

 Score =  135 bits (339), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 58/258 (22%), Positives = 112/258 (43%), Gaps = 11/258 (4%)

Query: 32  KMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPS--RKIFQLLATKNALARLDWDANLPH 89
             +  + K  +  +     + G + V  A  +     K++ L   ++   R        H
Sbjct: 8   HDKKMHDKKSYDKKENENIIEGRNAVMEAFRSGKPVDKLYVLDGCQDGAVRSIIREARKH 67

Query: 90  PFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAV-------RNSQLLMVLDHVN 142
              +  V    ++++  +   HQG+    A      ++ +            L++LD++ 
Sbjct: 68  DTILNFVEKDRLNQLS-ETGKHQGVIASVAAYEYAEVEDMLKLAEEKGEDPFLIILDNIE 126

Query: 143 DPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKM 202
           DPHN+GAI+R+A      G+I  KR +   +A +A++++GAL + P  +++NL   ++ +
Sbjct: 127 DPHNLGAIIRTANQAGAHGVIIPKRRAVGLTATVARTSAGALNYTPVAKVTNLVKTMEDL 186

Query: 203 HSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKA 262
              G   +    D     +  +K   I L++G EG+G+    ++T    A + M G I +
Sbjct: 187 KKKGLWFVCADMDGDVMYDVNMK-GPIGLVIGNEGEGVGRLVKDTCDFTARIPMKGDIDS 245

Query: 263 LNVSNAAAVALYITQNHF 280
           LN S AA V  Y      
Sbjct: 246 LNASVAAGVLAYEIVRQR 263


>gi|126665195|ref|ZP_01736178.1| RNA methyltransferase, TrmH family, group 3 [Marinobacter sp.
           ELB17]
 gi|126630565|gb|EBA01180.1| RNA methyltransferase, TrmH family, group 3 [Marinobacter sp.
           ELB17]
          Length = 266

 Score =  135 bits (339), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 66/242 (27%), Positives = 113/242 (46%), Gaps = 12/242 (4%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLAT---KNALARLDWDANLPHPFPVKTVPPQTIDKIVG 106
           F++G H V A L     ++ Q+      ++   +   +         + V  + +D    
Sbjct: 24  FVFGWHAVEAVLKREPERLLQVWIQTGRQDKRVKSTTELLDTLGVSWEIVHRKLLD--SR 81

Query: 107 KEAVHQGLALETAPLLSPTLD-------AVRNSQLLMVLDHVNDPHNIGAILRSAVAFSC 159
              VHQG+    +     + D              L++LD V DPHN+GA +R+A A   
Sbjct: 82  VAGVHQGIVASVSESREWSEDDLLAMLANSEKPPFLLILDGVTDPHNLGACMRTADAVGV 141

Query: 160 DGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKP 219
             +I  K  S + + V  K A GA E +P++R++NL   L+ +   G   +G + ++   
Sbjct: 142 QAVIVPKDKSATLTPVARKVACGAAETVPFVRVTNLARLLRTLQEQGVWLVGTAGEASIT 201

Query: 220 LEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNH 279
           L Q      +AL++GAEGKG+R  T+E    + ++ M G +++LNVS A+ V LY     
Sbjct: 202 LHQADLTGPLALVMGAEGKGMRRLTREHCDQLINIPMVGDVESLNVSVASGVCLYEALRQ 261

Query: 280 FA 281
            +
Sbjct: 262 RS 263


>gi|119471828|ref|ZP_01614161.1| 23S rRNA (Gm2251)-methyltransferase [Alteromonadales bacterium
           TW-7]
 gi|119445318|gb|EAW26607.1| 23S rRNA (Gm2251)-methyltransferase [Alteromonadales bacterium
           TW-7]
          Length = 247

 Score =  135 bits (339), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 64/242 (26%), Positives = 106/242 (43%), Gaps = 8/242 (3%)

Query: 48  NLFLYGVHTVSAALNNPSRKIFQLLATKNALARL---DWDANLPHPFPVKTVPPQTIDKI 104
           N  ++G H+V A L     +  ++ A K    +      D        V+ +  + +D  
Sbjct: 3   NELIFGFHSVEAILAKEPERFLEIYALKGRDDKRLTPIIDEARKFGISVQFMQRKALDNK 62

Query: 105 VGKEAVHQGLALETAPLLSPTLD-----AVRNSQLLMVLDHVNDPHNIGAILRSAVAFSC 159
              E     +A   A       D     A   +  L+VLD + DPHN+GA LRSA A   
Sbjct: 63  SKDEQHQGIIANVKAAPTYNEKDLDVIIAREETPFLLVLDGITDPHNLGACLRSADAAGV 122

Query: 160 DGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKP 219
             II  K  S   +    K A GA E +P I+++NL   L+++   G   +G + ++   
Sbjct: 123 HAIIVPKDKSAKLNGTARKVACGAAETVPLIQVTNLARTLREIKDAGVWVVGTAGETDTH 182

Query: 220 LEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNH 279
           +        +A+++GAEG+G+R  T+E    +  + M G + +LNVS A  + L+     
Sbjct: 183 VFDASLTGPMAIVMGAEGEGMRRLTREHCDVLVKIPMAGSVSSLNVSVATGICLFEVLRQ 242

Query: 280 FA 281
             
Sbjct: 243 RN 244


>gi|116872590|ref|YP_849371.1| rRNA methyltransferase [Listeria welshimeri serovar 6b str.
           SLCC5334]
 gi|116741468|emb|CAK20592.1| rRNA methyltransferase, TrmH family [Listeria welshimeri serovar 6b
           str. SLCC5334]
          Length = 252

 Score =  135 bits (339), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 55/278 (19%), Positives = 107/278 (38%), Gaps = 26/278 (9%)

Query: 1   MNLISKKKSEKIFSLKDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAA 60
           M  I   K++++ + K                        +   +     + G H V  A
Sbjct: 1   MEQIQSIKNDRVKTWKKLQT-------------------RKGRDKTGTYLVEGFHLVEEA 41

Query: 61  LNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAP 120
           L      + +LL +       +W   L   + V  +    I  ++ +    QG+      
Sbjct: 42  LRQDG-LVLELLVSSGVSVPEEW---LKGDYDVFEIS-AEISHLISETMTEQGVFAVVTI 96

Query: 121 LLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSA 180
                   +   + L+++D V DP N+G ++R+A A   D +I  +  +   +  + +S 
Sbjct: 97  SE--PDMMLLYGKKLLLVDAVQDPGNVGTLIRTADAAGYDCVILGRGSADLYNPKVIRST 154

Query: 181 SGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGL 240
            G+  HIP I+                    +  +  K L    K + +AL++G EG G+
Sbjct: 155 QGSHFHIPVIQADLFDWIANLEEEGVPVIGAVLDEQAKSLNDMPKRETLALMVGNEGNGI 214

Query: 241 RPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQN 278
            P+ QE  +   ++ + G  ++LNV+ AA + LY  + 
Sbjct: 215 SPELQERLSEKVYIPIYGDSESLNVAVAAGILLYGLRK 252


>gi|315302761|ref|ZP_07873535.1| RNA methyltransferase [Listeria ivanovii FSL F6-596]
 gi|313628869|gb|EFR97228.1| RNA methyltransferase [Listeria ivanovii FSL F6-596]
          Length = 252

 Score =  135 bits (339), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 57/278 (20%), Positives = 106/278 (38%), Gaps = 26/278 (9%)

Query: 1   MNLISKKKSEKIFSLKDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAA 60
           M  I   K++++ + K                        +   +     + G H V  A
Sbjct: 1   MEQIQSVKNDRVKTWKKLQT-------------------RKGRDKTGTYLVEGFHLVEEA 41

Query: 61  LNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAP 120
           L+     + +LL +K+     +W   L   + V  +  +    I          A+    
Sbjct: 42  LHQDGLVV-ELLVSKDVSVPEEW---LKGNYDVFEISTEISHFISETMTEQGVFAVVATT 97

Query: 121 LLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSA 180
                L   +    L+++D V DP N+G ++R+A A   D +I  +  +   +  + +S 
Sbjct: 98  EPDMMLLYGKK---LLLVDAVQDPGNVGTLIRTADAAGYDAVILGRGSADLYNPKVIRST 154

Query: 181 SGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGL 240
            G+  HIP I+ +                  +     K L    K D +ALI+G EGKG+
Sbjct: 155 QGSHFHIPVIQANLFDWIANLEEEGVPVIGAVLDAQAKSLNDISKRDTLALIVGNEGKGI 214

Query: 241 RPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQN 278
             + Q   +   ++ + G  ++LNV+ AA + LY  + 
Sbjct: 215 SEELQARLSEKVYIPIYGKSESLNVAVAAGILLYGLRK 252


>gi|154706093|ref|YP_001424432.1| 23S rRNA Gm2251 methyltransferase [Coxiella burnetii Dugway
           5J108-111]
 gi|164685717|ref|ZP_01945643.2| RNA methyltransferase, TrmH family, group 3 [Coxiella burnetii 'MSU
           Goat Q177']
 gi|165918586|ref|ZP_02218672.1| RNA methyltransferase, TrmH family, group 3 [Coxiella burnetii RSA
           334]
 gi|212218447|ref|YP_002305234.1| 23S rRNA Gm2251 methyltransferase [Coxiella burnetii CbuK_Q154]
 gi|154355379|gb|ABS76841.1| 23S rRNA Gm2251 methyltransferase [Coxiella burnetii Dugway
           5J108-111]
 gi|164601225|gb|EAX33789.2| RNA methyltransferase, TrmH family, group 3 [Coxiella burnetii 'MSU
           Goat Q177']
 gi|165917714|gb|EDR36318.1| RNA methyltransferase, TrmH family, group 3 [Coxiella burnetii RSA
           334]
 gi|212012709|gb|ACJ20089.1| 23S rRNA Gm2251 methyltransferase [Coxiella burnetii CbuK_Q154]
          Length = 270

 Score =  135 bits (339), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 70/240 (29%), Positives = 119/240 (49%), Gaps = 12/240 (5%)

Query: 51  LYGVHTVSAALNNPSRKIFQLLATKNAL-ARLDWDANLPHP--FPVKTVPPQTIDKIVGK 107
           +YG+H VSA L+   ++I +L   +N    RL             V  +    ++ +  +
Sbjct: 27  IYGIHAVSAVLDAAPQRIVKLYVQENRDDQRLQSLVEKAKGLGVKVILLSRTELNTLSNE 86

Query: 108 EAVHQGLALETAPLLSPT-------LDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCD 160
           +  HQG+  +   + +         L       LL++LD V DPHN+GA LRSA AF   
Sbjct: 87  K--HQGIVADCEEVENLDESALLSLLKKRETPALLLILDGVKDPHNLGACLRSANAFGVR 144

Query: 161 GIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPL 220
            +I  K  +   + V+ K A GA E  P+IR++NL+  +  +   G   +G + +++  +
Sbjct: 145 AVIAPKDRAVGVTPVVRKVACGAAEMTPFIRVTNLSRTIDWLQKEGVWIVGTAVEAETLI 204

Query: 221 EQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
           ++      IA++LG+EG GLR  T+E    +A + + G +++LNVS A  + LY  Q   
Sbjct: 205 QEIDLTGDIAIVLGSEGAGLRRLTKERCDFLAQIPLRGSVESLNVSVACGICLYEVQRQR 264


>gi|91775978|ref|YP_545734.1| RNA methyltransferase TrmH, group 3 [Methylobacillus flagellatus
           KT]
 gi|91709965|gb|ABE49893.1| 23S rRNA Gm-2251 2'-O-methyltransferase [Methylobacillus
           flagellatus KT]
          Length = 251

 Score =  135 bits (339), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 71/242 (29%), Positives = 113/242 (46%), Gaps = 10/242 (4%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLATKN---ALARLDWDANLPHPFPVKTVPPQTIDKIVG 106
            L+G H V + L   +  + ++L  ++   A  +            V  V    +D + G
Sbjct: 6   ILFGFHAVLSRLRQHAASVQEVLVDQDRVDARMKDLLQMAEGANVRVMHVERARLDGMAG 65

Query: 107 KEAVHQGLALETAPLLSPTLDAV-------RNSQLLMVLDHVNDPHNIGAILRSAVAFSC 159
             A HQG+         P  D         +     +VLD V DPHN+GA LR A A   
Sbjct: 66  GNARHQGVIARVVDTPIPYKDIHDILESDLKEPPFFLVLDGVEDPHNLGACLRVADAMGV 125

Query: 160 DGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKP 219
             +I  K  +   +A + K A GA E +P+I ++NL   L+++   G   +G ++++   
Sbjct: 126 HAVIAPKDRAAGLNATVRKVACGAAETVPFIAVTNLARTLRELKDAGVFIVGAAAEADAD 185

Query: 220 LEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNH 279
           L     +  +AL+LGAEG GLR  TQET  S+  + M G +++LNVS A+ + LY  +  
Sbjct: 186 LPSTNLSGPLALVLGAEGSGLRRLTQETCDSLISIPMFGSVESLNVSVASGICLYEARRQ 245

Query: 280 FA 281
             
Sbjct: 246 RI 247


>gi|24375422|ref|NP_719465.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Shewanella oneidensis
           MR-1]
 gi|52783315|sp|Q8EAG8|RLMB_SHEON RecName: Full=23S rRNA (guanosine-2'-O-)-methyltransferase RlmB;
           AltName: Full=23S rRNA Gm2251 2'-O-methyltransferase
 gi|24350263|gb|AAN56909.1|AE015825_8 RNA methyltransferase, TrmH family, group 3 [Shewanella oneidensis
           MR-1]
          Length = 246

 Score =  135 bits (339), Expect = 9e-30,   Method: Composition-based stats.
 Identities = 66/244 (27%), Positives = 112/244 (45%), Gaps = 10/244 (4%)

Query: 46  PENLFLYGVHTVSAALNNPSRKIFQLLATKNA-LARLDWDANLPH--PFPVKTVPPQTID 102
            +   ++G+H V A L +   +I +L   +     RL             ++    + +D
Sbjct: 2   KKQDIIFGIHAVEALLKHSPERIIELWLLQGREDERLTPLIRQAKAFGTSIQVTSRKVLD 61

Query: 103 KIVGKEAVHQGLALETA------PLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVA 156
           +   +   HQG+                 L A  +   L++LD V DPHN+GA LR+A A
Sbjct: 62  EKA-ESTQHQGIVARVKAAKILAEHDLDELLAKTDLPFLLILDGVTDPHNLGACLRNADA 120

Query: 157 FSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDS 216
               GII  K  S   +AV++K A GA E +P  +++NL   ++ +   G   +G + ++
Sbjct: 121 AGVQGIIVPKDNSVGLTAVVSKVACGAAETVPLFQVTNLARTMRHLQEKGVWIVGTAGEA 180

Query: 217 KKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYIT 276
              L Q      +A+ +GAEGKGLR  ++E   ++  + M G + +LNVS A  + L+  
Sbjct: 181 DCELYQADLKGPLAIAMGAEGKGLRRLSRECCDTLVSIPMSGSVSSLNVSVATGICLFEA 240

Query: 277 QNHF 280
               
Sbjct: 241 VRQR 244


>gi|62289126|ref|YP_220919.1| RNA methyltransferase [Brucella abortus bv. 1 str. 9-941]
 gi|62195258|gb|AAX73558.1| RNA methyltransferase, TrmH family [Brucella abortus bv. 1 str.
           9-941]
          Length = 297

 Score =  135 bits (339), Expect = 9e-30,   Method: Composition-based stats.
 Identities = 48/255 (18%), Positives = 85/255 (33%), Gaps = 4/255 (1%)

Query: 27  HRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDAN 86
           +   K ++S   K +   Q       G+  V  AL    R    + A      +      
Sbjct: 35  NPIVKDLRSLALK-KFRDQQGVFLAEGLKLVIDALEQDWRIKTLVFAKSGKGNKTVEQVA 93

Query: 87  ---LPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDHVND 143
                    V  V  + I  I  ++ +     +             + + + + LD V D
Sbjct: 94  TRTFAKGGLVLEVTEKVISAITRRDNLQMVAGVFEQQYHQLAGLKPKGNDVYVALDRVRD 153

Query: 144 PHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMH 203
           P N+G ++R+A A    G+I     +   S    ++  G++  +P  R S       +  
Sbjct: 154 PGNLGTVIRTADAVGAKGVILIGDTTDPYSLETVRATMGSVFSVPLYRASEADFLNWRKG 213

Query: 204 SWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKAL 263
             G         +         N  I LI+G E +GL          +A +   G   +L
Sbjct: 214 FSGLVVGTHLKGAVDYRTIPYANKPIILIMGNEQQGLPDSLAGACDKLARIPQAGRADSL 273

Query: 264 NVSNAAAVALYITQN 278
           N++ A  V LY  + 
Sbjct: 274 NLAIATGVMLYEIRR 288


>gi|295694816|ref|YP_003588054.1| RNA methyltransferase, TrmH family, group 3 [Bacillus tusciae DSM
           2912]
 gi|295410418|gb|ADG04910.1| RNA methyltransferase, TrmH family, group 3 [Bacillus tusciae DSM
           2912]
          Length = 268

 Score =  134 bits (338), Expect = 9e-30,   Method: Composition-based stats.
 Identities = 65/253 (25%), Positives = 111/253 (43%), Gaps = 12/253 (4%)

Query: 39  KSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNAL---ARLDWDANLPHPFPVKT 95
           + R   + +   + G   V   L    R + +L   + A                  +  
Sbjct: 16  RRRVQGESQRRRVVGRQPVLELLRAG-RPVNRLFIAEGAEGGSMAEITARAKEAGIVIIR 74

Query: 96  VPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAV-------RNSQLLMVLDHVNDPHNIG 148
           VP   +D+       HQG+  + AP     LD         R   L ++LD + DPHN+G
Sbjct: 75  VPRNRLDEWAS-GVNHQGVMADVAPFAYADLDECLRAAKLHRRPGLFVLLDGIEDPHNLG 133

Query: 149 AILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQ 208
           +ILR+A A + DG++  KR + + +  + K+++GA E +P IR+ NL   +  +   G++
Sbjct: 134 SILRTAEACAVDGVVVPKRRAAAVNETVVKASAGAAEFVPVIRVGNLGQTILALKRSGYR 193

Query: 209 TIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNA 268
            +G  ++ +            AL++G EGKGL    +E    + H+ M G + +LN   A
Sbjct: 194 VVGADTEGECDYTDVDYRVPTALVIGGEGKGLGRLVRERCDEVVHIPMAGRVNSLNAGVA 253

Query: 269 AAVALYITQNHFA 281
           A V LY      +
Sbjct: 254 AGVLLYEAIRQRS 266


>gi|317049748|ref|YP_004117396.1| TrmH family RNA methyltransferase [Pantoea sp. At-9b]
 gi|316951365|gb|ADU70840.1| RNA methyltransferase, TrmH family, group 3 [Pantoea sp. At-9b]
          Length = 244

 Score =  134 bits (338), Expect = 9e-30,   Method: Composition-based stats.
 Identities = 68/242 (28%), Positives = 111/242 (45%), Gaps = 10/242 (4%)

Query: 48  NLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDW---DANLPHPFPVKTVPPQTIDKI 104
           +  ++G+H V A L    ++  ++   K    R       A       V+    Q +D  
Sbjct: 2   SEIIFGIHAVQALLERDPQRFQEVFILKGRDDRRLQPLVAALEAQGIAVQLANRQWLDSQ 61

Query: 105 VGKEAVHQGLALETAPLLSP------TLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFS 158
           V +  VHQG+     P  +        L     +  L++LD V DPHN+GA LRSA A  
Sbjct: 62  V-EGGVHQGIVARVKPGKNYQEGDLPDLLESIENPFLLILDGVTDPHNLGACLRSADAAG 120

Query: 159 CDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKK 218
              +I  K  S   +A   K A GA E++P IR++NL   ++ +  +    +G + ++  
Sbjct: 121 VHAVIVPKDRSAQLNATAKKVACGAAENVPLIRVTNLARTMRLLQEYQIWIVGTAGEADH 180

Query: 219 PLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQN 278
            L Q      +AL++GAEG+G+R  T+E    +  + M G + +LNVS A  + L+    
Sbjct: 181 TLYQSKLPAALALVMGAEGEGMRRLTREHCDELISIPMAGSVSSLNVSVATGICLFEAVR 240

Query: 279 HF 280
             
Sbjct: 241 QR 242


>gi|117919150|ref|YP_868342.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Shewanella sp. ANA-3]
 gi|117611482|gb|ABK46936.1| RNA methyltransferase, TrmH family, group 3 [Shewanella sp. ANA-3]
          Length = 246

 Score =  134 bits (338), Expect = 9e-30,   Method: Composition-based stats.
 Identities = 66/244 (27%), Positives = 111/244 (45%), Gaps = 10/244 (4%)

Query: 46  PENLFLYGVHTVSAALNNPSRKIFQLLATKNA-LARLDWDANLPH--PFPVKTVPPQTID 102
            +   ++G+H V A L +   +I +L   +     RL             ++    + +D
Sbjct: 2   KKQDIIFGIHAVEALLKHSPERIIELWLLQGREDERLTPLIRQAKAFGTSIQVTSRKVLD 61

Query: 103 KIVGKEAVHQGLALETA------PLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVA 156
               + A HQG+                 L    +   L++LD V DPHN+GA LR+A A
Sbjct: 62  DKA-ESAQHQGIVARVKAAKILGEHDLDELLGKTDLPFLLILDGVTDPHNLGACLRNADA 120

Query: 157 FSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDS 216
               GII  K  S   +AV++K A GA E +P  +++NL   ++ +   G   +G + ++
Sbjct: 121 AGVQGIIVPKDNSVGLTAVVSKVACGAAETVPLFQVTNLARTMRHLQEKGVWIVGTAGEA 180

Query: 217 KKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYIT 276
              L Q      +A+ +GAEGKGLR  ++E   ++  + M G + +LNVS A  + L+  
Sbjct: 181 DCELYQADLKGPLAIAMGAEGKGLRRLSRECCDTLVSIPMAGSVSSLNVSVATGICLFEA 240

Query: 277 QNHF 280
               
Sbjct: 241 VRQR 244


>gi|134094504|ref|YP_001099579.1| tRNA (guanosine-2'-O-)-methyltransferase [Herminiimonas
           arsenicoxydans]
 gi|133738407|emb|CAL61452.1| 23S rRNA (guanosine-2'-O-)-methyltransferase RlmB (23S rRNA Gm2251
           2'-O-methyltransferase) [Herminiimonas arsenicoxydans]
          Length = 247

 Score =  134 bits (338), Expect = 9e-30,   Method: Composition-based stats.
 Identities = 71/238 (29%), Positives = 114/238 (47%), Gaps = 7/238 (2%)

Query: 51  LYGVHTVSAALNNPSRKIFQLLA---TKNALARLDWDANLPHPFPVKTVPPQTIDKIVGK 107
           ++G H V+A L + +  + ++       +   +    A       +       +  IVG 
Sbjct: 6   IFGFHAVTARLRHEASSVEEIYIDASRHDQRMKDLIRAAEAAKVRIIAADDARLSSIVGT 65

Query: 108 EAVHQGLAL----ETAPLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGII 163
                 +A       A  L   LDA+    LL+VLD + DPHN+GA LR A       +I
Sbjct: 66  RRHQGVVAKAGELSLARNLDELLDAIDGPPLLLVLDGITDPHNLGACLRVADGAGAHAVI 125

Query: 164 TTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQE 223
             K  +   +A  AK ASGA + +PYI ++NL   L+++       IG + DS+K L + 
Sbjct: 126 APKDRAVGLNATAAKVASGAADTVPYITVTNLARTLRELKERDILLIGTTDDSEKGLYEA 185

Query: 224 IKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHFA 281
             +   ALI+G+EG+G+R  T+ET   +  + M G +++LNVS A+ V LY  +    
Sbjct: 186 DFSGPAALIMGSEGEGMRRLTRETCDVLVSIPMFGSVESLNVSVASGVCLYEARRQRI 243


>gi|113971595|ref|YP_735388.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Shewanella sp. MR-4]
 gi|113886279|gb|ABI40331.1| RNA methyltransferase, TrmH family, group 3 [Shewanella sp. MR-4]
          Length = 246

 Score =  134 bits (338), Expect = 9e-30,   Method: Composition-based stats.
 Identities = 66/244 (27%), Positives = 111/244 (45%), Gaps = 10/244 (4%)

Query: 46  PENLFLYGVHTVSAALNNPSRKIFQLLATKNA-LARLDWDANLPH--PFPVKTVPPQTID 102
            +   ++G+H V A L +   +I +L   +     RL             ++    + +D
Sbjct: 2   KKQDIIFGIHAVEALLKHSPERIIELWLLQGREDERLTPLIRQAKSFGTSIQVTSRKVLD 61

Query: 103 KIVGKEAVHQGLALETA------PLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVA 156
               +   HQG+                 L A  +   L++LD V DPHN+GA LR+A A
Sbjct: 62  DKA-ESTQHQGIVARVKAAKILAEHDLDELLAKTDLPFLLILDGVTDPHNLGACLRNADA 120

Query: 157 FSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDS 216
               GII  K  S   +AV++K A GA E +P  +++NL   ++ +   G   +G + ++
Sbjct: 121 AGVQGIIVPKDNSVGLTAVVSKVACGAAETVPLFQVTNLARTMRHLQEKGVWIVGTAGEA 180

Query: 217 KKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYIT 276
              L Q      +A+ +GAEGKGLR  ++E   ++  + M G + +LNVS A  + L+  
Sbjct: 181 DCELYQADLKGPLAIAMGAEGKGLRRLSRECCDTLVSIPMAGSVSSLNVSVATGICLFEA 240

Query: 277 QNHF 280
               
Sbjct: 241 VRQR 244


>gi|238764700|ref|ZP_04625644.1| 23S rRNA (guanosine-2'-O-)-methyltransferase rlmB [Yersinia
           kristensenii ATCC 33638]
 gi|238697096|gb|EEP89869.1| 23S rRNA (guanosine-2'-O-)-methyltransferase rlmB [Yersinia
           kristensenii ATCC 33638]
          Length = 246

 Score =  134 bits (338), Expect = 9e-30,   Method: Composition-based stats.
 Identities = 67/242 (27%), Positives = 109/242 (45%), Gaps = 8/242 (3%)

Query: 48  NLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANL---PHPFPVKTVPPQTIDKI 104
           +  +YG+H+V A L+N  ++  ++   K    R               ++    Q +D  
Sbjct: 2   SEIIYGIHSVKALLDNDPQRFLEVFILKGRDDRRLQPLIAELEAAGLVIQVASRQWLDSQ 61

Query: 105 VGKEAVHQGLALETAPLLSPTLDAVR-----NSQLLMVLDHVNDPHNIGAILRSAVAFSC 159
           V        +A           D         +  L+VLD V DPHN+GA LRSA A   
Sbjct: 62  VEGGVHQGIVARVREGRQYQENDLPALLESVETPFLLVLDGVTDPHNLGACLRSADAAGV 121

Query: 160 DGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKP 219
             +I  +  S   +A+  K ASGA E++P I+++NL   L+ +       +G + ++   
Sbjct: 122 HAVIVPRDRSAQLNAIAKKVASGAAENVPLIKVTNLARTLRVLQEHNVWIVGTAGEADHT 181

Query: 220 LEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNH 279
           L Q      +AL++GAEG+G+R  T+E    +  + M G + +LNVS A  V L+     
Sbjct: 182 LYQSKMTGPMALVMGAEGEGMRRLTREHCDELISIPMAGSVSSLNVSVATGVCLFEAVRQ 241

Query: 280 FA 281
            A
Sbjct: 242 RA 243


>gi|123440768|ref|YP_001004760.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Yersinia
           enterocolitica subsp. enterocolitica 8081]
 gi|122087729|emb|CAL10514.1| putative methylase [Yersinia enterocolitica subsp. enterocolitica
           8081]
          Length = 246

 Score =  134 bits (338), Expect = 9e-30,   Method: Composition-based stats.
 Identities = 67/242 (27%), Positives = 109/242 (45%), Gaps = 8/242 (3%)

Query: 48  NLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANL---PHPFPVKTVPPQTIDKI 104
           +  +YG+H+V A L+N  ++  ++   K    R               ++    Q +D  
Sbjct: 2   SEIIYGIHSVKALLDNDPQRFLEVFILKGRDDRRLQPLIAELEAAGLVIQVASRQWLDSQ 61

Query: 105 VGKEAVHQGLALETAPLLSPTLDAVR-----NSQLLMVLDHVNDPHNIGAILRSAVAFSC 159
           V        +A           D         +  L+VLD V DPHN+GA LRSA A   
Sbjct: 62  VEGGVHQGIVARVREGRQYQENDLPALLESVETPFLLVLDGVTDPHNLGACLRSADAAGV 121

Query: 160 DGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKP 219
             +I  +  S   +A+  K ASGA E++P I+++NL   L+ +       +G + ++   
Sbjct: 122 HAVIVPRDRSAQLNAIAKKVASGAAENVPLIKVTNLARTLRVLQEHNVWIVGTAGEADHT 181

Query: 220 LEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNH 279
           L Q      +AL++GAEG+G+R  T+E    +  + M G + +LNVS A  V L+     
Sbjct: 182 LYQSKMTGPMALVMGAEGEGMRRLTREHCDELISIPMAGSVSSLNVSVATGVCLFEAVRQ 241

Query: 280 FA 281
            A
Sbjct: 242 RA 243


>gi|167758883|ref|ZP_02431010.1| hypothetical protein CLOSCI_01228 [Clostridium scindens ATCC 35704]
 gi|167663623|gb|EDS07753.1| hypothetical protein CLOSCI_01228 [Clostridium scindens ATCC 35704]
          Length = 250

 Score =  134 bits (338), Expect = 9e-30,   Method: Composition-based stats.
 Identities = 61/250 (24%), Positives = 107/250 (42%), Gaps = 9/250 (3%)

Query: 41  RHTSQPENLFLYGVHTVSAALNNPS--RKIFQLLATKNALARLDWDANLPHPFPVKTVPP 98
           +   Q     + G + V  A  +     K+F L   ++   R        H   ++ V  
Sbjct: 2   KEDKQINENIIEGRNAVLEAFRSGKPIDKLFVLDGCQDGPIRTIVREAKKHDTILQFVTK 61

Query: 99  QTIDKIVGKEAVHQGLALETAPLLSPTLDAVR------NSQLLMVLDHVNDPHNIGAILR 152
           + + +I         +A   A   +   D ++          L++LD++ DPHN+GAI+R
Sbjct: 62  ERLSQISETGRHQGVIAYAAAYEYADVEDMLKLAESKGEDPFLILLDNIEDPHNLGAIIR 121

Query: 153 SAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGL 212
           +A      G+I  KR +   +A +AK+++GAL + P  +++NL   ++ +   G   +  
Sbjct: 122 TANLAGAHGVIIPKRRAVGLTATVAKTSAGALNYTPVAKVTNLAKTMESLKEKGLWFVCA 181

Query: 213 SSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVA 272
                + +        I LI+G EG+G+    +ET    A + M G I +LN S AA V 
Sbjct: 182 -DMGGEEMYDLNLTGPIGLIIGNEGEGVSRLVKETCDFTARIPMNGDIDSLNASVAAGVL 240

Query: 273 LYITQNHFAK 282
            Y       K
Sbjct: 241 AYEIVRQRRK 250


>gi|16767615|ref|NP_463230.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Salmonella enterica
           subsp. enterica serovar Typhimurium str. LT2]
 gi|56416160|ref|YP_153235.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Salmonella enterica
           subsp. enterica serovar Paratyphi A str. ATCC 9150]
 gi|62182815|ref|YP_219232.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Salmonella enterica
           subsp. enterica serovar Choleraesuis str. SC-B67]
 gi|161617640|ref|YP_001591605.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Salmonella enterica
           subsp. enterica serovar Paratyphi B str. SPB7]
 gi|167994986|ref|ZP_02576076.1| RNA methyltransferase, TrmH family, group 3 [Salmonella enterica
           subsp. enterica serovar 4,[5],12:i:- str. CVM23701]
 gi|168231407|ref|ZP_02656465.1| RNA methyltransferase, TrmH family, group 3 [Salmonella enterica
           subsp. enterica serovar Kentucky str. CDC 191]
 gi|168239664|ref|ZP_02664722.1| RNA methyltransferase, TrmH family, group 3 [Salmonella enterica
           subsp. enterica serovar Schwarzengrund str. SL480]
 gi|168245157|ref|ZP_02670089.1| RNA methyltransferase, TrmH family, group 3 [Salmonella enterica
           subsp. enterica serovar Heidelberg str. SL486]
 gi|168822505|ref|ZP_02834505.1| RNA methyltransferase, TrmH family, group 3 [Salmonella enterica
           subsp. enterica serovar Weltevreden str. HI_N05-537]
 gi|194444737|ref|YP_002043624.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Salmonella enterica
           subsp. enterica serovar Newport str. SL254]
 gi|194449058|ref|YP_002048412.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Salmonella enterica
           subsp. enterica serovar Heidelberg str. SL476]
 gi|194469123|ref|ZP_03075107.1| RNA methyltransferase, TrmH family, group 3 [Salmonella enterica
           subsp. enterica serovar Kentucky str. CVM29188]
 gi|194734163|ref|YP_002117310.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Salmonella enterica
           subsp. enterica serovar Schwarzengrund str. CVM19633]
 gi|197263055|ref|ZP_03163129.1| RNA methyltransferase, TrmH family, group 3 [Salmonella enterica
           subsp. enterica serovar Saintpaul str. SARA23]
 gi|197365085|ref|YP_002144722.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Salmonella enterica
           subsp. enterica serovar Paratyphi A str. AKU_12601]
 gi|204927331|ref|ZP_03218533.1| RNA methyltransferase, TrmH family, group 3 [Salmonella enterica
           subsp. enterica serovar Javiana str. GA_MM04042433]
 gi|213428664|ref|ZP_03361414.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Salmonella enterica
           subsp. enterica serovar Typhi str. E02-1180]
 gi|213582911|ref|ZP_03364737.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Salmonella enterica
           subsp. enterica serovar Typhi str. E98-0664]
 gi|213852966|ref|ZP_03382498.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Salmonella enterica
           subsp. enterica serovar Typhi str. M223]
 gi|224586209|ref|YP_002640008.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Salmonella enterica
           subsp. enterica serovar Paratyphi C strain RKS4594]
 gi|238910527|ref|ZP_04654364.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Salmonella enterica
           subsp. enterica serovar Tennessee str. CDC07-0191]
 gi|289829973|ref|ZP_06547424.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Salmonella enterica
           subsp. enterica serovar Typhi str. E98-3139]
 gi|52783321|sp|Q8ZKA2|RLMB_SALTY RecName: Full=23S rRNA (guanosine-2'-O-)-methyltransferase RlmB;
           AltName: Full=23S rRNA Gm2251 2'-O-methyltransferase
 gi|16422930|gb|AAL23189.1| putative tRNA/rRNA methyltransferase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. LT2]
 gi|56130417|gb|AAV79923.1| probable tRNA/rRNA methyltransferase [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. ATCC 9150]
 gi|62130448|gb|AAX68151.1| putative tRNA/rRNA methyltransferase [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. SC-B67]
 gi|161367004|gb|ABX70772.1| hypothetical protein SPAB_05503 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|194403400|gb|ACF63622.1| RNA methyltransferase, TrmH family, group 3 [Salmonella enterica
           subsp. enterica serovar Newport str. SL254]
 gi|194407362|gb|ACF67581.1| RNA methyltransferase, TrmH family, group 3 [Salmonella enterica
           subsp. enterica serovar Heidelberg str. SL476]
 gi|194455487|gb|EDX44326.1| RNA methyltransferase, TrmH family, group 3 [Salmonella enterica
           subsp. enterica serovar Kentucky str. CVM29188]
 gi|194709665|gb|ACF88886.1| RNA methyltransferase, TrmH family, group 3 [Salmonella enterica
           subsp. enterica serovar Schwarzengrund str. CVM19633]
 gi|197096562|emb|CAR62172.1| probable tRNA/rRNA methyltransferase [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. AKU_12601]
 gi|197241310|gb|EDY23930.1| RNA methyltransferase, TrmH family, group 3 [Salmonella enterica
           subsp. enterica serovar Saintpaul str. SARA23]
 gi|197287651|gb|EDY27042.1| RNA methyltransferase, TrmH family, group 3 [Salmonella enterica
           subsp. enterica serovar Schwarzengrund str. SL480]
 gi|204323996|gb|EDZ09191.1| RNA methyltransferase, TrmH family, group 3 [Salmonella enterica
           subsp. enterica serovar Javiana str. GA_MM04042433]
 gi|205327237|gb|EDZ14001.1| RNA methyltransferase, TrmH family, group 3 [Salmonella enterica
           subsp. enterica serovar 4,[5],12:i:- str. CVM23701]
 gi|205334208|gb|EDZ20972.1| RNA methyltransferase, TrmH family, group 3 [Salmonella enterica
           subsp. enterica serovar Kentucky str. CDC 191]
 gi|205336077|gb|EDZ22841.1| RNA methyltransferase, TrmH family, group 3 [Salmonella enterica
           subsp. enterica serovar Heidelberg str. SL486]
 gi|205341078|gb|EDZ27842.1| RNA methyltransferase, TrmH family, group 3 [Salmonella enterica
           subsp. enterica serovar Weltevreden str. HI_N05-537]
 gi|224470737|gb|ACN48567.1| putative tRNA/rRNA methyltransferase [Salmonella enterica subsp.
           enterica serovar Paratyphi C strain RKS4594]
 gi|261249459|emb|CBG27324.1| probable tRNA/rRNA methyltransferase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. D23580]
 gi|267996701|gb|ACY91586.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Salmonella enterica
           subsp. enterica serovar Typhimurium str. 14028S]
 gi|301160857|emb|CBW20388.1| probable tRNA/rRNA methyltransferase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. SL1344]
 gi|312915467|dbj|BAJ39441.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Salmonella enterica
           subsp. enterica serovar Typhimurium str. T000240]
 gi|320088796|emb|CBY98554.1| hypothetical tRNA/rRNA methyltransferase [Salmonella enterica
           subsp. enterica serovar Weltevreden str. 2007-60-3289-1]
 gi|321222665|gb|EFX47737.1| 23S rRNA guanosine-2'-O- -methyltransferase rlmB [Salmonella
           enterica subsp. enterica serovar Typhimurium str.
           TN061786]
 gi|322615531|gb|EFY12451.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Salmonella enterica
           subsp. enterica serovar Montevideo str. 315996572]
 gi|322618591|gb|EFY15480.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Salmonella enterica
           subsp. enterica serovar Montevideo str. 495297-1]
 gi|322621996|gb|EFY18846.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Salmonella enterica
           subsp. enterica serovar Montevideo str. 495297-3]
 gi|322627720|gb|EFY24511.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Salmonella enterica
           subsp. enterica serovar Montevideo str. 495297-4]
 gi|322631027|gb|EFY27791.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Salmonella enterica
           subsp. enterica serovar Montevideo str. 515920-1]
 gi|322637754|gb|EFY34455.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Salmonella enterica
           subsp. enterica serovar Montevideo str. 515920-2]
 gi|322642418|gb|EFY39022.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Salmonella enterica
           subsp. enterica serovar Montevideo str. 531954]
 gi|322644013|gb|EFY40561.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Salmonella enterica
           subsp. enterica serovar Montevideo str.
           NC_MB110209-0054]
 gi|322650481|gb|EFY46889.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Salmonella enterica
           subsp. enterica serovar Montevideo str. OH_2009072675]
 gi|322653555|gb|EFY49883.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Salmonella enterica
           subsp. enterica serovar Montevideo str.
           CASC_09SCPH15965]
 gi|322659740|gb|EFY55983.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Salmonella enterica
           subsp. enterica serovar Montevideo str. 19N]
 gi|322662049|gb|EFY58265.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Salmonella enterica
           subsp. enterica serovar Montevideo str. 81038-01]
 gi|322666202|gb|EFY62380.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Salmonella enterica
           subsp. enterica serovar Montevideo str. MD_MDA09249507]
 gi|322672622|gb|EFY68733.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Salmonella enterica
           subsp. enterica serovar Montevideo str. 414877]
 gi|322676052|gb|EFY72123.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Salmonella enterica
           subsp. enterica serovar Montevideo str. 366867]
 gi|322680536|gb|EFY76574.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Salmonella enterica
           subsp. enterica serovar Montevideo str. 413180]
 gi|322684570|gb|EFY80574.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Salmonella enterica
           subsp. enterica serovar Montevideo str. 446600]
 gi|322717317|gb|EFZ08888.1| 23S rRNA (guanosine-2'-O-)-methyltransferase rlmB [Salmonella
           enterica subsp. enterica serovar Choleraesuis str. A50]
 gi|323132707|gb|ADX20137.1| 23S rRNA (guanosine-2'-O-)-methyltransferase rlmB [Salmonella
           enterica subsp. enterica serovar Typhimurium str. 4/74]
 gi|323192885|gb|EFZ78111.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Salmonella enterica
           subsp. enterica serovar Montevideo str. 609458-1]
 gi|323197239|gb|EFZ82379.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Salmonella enterica
           subsp. enterica serovar Montevideo str. 556150-1]
 gi|323201644|gb|EFZ86708.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Salmonella enterica
           subsp. enterica serovar Montevideo str. 609460]
 gi|323206158|gb|EFZ91120.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Salmonella enterica
           subsp. enterica serovar Montevideo str. 507440-20]
 gi|323213166|gb|EFZ97968.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Salmonella enterica
           subsp. enterica serovar Montevideo str. 556152]
 gi|323215540|gb|EGA00284.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Salmonella enterica
           subsp. enterica serovar Montevideo str. MB101509-0077]
 gi|323219525|gb|EGA04010.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Salmonella enterica
           subsp. enterica serovar Montevideo str. MB102109-0047]
 gi|323227828|gb|EGA11982.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Salmonella enterica
           subsp. enterica serovar Montevideo str. MB110209-0055]
 gi|323228998|gb|EGA13127.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Salmonella enterica
           subsp. enterica serovar Montevideo str. MB111609-0052]
 gi|323236390|gb|EGA20466.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Salmonella enterica
           subsp. enterica serovar Montevideo str. 2009083312]
 gi|323238705|gb|EGA22757.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Salmonella enterica
           subsp. enterica serovar Montevideo str. 2009085258]
 gi|323241844|gb|EGA25873.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Salmonella enterica
           subsp. enterica serovar Montevideo str. 315731156]
 gi|323248007|gb|EGA31944.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Salmonella enterica
           subsp. enterica serovar Montevideo str. IA_2009159199]
 gi|323254662|gb|EGA38473.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Salmonella enterica
           subsp. enterica serovar Montevideo str. IA_2010008282]
 gi|323258279|gb|EGA41956.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Salmonella enterica
           subsp. enterica serovar Montevideo str. IA_2010008283]
 gi|323263575|gb|EGA47096.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Salmonella enterica
           subsp. enterica serovar Montevideo str. IA_2010008284]
 gi|323265829|gb|EGA49325.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Salmonella enterica
           subsp. enterica serovar Montevideo str. IA_2010008285]
 gi|323270273|gb|EGA53721.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Salmonella enterica
           subsp. enterica serovar Montevideo str. IA_2010008287]
 gi|332991180|gb|AEF10163.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Salmonella enterica
           subsp. enterica serovar Typhimurium str. UK-1]
          Length = 243

 Score =  134 bits (338), Expect = 9e-30,   Method: Composition-based stats.
 Identities = 68/243 (27%), Positives = 110/243 (45%), Gaps = 10/243 (4%)

Query: 48  NLFLYGVHTVSAALNNPSRKIFQLLATKNALARLD---WDANLPHPFPVKTVPPQTIDKI 104
           +  +YG+H V A L     +  ++   K    +       A       ++    Q +D+ 
Sbjct: 2   SEMIYGIHAVQALLERAPERFQEVFILKGREDKRLLPLIHALESQGVVIQLANRQYLDEK 61

Query: 105 VGKEAVHQGLALETAPLLSP------TLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFS 158
               AVHQG+     P           L A+ +   L++LD V DPHN+GA LRSA A  
Sbjct: 62  SD-GAVHQGIIARVKPGRQYQENDLPDLIALHDRPFLLILDGVTDPHNLGACLRSADAAG 120

Query: 159 CDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKK 218
              +I  K  S   +A   K A GA E +P IR++NL   ++ +       +G + ++  
Sbjct: 121 VHAVIVPKDRSAQLNATAKKVACGAAESVPLIRVTNLARTMRMLQEENIWIVGTAGEADH 180

Query: 219 PLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQN 278
            L Q     ++AL++GAEG+G+R  T+E    +  + M G + +LNVS A  + L+    
Sbjct: 181 TLYQSKMPGRMALVMGAEGEGMRRLTREHCDELISIPMAGSVSSLNVSVATGICLFEAVR 240

Query: 279 HFA 281
              
Sbjct: 241 QRT 243


>gi|312876807|ref|ZP_07736785.1| RNA methyltransferase, TrmH family, group 3 [Caldicellulosiruptor
           lactoaceticus 6A]
 gi|311796426|gb|EFR12777.1| RNA methyltransferase, TrmH family, group 3 [Caldicellulosiruptor
           lactoaceticus 6A]
          Length = 253

 Score =  134 bits (338), Expect = 9e-30,   Method: Composition-based stats.
 Identities = 55/242 (22%), Positives = 103/242 (42%), Gaps = 12/242 (4%)

Query: 51  LYGVHTVSAALNNPSRKIFQLLATKNALARL---DWDANLPHPFPVKTVPPQTIDKIVGK 107
           + G + V  AL + + KI ++  + +A  R      +        VK V    IDK+  +
Sbjct: 4   IEGKNPVKEALRSGA-KITEVYISNSAKDRETAQIINLCKQSGIVVKFVDKSKIDKMA-Q 61

Query: 108 EAVHQGLALETAPLLSPTLD-------AVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCD 160
               QG+           +D           +  L++LD + DP N G+I+RSA      
Sbjct: 62  TKNPQGVIAIAHEFEYCDIDDILAEARQRGETPFLVLLDGITDPQNFGSIIRSAHLCGAH 121

Query: 161 GIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPL 220
           GI+   R S   +  + K+++GA+E++   R+ NL   ++++   G       +   KP+
Sbjct: 122 GIVIEARNSCPVTPAVEKASAGAVEYMKIARVVNLRRTIEELKEKGIWVFATDASGPKPV 181

Query: 221 EQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
            +        +++G+EGKG+    +E A  +  +   G + + N S AA +  +      
Sbjct: 182 YECDFTIPTCIVIGSEGKGISRLVKEGADFLIKIPQKGYVNSFNASVAAGIIFFEVLKQR 241

Query: 281 AK 282
            K
Sbjct: 242 LK 243


>gi|160932770|ref|ZP_02080159.1| hypothetical protein CLOLEP_01611 [Clostridium leptum DSM 753]
 gi|156867844|gb|EDO61216.1| hypothetical protein CLOLEP_01611 [Clostridium leptum DSM 753]
          Length = 255

 Score =  134 bits (338), Expect = 9e-30,   Method: Composition-based stats.
 Identities = 69/249 (27%), Positives = 109/249 (43%), Gaps = 13/249 (5%)

Query: 42  HTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDA---NLPHPFPVKTVPP 98
             ++P    + G + V  AL   +R I  +L  + A      D           VK V P
Sbjct: 4   KRTEPAQDVIAGRNAVKEAL-CSARPIESILVARGARNGSLGDIVSKAKAQGVAVKEVDP 62

Query: 99  QTIDKIVGKEAVHQGLALETAPLLSPTLDAV-------RNSQLLMVLDHVNDPHNIGAIL 151
           + ++ +    A HQG+    A     +++ +            L+V D +NDPHN+GAIL
Sbjct: 63  KRLEFLC-PGANHQGIVALAAAHEYASVEDMLALADERGEPPFLIVADELNDPHNLGAIL 121

Query: 152 RSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIG 211
           R+A      G+I  KR S   +  + K+++GALE++P  R+SNL  A  +        I 
Sbjct: 122 RTAECTGAHGVIIPKRRSAGLTYTVGKASAGALEYVPVARVSNL-AAALEDLKKRGLWIY 180

Query: 212 LSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAV 271
            +     P  +       AL++G+EG G+    +E    +  L M G I +LN S AA V
Sbjct: 181 GADMEGTPWCEAELTGPAALVIGSEGAGIGRLVKEKCDVILSLPMRGKINSLNASVAAGV 240

Query: 272 ALYITQNHF 280
            +Y      
Sbjct: 241 LMYEFMRQR 249


>gi|86143085|ref|ZP_01061507.1| putative rRNA methylase [Leeuwenhoekiella blandensis MED217]
 gi|85830530|gb|EAQ48989.1| putative rRNA methylase [Leeuwenhoekiella blandensis MED217]
          Length = 268

 Score =  134 bits (338), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 51/257 (19%), Positives = 97/257 (37%), Gaps = 3/257 (1%)

Query: 26  NHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLA--TKNALARLDW 83
            +   K++ +  +KSR   +     + GV  ++ AL+   +    L      +A      
Sbjct: 9   QNPTVKQLVALQEKSRIRRKTGEFLIEGVREINLALDAGFQLTQLLFCSAIADAEELAAL 68

Query: 84  DANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDHVND 143
            + L        V  +   KI  +      +A   A   + +   +  + L+MV +    
Sbjct: 69  QSKLSAEVTQIEVTEEVYKKIAYRSGTEGIIASAKAKKNTLSALDLPKNPLIMVAEAPEK 128

Query: 144 PHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMH 203
           P NIGA+LR+A A   D  I     +   +  + +S+ G L  +P    S   + +  + 
Sbjct: 129 PGNIGALLRTADAAGVDAFILANPRTDLYNPNIIRSSVGGLFTVPVATGSTQ-EVIDFLK 187

Query: 204 SWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKAL 263
                            E++      AL++G E  GL    +  A     + M G + ++
Sbjct: 188 QKNIAIYTAILQEAISYEKQDFTTASALVVGTEADGLSEAWRAAAKQNIIIPMQGRLDSM 247

Query: 264 NVSNAAAVALYITQNHF 280
           NVS AAA+ ++  +   
Sbjct: 248 NVSVAAAILIFEARRQR 264


>gi|238757527|ref|ZP_04618712.1| 23S rRNA (guanosine-2'-O-)-methyltransferase rlmB [Yersinia aldovae
           ATCC 35236]
 gi|238704289|gb|EEP96821.1| 23S rRNA (guanosine-2'-O-)-methyltransferase rlmB [Yersinia aldovae
           ATCC 35236]
          Length = 246

 Score =  134 bits (338), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 66/242 (27%), Positives = 110/242 (45%), Gaps = 8/242 (3%)

Query: 48  NLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDAN---LPHPFPVKTVPPQTIDKI 104
           +  +YG+H++ A L+N  ++  ++   K    R               ++    + +D  
Sbjct: 2   SEIIYGIHSIKALLDNDPQRFLEVFILKGRDDRRLQSLIVELEATGLVIQVASRKWLDSQ 61

Query: 105 VGKEAVHQGLALETAPLLSPTLDAVR-----NSQLLMVLDHVNDPHNIGAILRSAVAFSC 159
           V   A    +A           D         +  L+VLD V DPHN+GA LRSA A   
Sbjct: 62  VEDGAHQGIVARVREGRQYQENDLPALLESVETPFLLVLDGVTDPHNLGACLRSADAAGV 121

Query: 160 DGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKP 219
             +I  +  S   +A+  K ASGA E++P I+++NL   L+ +       +G + ++   
Sbjct: 122 HAVIVPRDRSAQLNAIAKKVASGAAENVPLIKVTNLARTLRVLQEHNVWIVGTAGEADHT 181

Query: 220 LEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNH 279
           L Q      +AL++GAEG+G+R  T+E    +  + M G + +LNVS A  V L+     
Sbjct: 182 LYQSKMTGPMALVMGAEGEGMRRLTREHCDELISIPMAGSVSSLNVSVATGVCLFEVVRQ 241

Query: 280 FA 281
            A
Sbjct: 242 RA 243


>gi|312144265|ref|YP_003995711.1| RNA methyltransferase, TrmH family, group 3 [Halanaerobium sp.
           'sapolanicus']
 gi|311904916|gb|ADQ15357.1| RNA methyltransferase, TrmH family, group 3 [Halanaerobium sp.
           'sapolanicus']
          Length = 246

 Score =  134 bits (338), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 65/242 (26%), Positives = 115/242 (47%), Gaps = 12/242 (4%)

Query: 51  LYGVHTVSAALNNPSRKIFQLLATKNALARLDWDA---NLPHPFPVKTVPPQTIDKIVGK 107
           + G + V  AL    RKI ++   +N+ + +  D          P+  +  + + +   +
Sbjct: 4   IEGRNAVYEALRAG-RKIHRIYIKENSSSEIIDDILEMAEKDNIPITRISNKKLSE-TAR 61

Query: 108 EAVHQGLALETAPLLSPTL-------DAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCD 160
              HQG+  E   L    +       D      L ++LD + DPHN GAI+R+A A   D
Sbjct: 62  SHAHQGIIAEADHLKEYNINDIINIKDEKPGDSLTIILDEIKDPHNFGAIIRTAYAAGAD 121

Query: 161 GIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPL 220
            ++   R +   + V+ K+A+GA EHIP +++SN+  A++ +    F  +G  +  ++  
Sbjct: 122 AVVYQDRRAVDITPVVLKAAAGAAEHIPLVKVSNINYAIKALKDAHFWVVGADAAGEQSH 181

Query: 221 EQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
            +   +   AL++G+EG GLR   +E    +  + M G + +LN S AAAV +Y      
Sbjct: 182 FEADFSGSTALVIGSEGSGLRRLVRENCDFLVKIPMKGELGSLNASVAAAVIIYEIFRQE 241

Query: 281 AK 282
            K
Sbjct: 242 EK 243


>gi|325144276|gb|EGC66581.1| RNA methyltransferase, TrmH family, group 3 [Neisseria meningitidis
           M01-240013]
          Length = 250

 Score =  134 bits (338), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 69/238 (28%), Positives = 111/238 (46%), Gaps = 9/238 (3%)

Query: 51  LYGVHTVSAALNNPSRKIFQLLATK---NALARLDWDANLPHPFPVKTVPPQTIDKIVGK 107
           +YG H V+A L    + I +L   +   +   R   +        V       ++ I  K
Sbjct: 7   IYGFHAVNARLWQNPKSIVELYVQEGKNDVRTREVLEKAANENIRVYFADADRLNAIS-K 65

Query: 108 EAVHQGLALET-----APLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGI 162
            A HQG+            L   L+ +    LL++LD + DPHN+GA LR+A A     +
Sbjct: 66  GARHQGVVGFIDASKNHVHLEDVLENLSEPPLLLILDGITDPHNLGACLRTADAMGVHAV 125

Query: 163 ITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQ 222
           I  K  S   +A ++K ASGA E +PYI ++NL   L+++  +G   IG     +  L  
Sbjct: 126 IAPKDKSAGLNATVSKVASGAAETVPYITVTNLARTLRELKEYGIWIIGTDMSGESDLYH 185

Query: 223 EIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
               D  A ++G EG G+R  T+E    +  + M G ++++NVS +A + L  T+   
Sbjct: 186 CNLPDSAAWVMGNEGDGMRRLTREHCDMLVSIPMFGTVESMNVSVSAGMVLSETRRQR 243


>gi|283786859|ref|YP_003366724.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Citrobacter rodentium
           ICC168]
 gi|282950313|emb|CBG89960.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Citrobacter rodentium
           ICC168]
          Length = 243

 Score =  134 bits (338), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 69/243 (28%), Positives = 111/243 (45%), Gaps = 10/243 (4%)

Query: 48  NLFLYGVHTVSAALNNPSRK---IFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKI 104
           +  +YG+H V A L     +   +F L   ++        A       ++    Q +D+ 
Sbjct: 2   SEMIYGIHAVQALLERAPERFQDVFILKGREDKRLLPLIHALEAQGVVIQLANRQFLDEK 61

Query: 105 VGKEAVHQGLALETAPLLSP------TLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFS 158
             + AVHQG+     P           L A      L++LD V DPHN+GA LRSA A  
Sbjct: 62  S-EGAVHQGIIARVKPGRQYQENDLPDLIASLEQPFLLILDGVTDPHNLGACLRSADAAG 120

Query: 159 CDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKK 218
              +I  K  S   +A   K A GA E +P IR++NL   ++ +       +G + ++  
Sbjct: 121 VHAVIVPKDRSAQLNATAKKVACGAAESVPLIRVTNLARTMRMLQEENIWIVGTAGEADH 180

Query: 219 PLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQN 278
            L Q     ++AL++GAEG+G+R  T+E    +  + M G + +LNVS A  + L+    
Sbjct: 181 TLYQSKMTGRMALVMGAEGEGMRRLTREHCDELISIPMAGSVSSLNVSVATGICLFEAVR 240

Query: 279 HFA 281
             +
Sbjct: 241 QRS 243


>gi|42519503|ref|NP_965433.1| hypothetical protein LJ1627 [Lactobacillus johnsonii NCC 533]
 gi|41583791|gb|AAS09399.1| hypothetical protein LJ_1627 [Lactobacillus johnsonii NCC 533]
 gi|329667742|gb|AEB93690.1| rRNA methylase [Lactobacillus johnsonii DPC 6026]
          Length = 253

 Score =  134 bits (338), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 51/251 (20%), Positives = 104/251 (41%), Gaps = 6/251 (2%)

Query: 26  NHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDA 85
           N+   K ++   QK ++  + +   + G H V  AL +    ++ L  T  AL +LD   
Sbjct: 8   NNPTIKSLRKLEQK-KYRKKTQTYLIEGFHLVEEALKSHENYLYVL-GTAEALKKLDTTY 65

Query: 86  NLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDHVNDPH 145
            L     ++      I + +      Q + +        +        +++  D++ DP 
Sbjct: 66  KLKDNKVIQITDA--IAQHLSSTKNSQDIFMVLPINQPKSFSFEYGKWVVL--DNLTDPG 121

Query: 146 NIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSW 205
           N+G I+R+A A   DG++ ++      +  + +S  G+  HI  I+   L        + 
Sbjct: 122 NVGTIIRTADAAGFDGVVLSEESVDLYNPKVQRSMQGSQFHIQIIQNPILEAISSFKENG 181

Query: 206 GFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNV 265
               + +   + K L       ++AL++G E  G   +  ETA    ++ + G  ++LN 
Sbjct: 182 LPVYVSILDKTAKSLNNCAPVPQLALVIGNEAHGASKEVIETADKKIYIPIKGKAESLNA 241

Query: 266 SNAAAVALYIT 276
           + AA + +Y  
Sbjct: 242 AVAAGIMIYHF 252


>gi|167553783|ref|ZP_02347529.1| RNA methyltransferase, TrmH family, group 3 [Salmonella enterica
           subsp. enterica serovar Saintpaul str. SARA29]
 gi|168263278|ref|ZP_02685251.1| RNA methyltransferase, TrmH family, group 3 [Salmonella enterica
           subsp. enterica serovar Hadar str. RI_05P066]
 gi|168464747|ref|ZP_02698650.1| RNA methyltransferase, TrmH family, group 3 [Salmonella enterica
           subsp. enterica serovar Newport str. SL317]
 gi|198243348|ref|YP_002218253.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Salmonella enterica
           subsp. enterica serovar Dublin str. CT_02021853]
 gi|205355126|ref|YP_002228927.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Salmonella enterica
           subsp. enterica serovar Gallinarum str. 287/91]
 gi|207859514|ref|YP_002246165.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Salmonella enterica
           subsp. enterica serovar Enteritidis str. P125109]
 gi|195632589|gb|EDX51043.1| RNA methyltransferase, TrmH family, group 3 [Salmonella enterica
           subsp. enterica serovar Newport str. SL317]
 gi|197937864|gb|ACH75197.1| RNA methyltransferase, TrmH family, group 3 [Salmonella enterica
           subsp. enterica serovar Dublin str. CT_02021853]
 gi|205274907|emb|CAR39974.1| probable tRNA/rRNA methyltransferase [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 287/91]
 gi|205321857|gb|EDZ09696.1| RNA methyltransferase, TrmH family, group 3 [Salmonella enterica
           subsp. enterica serovar Saintpaul str. SARA29]
 gi|205348047|gb|EDZ34678.1| RNA methyltransferase, TrmH family, group 3 [Salmonella enterica
           subsp. enterica serovar Hadar str. RI_05P066]
 gi|206711317|emb|CAR35695.1| probable tRNA/rRNA methyltransferase [Salmonella enterica subsp.
           enterica serovar Enteritidis str. P125109]
 gi|326626058|gb|EGE32403.1| RNA methyltransferase, TrmH family, group 3 [Salmonella enterica
           subsp. enterica serovar Dublin str. 3246]
 gi|326630284|gb|EGE36627.1| RNA methyltransferase, TrmH family, group 3 [Salmonella enterica
           subsp. enterica serovar Gallinarum str. 9]
          Length = 243

 Score =  134 bits (338), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 68/243 (27%), Positives = 109/243 (44%), Gaps = 10/243 (4%)

Query: 48  NLFLYGVHTVSAALNNPSRKIFQLLATKNALARLD---WDANLPHPFPVKTVPPQTIDKI 104
           +  +YG+H V A L     +  ++   K    +       A       ++    Q +D+ 
Sbjct: 2   SEMIYGIHAVQALLERAPERFQEVFILKGREDKRLLPLIHALESQGVVIQLANRQYLDEK 61

Query: 105 VGKEAVHQGLALETAPLLSP------TLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFS 158
               AVHQG+     P           L A+     L++LD V DPHN+GA LRSA A  
Sbjct: 62  SD-GAVHQGIIARVKPGRQYQENDLPDLIALHERPFLLILDGVTDPHNLGACLRSADAAG 120

Query: 159 CDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKK 218
              +I  K  S   +A   K A GA E +P IR++NL   ++ +       +G + ++  
Sbjct: 121 VHAVIVPKDRSAQLNATAKKVACGAAESVPLIRVTNLARTMRMLQEENIWIVGTAGEADH 180

Query: 219 PLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQN 278
            L Q     ++AL++GAEG+G+R  T+E    +  + M G + +LNVS A  + L+    
Sbjct: 181 TLYQSKMPGRMALVMGAEGEGMRRLTREHCDELISIPMAGSVSSLNVSVATGICLFEAVR 240

Query: 279 HFA 281
              
Sbjct: 241 QRT 243


>gi|331650305|ref|ZP_08351377.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli M605]
 gi|330908522|gb|EGH37041.1| 23S rRNA (guanosine-2'-O-) -methyltransferase rlmB [Escherichia
           coli AA86]
 gi|331040699|gb|EGI12857.1| RNA methyltransferase, TrmH family, group 3 [Escherichia coli M605]
          Length = 243

 Score =  134 bits (338), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 62/242 (25%), Positives = 104/242 (42%), Gaps = 8/242 (3%)

Query: 48  NLFLYGVHTVSAALNNPSRKIFQLLATKNALARLD---WDANLPHPFPVKTVPPQTIDKI 104
           +  +YG+H V A L     +  ++   K    +       A       ++    Q +D+ 
Sbjct: 2   SEMIYGIHAVQALLERTPERFQEVFILKGREDKRLLPLIHALESQGVVIQLANRQYLDEK 61

Query: 105 VGKEAVHQGLALETAPLLSPTLDAVR-----NSQLLMVLDHVNDPHNIGAILRSAVAFSC 159
                    +A           D        +   L++LD V DPHN+GA LRSA A   
Sbjct: 62  SDGAVHQGIIARVKPGRQYQENDLPDLIASLDQPFLLILDGVTDPHNLGACLRSADAAGV 121

Query: 160 DGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKP 219
             +I  K  S   +A   K A GA E +P IR++NL   ++ +       +G + ++   
Sbjct: 122 HAVIVPKDRSAQLNATAKKVACGAAESVPLIRVTNLARTMRMLQEENIWIVGTAGEADHT 181

Query: 220 LEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNH 279
           L Q     ++AL++GAEG+G+R  T+E    +  + M G + +LNVS A  + L+     
Sbjct: 182 LYQSKMTGRLALVMGAEGEGMRRLTREHCDELISIPMAGSVSSLNVSVATGICLFEAVRQ 241

Query: 280 FA 281
            +
Sbjct: 242 RS 243


>gi|295696878|ref|YP_003590116.1| tRNA/rRNA methyltransferase (SpoU) [Bacillus tusciae DSM 2912]
 gi|295412480|gb|ADG06972.1| tRNA/rRNA methyltransferase (SpoU) [Bacillus tusciae DSM 2912]
          Length = 271

 Score =  134 bits (338), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 50/261 (19%), Positives = 99/261 (37%), Gaps = 8/261 (3%)

Query: 26  NHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDA 85
            +   K+  +  +  +   +       G H V  AL++       L   ++    +    
Sbjct: 10  QNARVKEWAALRR-GKERRRRGTFLAEGPHLVGEALHSGLGIEVVLFDPRDQTPEVASLV 68

Query: 86  NLP--HPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPT----LDAVRNSQLLMVLD 139
                   PV+ V  + ++++          A+   P              +  L++ LD
Sbjct: 69  EEARGKGCPVQPVDRRVLERVCEVITPQGIAAVVRIPERPMPGFAVEAPEEDPVLMVALD 128

Query: 140 HVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDAL 199
            + DP N+GA+LR A A    G++  +  +   S    +S+ GA   +P  +   +    
Sbjct: 129 GIQDPGNVGAVLRVARAVGVTGVLCGEDTADPFSPKAVRSSMGAAFTVPIRQGRLVNMIG 188

Query: 200 QKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGI 259
           +              +  +       N  + ++LG EG+G+ P+ +       H+ MPG 
Sbjct: 189 EWHAKGVEPVETAVGEGVRYDRWN-WNIPVMIVLGNEGRGISPEVRHLCRGKVHIPMPGG 247

Query: 260 IKALNVSNAAAVALYITQNHF 280
            ++LNV+ AAA+ LY  + H 
Sbjct: 248 GESLNVAVAAALLLYEARRHR 268


>gi|114046193|ref|YP_736743.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Shewanella sp. MR-7]
 gi|113887635|gb|ABI41686.1| RNA methyltransferase, TrmH family, group 3 [Shewanella sp. MR-7]
          Length = 246

 Score =  134 bits (338), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 66/244 (27%), Positives = 112/244 (45%), Gaps = 10/244 (4%)

Query: 46  PENLFLYGVHTVSAALNNPSRKIFQLLATKNA-LARLDWDANLPH--PFPVKTVPPQTID 102
            +   ++G+H V A L +   +I +L   +     RL             ++    + +D
Sbjct: 2   KKQDIIFGIHAVEALLKHSPERIIELWLLQGREDERLTPLIRQAKSFGTSIQVTSRKVLD 61

Query: 103 KIVGKEAVHQGLALETA------PLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVA 156
               + + HQG+                 L A  +   L++LD V DPHN+GA LR+A A
Sbjct: 62  DKA-ESSQHQGIVARVKAAKILAEHDLDELLAKTDLPFLLILDGVTDPHNLGACLRNADA 120

Query: 157 FSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDS 216
               GII  K  S   +AV++K A GA E +P  +++NL   ++ +   G   +G + ++
Sbjct: 121 AGVQGIIVPKDNSVGVTAVVSKVACGAAETVPLFQVTNLARTMRHLQEKGVWIVGTAGEA 180

Query: 217 KKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYIT 276
              L Q      +A+ +GAEGKGLR  ++E   ++  + M G + +LNVS A  + L+  
Sbjct: 181 DCELYQADLKGPLAIAMGAEGKGLRRLSRECCDTLVSIPMAGSVSSLNVSVATGICLFEA 240

Query: 277 QNHF 280
               
Sbjct: 241 VRQR 244


>gi|319404391|emb|CBI77994.1| tRNA/rRNA metyltransferase [Bartonella rochalimae ATCC BAA-1498]
          Length = 272

 Score =  134 bits (338), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 136/269 (50%), Positives = 180/269 (66%), Gaps = 5/269 (1%)

Query: 16  KDSHYAKLRRNHRDYK----KMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQL 71
           KDSHYA+LRR +RD K    +  ++ ++     Q E ++LYG+H V AAL NP R +  L
Sbjct: 3   KDSHYARLRRRYRDTKGSFFQSTTYVKQPPIPLQKEQIYLYGIHPVHAALKNPRRILRHL 62

Query: 72  LATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRN 131
             T NAL RLD + +     P+    P+ ++  VG+EAVHQG+ LET PL S +L  + N
Sbjct: 63  YTTPNALKRLDINESNIA-CPITPCSPKKLEMFVGREAVHQGIVLETEPLKSRSLSELTN 121

Query: 132 SQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIR 191
           + L++++D + DPHN+GAI+RSAVAF    IITT R+SP ES VLAK+ASGALE I YI 
Sbjct: 122 TDLIIIMDQITDPHNVGAIMRSAVAFKAGAIITTNRHSPQESGVLAKAASGALELIEYIT 181

Query: 192 ISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSM 251
           + NL  ALQ++H   F + GL S+ K PLE  +   KI+LILGAEGKGLR KT+E   S+
Sbjct: 182 VRNLFKALQELHQMNFISFGLDSEGKFPLETALTGTKISLILGAEGKGLRQKTRENVYSL 241

Query: 252 AHLHMPGIIKALNVSNAAAVALYITQNHF 280
           A L +PG IK+LNVSNAAA+ALY    + 
Sbjct: 242 ARLDLPGDIKSLNVSNAAAIALYAVHKYL 270


>gi|312126945|ref|YP_003991819.1| RNA methyltransferase, TrmH family, group 3 [Caldicellulosiruptor
           hydrothermalis 108]
 gi|311776964|gb|ADQ06450.1| RNA methyltransferase, TrmH family, group 3 [Caldicellulosiruptor
           hydrothermalis 108]
          Length = 253

 Score =  134 bits (338), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 56/242 (23%), Positives = 105/242 (43%), Gaps = 12/242 (4%)

Query: 51  LYGVHTVSAALNNPSRKIFQLLATKNALARL---DWDANLPHPFPVKTVPPQTIDKIVGK 107
           + G + V  AL + + KI ++  + +A  +      D        VK V    IDK+  +
Sbjct: 4   IEGKNPVKEALKSGA-KITEVYISNSAKDKETAQIIDLCRQSGVVVKFVDKSKIDKMA-Q 61

Query: 108 EAVHQGLALETAPLLSPTLD-------AVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCD 160
               QG+           +D         + +  L++LD + DP N G+I+RSA      
Sbjct: 62  TKNPQGVIAIAHEFEYCDIDDILFEARQKKEAPFLVLLDGITDPQNFGSIIRSAHLCGAH 121

Query: 161 GIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPL 220
           GI+   R S   +  + K+++GA+E++   R+ NL   ++++   G       + S KP+
Sbjct: 122 GIVIEARNSCPVTPAVEKASAGAVEYMKIARVVNLRRTIEELKEKGIWVFAADASSPKPV 181

Query: 221 EQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
            +        +++G+EGKG+    +E A  +  +   G + + N S AA +  +      
Sbjct: 182 YECDFTIPTCIVIGSEGKGISRLVKEGADFLIKIPQKGYVNSFNASVAAGIIFFEVLKQR 241

Query: 281 AK 282
            K
Sbjct: 242 LK 243


>gi|307824282|ref|ZP_07654508.1| RNA methyltransferase, TrmH family, group 3 [Methylobacter
           tundripaludum SV96]
 gi|307734662|gb|EFO05513.1| RNA methyltransferase, TrmH family, group 3 [Methylobacter
           tundripaludum SV96]
          Length = 248

 Score =  134 bits (338), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 70/240 (29%), Positives = 118/240 (49%), Gaps = 11/240 (4%)

Query: 51  LYGVHTVSAALNNPSRKIFQLLATKNALARLDWDAN---LPHPFPVKTVPPQTIDKIVGK 107
           +YG+H+V +AL+   +KI +         +         L      + V  + +D+   +
Sbjct: 6   IYGIHSVQSALDYSPKKIGKAWIDSQRQDKRLTQLIDDLLDLGIEPEKVDRKKLDRFA-E 64

Query: 108 EAVHQGLALETAPLLSPTLDAVRN-------SQLLMVLDHVNDPHNIGAILRSAVAFSCD 160
              HQG+ +E       +   +++       + L +VLD+V DPHN GA LR+A A    
Sbjct: 65  GNNHQGIVIEVEMPGELSESDLKDAVLTLSGTPLFLVLDNVQDPHNFGACLRTADATGVH 124

Query: 161 GIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPL 220
           G+I TK  +   +  + K ASGA E +P  +++NL+  L+ +   G   +G + ++ +  
Sbjct: 125 GVIITKDNATGITPTVCKVASGAAETVPVYQVTNLSRTLRWLKEQGIWVMGAAGEATQTA 184

Query: 221 EQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
            Q      +AL++GAEGKGLR  T+E    +  L M G +++LN+S A  V LY T    
Sbjct: 185 YQTDFTVPLALVVGAEGKGLRRLTKEQCDILVKLPMRGQVESLNLSVATGVLLYETVRQR 244


>gi|307243416|ref|ZP_07525573.1| RNA methyltransferase, TrmH family, group 3 [Peptostreptococcus
           stomatis DSM 17678]
 gi|306493226|gb|EFM65222.1| RNA methyltransferase, TrmH family, group 3 [Peptostreptococcus
           stomatis DSM 17678]
          Length = 244

 Score =  134 bits (338), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 54/241 (22%), Positives = 105/241 (43%), Gaps = 11/241 (4%)

Query: 50  FLYGVHTVSAALNNPS--RKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGK 107
            + G + +  AL N     KI    A+K    +        +   ++ V    +D++   
Sbjct: 3   IIEGRNPIIEALKNNRSIEKIMVNKASKEGSIKKILAMAKENKVIIQEVDRHKLDEMSES 62

Query: 108 EAVHQGLALETAPLLSPTLDA-------VRNSQLLMVLDHVNDPHNIGAILRSAVAFSCD 160
            A HQG+   T+      LD               ++LD + DPHN+G+I+R+A A    
Sbjct: 63  HA-HQGVIAITSDYRYYDLDEILEIPKERGEDPFFIILDGITDPHNLGSIIRTADAVGAH 121

Query: 161 GIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPL 220
            +I  KR S   + ++AK+++GA+E++P  +++N+ + ++ +   G              
Sbjct: 122 AVIIPKRRSVQITPIVAKASAGAVEYLPVCKVTNIVNTIKTLKENGLWIA-AVDMDGHTF 180

Query: 221 EQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
            Q+     + L++G+EG+G+    ++       + M G + +LN S A  + LY      
Sbjct: 181 YQQNLGGPLGLVVGSEGEGISRLVKQNCDFTVSMPMSGNVTSLNASVAGGILLYEVYRQR 240

Query: 281 A 281
            
Sbjct: 241 N 241


>gi|296875965|ref|ZP_06900024.1| SpoU rRNA methylase [Streptococcus parasanguinis ATCC 15912]
 gi|296433040|gb|EFH18828.1| SpoU rRNA methylase [Streptococcus parasanguinis ATCC 15912]
          Length = 248

 Score =  134 bits (338), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 61/278 (21%), Positives = 115/278 (41%), Gaps = 31/278 (11%)

Query: 1   MNLISKKKSEKIFSLKDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAA 60
           MN+I+ K +  I + K  H  K R +                     +  + G H    A
Sbjct: 1   MNIITSKSNNVIKNAKKLHQKKYRTD---------------------SYLIEGWHLFEEA 39

Query: 61  LNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAP 120
           + N +  I Q+   +  L R++   N      V  V  + +  +   +     +      
Sbjct: 40  VENQAE-IRQVFVLEAYLDRVENIQN------VTVVTSEILSLLADSKTPQGIV---AEI 89

Query: 121 LLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSA 180
           LL   +   +     + L+ V DP N+G ++R+A A   DG++ +K  +   S    +S 
Sbjct: 90  LLEQPVLPYQLQGRYLYLEDVQDPGNVGTMIRTADAAGFDGVMLSKASADLYSLKTLRSM 149

Query: 181 SGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGL 240
            G+  H+P  ++       +   S         S++     Q  + D++ L++G EGKG+
Sbjct: 150 QGSHFHLPIWKLDREELFERASQSNLAVLATTLSEASIDYRQLPQIDQLILVMGNEGKGI 209

Query: 241 RPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQN 278
            P+    A  + H+ MPG  ++LNV+ AA + ++  +N
Sbjct: 210 SPEMATRADQLVHITMPGRAESLNVAVAAGILMFYLRN 247


>gi|257879805|ref|ZP_05659458.1| RNA methyltransferase TrmH [Enterococcus faecium 1,230,933]
 gi|257882531|ref|ZP_05662184.1| RNA methyltransferase TrmH [Enterococcus faecium 1,231,502]
 gi|257891646|ref|ZP_05671299.1| RNA methyltransferase TrmH [Enterococcus faecium 1,231,410]
 gi|257894123|ref|ZP_05673776.1| RNA methyltransferase TrmH [Enterococcus faecium 1,231,408]
 gi|257814033|gb|EEV42791.1| RNA methyltransferase TrmH [Enterococcus faecium 1,230,933]
 gi|257818189|gb|EEV45517.1| RNA methyltransferase TrmH [Enterococcus faecium 1,231,502]
 gi|257828006|gb|EEV54632.1| RNA methyltransferase TrmH [Enterococcus faecium 1,231,410]
 gi|257830502|gb|EEV57109.1| RNA methyltransferase TrmH [Enterococcus faecium 1,231,408]
          Length = 289

 Score =  134 bits (338), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 76/288 (26%), Positives = 134/288 (46%), Gaps = 10/288 (3%)

Query: 1   MNLISKKKSEKIFSLKDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAA 60
           M  + K+++ K  S +     K  R     +  ++ +   ++    E+ F++G H    A
Sbjct: 1   MKKMGKERTNKHQSKRGFEDKKQNRYSNKKQTGRNQSVSDQNEEALEDNFVFGHHAAVEA 60

Query: 61  LNNPS-RKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETA 119
           L      K+F    ++        +       PVK VP Q ++ +     VHQG+ L   
Sbjct: 61  LQQGRGNKLFLQEDSRGEKVEELKEIAREQAVPVKWVPKQKLETLSDH-GVHQGVVLAIT 119

Query: 120 PLLSPTLDA-------VRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSE 172
           P    +LD         +     ++LD + DPHN G+ILR+A A   DG+I  K  +   
Sbjct: 120 PYEYLSLDQLIERTKEKKEDPFFLILDSIEDPHNFGSILRTADASGVDGVIIPKHRAVGI 179

Query: 173 SAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALI 232
           + ++ K+++GA+EH+P  R++NL  A+Q++   GF   G         +   K   IAL+
Sbjct: 180 TPIVTKTSTGAVEHVPVARVTNLVQAVQQLKETGFWVFGTDMTGTNFQKWNAK-GSIALV 238

Query: 233 LGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
           +G EGKG+ P  ++    +  + M G +++LN S AA + +Y   +  
Sbjct: 239 IGNEGKGMSPGLKKEMDELLTIPMTGHVQSLNASVAAGLLMYQAFSQR 286


>gi|94968032|ref|YP_590080.1| RNA methyltransferase TrmH, group 3 [Candidatus Koribacter
           versatilis Ellin345]
 gi|94550082|gb|ABF40006.1| RNA methyltransferase TrmH, group 3 [Candidatus Koribacter
           versatilis Ellin345]
          Length = 261

 Score =  134 bits (338), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 62/242 (25%), Positives = 112/242 (46%), Gaps = 10/242 (4%)

Query: 48  NLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDA---NLPHPFPVKTVPPQTIDKI 104
              +YG+H VS AL +  R    +   K+ +                 V+ +P   +D+ 
Sbjct: 1   MDVIYGIHPVSEALKSRGRSFQYVAIAKDRMDPRVQRIVEDARESGITVRFLPRDFLDR- 59

Query: 105 VGKEAVHQGLALETAPLLSPTLDA-----VRNSQLLMVLDHVNDPHNIGAILRSAVAFSC 159
                +HQG+   T+      LD            ++VLD + DPHN+GA++RSA     
Sbjct: 60  TANTNMHQGVIAVTSKKEYLDLDDIIEKKRGEHAFVVVLDGIEDPHNLGALIRSADGAGV 119

Query: 160 DGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQK-MHSWGFQTIGLSSDSKK 218
           DG++  +R +   +    K+++GA E++P  R++N+  +++     +   T+GL     +
Sbjct: 120 DGVVIPERRAVGVTGTAMKASAGAAEYVPIARVTNIARSIEDLKDKYNVWTVGLDERGTQ 179

Query: 219 PLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQN 278
             ++   N  +AL+LGAEGKGL    ++    +  + M G + +LNVS A  + +Y    
Sbjct: 180 NYDEIDYNMSLALVLGAEGKGLHDLVRKKCDLLVKIPMAGEVSSLNVSVAGGIVMYEVSR 239

Query: 279 HF 280
             
Sbjct: 240 QR 241


>gi|86605012|ref|YP_473775.1| RNA methyltransferase [Synechococcus sp. JA-3-3Ab]
 gi|86553554|gb|ABC98512.1| RNA methyltransferase, TrmH family, group 3 [Synechococcus sp.
           JA-3-3Ab]
          Length = 354

 Score =  134 bits (338), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 70/256 (27%), Positives = 115/256 (44%), Gaps = 11/256 (4%)

Query: 36  FNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATK---NALARLDWDANLPHPFP 92
                   ++PE   +YG  TV AAL + +      +  +   +       +        
Sbjct: 82  LQVNRDPEAEPEQEIIYGRQTVLAALRSQATLNRVWVLPRLRYSPQFWSLLEEAKARGTV 141

Query: 93  VKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLD-------AVRNSQLLMVLDHVNDPH 145
           +  V  Q ++ +    A HQG+A +  P     L+             +L+VLD + DPH
Sbjct: 142 IDEVSLQRLNLLTA-GANHQGIAAQATPYRYVDLEELVEQSRQSGPHPVLVVLDGIQDPH 200

Query: 146 NIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSW 205
           N+GAI RS  AF   G++  +R +   +A + K A+GAL  +P  R+ NL  AL+ +   
Sbjct: 201 NLGAIARSVEAFGMQGMVIPQRRAAGVTATVMKVAAGALSTLPVARVVNLNRALEYLKGQ 260

Query: 206 GFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNV 265
           GF   G +S    P+        IAL++G+EG+G+   TQ     +  + + G  ++LN 
Sbjct: 261 GFWVYGTTSQGAAPIYSADFRRPIALVVGSEGEGISLLTQRHCDQLLSIPLAGRTESLNA 320

Query: 266 SNAAAVALYITQNHFA 281
           S AA +ALY      +
Sbjct: 321 SVAAGIALYEIHRQRS 336


>gi|300721497|ref|YP_003710772.1| putative tRNA /rRNA methyltransferase [Xenorhabdus nematophila ATCC
           19061]
 gi|297627989|emb|CBJ88538.1| putative tRNA/rRNA methyltransferase [Xenorhabdus nematophila ATCC
           19061]
          Length = 245

 Score =  134 bits (338), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 69/242 (28%), Positives = 112/242 (46%), Gaps = 10/242 (4%)

Query: 48  NLFLYGVHTVSAALNNPSRKIFQLLATKNALARLD---WDANLPHPFPVKTVPPQTIDKI 104
           +  +YG+H V A L +  ++  ++   K    R     +         V+    Q +D  
Sbjct: 2   SEIIYGIHAVKALLESDPQRFMEVYVLKGREDRRLTPLFQELESIGITVQLANRQWLDAQ 61

Query: 105 VGKEAVHQGLALETAPLLSP------TLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFS 158
             + AVHQG+     P           L +  +   L+VLD V DPHN+GA LR+A A  
Sbjct: 62  T-EGAVHQGIIARVKPGRQYQENDLPDLLSQLDRPFLLVLDGVTDPHNLGACLRTADAAG 120

Query: 159 CDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKK 218
            D +I  +  S   +A   K A GA E++P IR++NL   L+ +       +G + ++  
Sbjct: 121 VDAVIVPRDRSAQLNATAKKVACGAAENVPLIRVTNLARTLRLLQEHNIWIVGTAGEATH 180

Query: 219 PLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQN 278
            L +      +AL++GAEG+G+R  T+E    +  + M G + +LNVS A  V L+    
Sbjct: 181 ALYESKLTGPMALVMGAEGEGMRRLTREHCDELISIPMAGSVSSLNVSVATGVCLFEIVR 240

Query: 279 HF 280
             
Sbjct: 241 QR 242


>gi|294671054|ref|ZP_06735909.1| hypothetical protein NEIELOOT_02762 [Neisseria elongata subsp.
           glycolytica ATCC 29315]
 gi|291307162|gb|EFE48405.1| hypothetical protein NEIELOOT_02762 [Neisseria elongata subsp.
           glycolytica ATCC 29315]
          Length = 249

 Score =  134 bits (337), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 67/239 (28%), Positives = 110/239 (46%), Gaps = 9/239 (3%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLATK---NALARLDWDANLPHPFPVKTVPPQTIDKIVG 106
            +YG H V+  L    + I +L   +   +A  R   +        V       ++ I  
Sbjct: 6   LIYGFHAVNTRLWQNPKSITELYVQEGKNDARTRDVLEKAANENVRVHFADADRLNAIS- 64

Query: 107 KEAVHQGLALET-----APLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDG 161
           K A HQG+            L   L+ +    LL++LD + DPHN+GA LR+A A     
Sbjct: 65  KGARHQGVVGFIDASKNHVHLEDVLENLSEPPLLLILDGITDPHNLGACLRTADAMGVHA 124

Query: 162 IITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLE 221
           +I  K  +   +A ++K A GA E +PYI ++NL   L+++  +G   IG        L 
Sbjct: 125 VIAPKDKNAGLNATVSKVACGAAETVPYITVTNLARTLRELKEYGIWIIGTDMGGDSDLY 184

Query: 222 QEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
                D  A ++G EG+G+R  T+E    +  + M G ++++NVS +A + L  T+   
Sbjct: 185 HCDLPDSAAWVMGNEGEGMRRLTREHCDMLVSIPMFGTVESMNVSVSAGMVLSETRRQR 243


>gi|218247732|ref|YP_002373103.1| tRNA/rRNA methyltransferase SpoU [Cyanothece sp. PCC 8801]
 gi|218168210|gb|ACK66947.1| tRNA/rRNA methyltransferase (SpoU) [Cyanothece sp. PCC 8801]
          Length = 260

 Score =  134 bits (337), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 51/255 (20%), Positives = 104/255 (40%), Gaps = 4/255 (1%)

Query: 27  HRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALN-NPSRKIFQLLATKNALARLDWDA 85
           +   K+++  + +++   +   L   G H +  A   N S       A   +     W+ 
Sbjct: 7   NPLVKQIRQLH-RTKGRREQNLLLFEGTHLLETACEVNCSLDCLCYTAQWQSRYPQLWEL 65

Query: 86  NLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDHVNDPH 145
                  ++ V P+ +  +         +A         +   + + ++ ++L+ + DP 
Sbjct: 66  ATQKAQRIELVSPEVLQALATTVNPDGVIATAV--NPKISKPTIADFKIGLILERLQDPG 123

Query: 146 NIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSW 205
           N+G I+R+AVA   DGI  +      ++  + +S++GA  H+P I   +L+  ++   + 
Sbjct: 124 NLGTIIRTAVATEIDGIWLSSDSVDIDNPKVLRSSAGAWFHVPLIVSCDLSATIKHYQAS 183

Query: 206 GFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNV 265
           G Q I     +              ++LG EG GL  +    A     + +   I++LNV
Sbjct: 184 GVQVIATLPTATNTYWDVDLTQPSLILLGNEGAGLSEELASLADQTVSIPLGNTIESLNV 243

Query: 266 SNAAAVALYITQNHF 280
           + A A+ LY  Q   
Sbjct: 244 AIACALLLYERQRQI 258


>gi|317472693|ref|ZP_07932008.1| RNA methyltransferase [Anaerostipes sp. 3_2_56FAA]
 gi|316899870|gb|EFV21869.1| RNA methyltransferase [Anaerostipes sp. 3_2_56FAA]
          Length = 246

 Score =  134 bits (337), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 58/243 (23%), Positives = 106/243 (43%), Gaps = 12/243 (4%)

Query: 47  ENLFLYGVHTVSAALNNPS--RKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKI 104
           E   L G + V  AL       KI+ L   ++   R            +  V  + +D++
Sbjct: 4   EEYLLAGRNAVLEALRAGKPIDKIYILDGCQDGPVRTIVREAKKTDAVLNFVEKERLDQL 63

Query: 105 VGKEAVHQGLALETAPLLSPTLDA-------VRNSQLLMVLDHVNDPHNIGAILRSAVAF 157
             +   HQG+    A      ++         +     ++LD + DPHN+GAI+R+A   
Sbjct: 64  TKEH--HQGVVAMAAAYEYGQMEDLFARAEEKKEDPFFILLDGIEDPHNLGAIIRTANLA 121

Query: 158 SCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSK 217
              G+I  KR +   +  +AK+++GAL + P ++++NL++ ++++   G   +       
Sbjct: 122 GAHGVIIPKRRAVGLTPTVAKTSAGALNYTPVVKVTNLSNTMEELKERGLWFVCA-DMDG 180

Query: 218 KPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQ 277
             + ++     I L++G EG G+    +E     A + M G I +LN S AA V  Y   
Sbjct: 181 DMMYRQNLTGPIGLVIGNEGSGVSRLVKERCDYTASIPMNGDIDSLNASVAAGVLAYEIV 240

Query: 278 NHF 280
              
Sbjct: 241 RQR 243


>gi|113475949|ref|YP_722010.1| RNA methyltransferase [Trichodesmium erythraeum IMS101]
 gi|110166997|gb|ABG51537.1| RNA methyltransferase, TrmH family, group 3 [Trichodesmium
           erythraeum IMS101]
          Length = 288

 Score =  134 bits (337), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 71/290 (24%), Positives = 129/290 (44%), Gaps = 27/290 (9%)

Query: 6   KKKSEKIFSLKDSHYAKLRRNHRDYKKMQSFNQKSRHT-----SQPENLFLYGVHTVSAA 60
             K+ K  S +              K++Q  + +S+        + +   +YG HTV AA
Sbjct: 2   STKNYKFNSQEKPQ---------KNKQIQLKDGRSKKYYSPTVKEEDEDLIYGRHTVQAA 52

Query: 61  LNNPSRKIFQLLA----TKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLAL 116
           L +  R + ++        +    +  +        +  V  + +D+I  +   HQG+  
Sbjct: 53  LKS-ERYLNRIWIISSLRYDPRFHILLNEAKTKGTIIDEVDDRRLDQIT-RRKHHQGIVA 110

Query: 117 ETAPLLSPTLDA-------VRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYS 169
           +  P     L           +  +L+V D +NDPHN+GAI+R+  A    G++  +R +
Sbjct: 111 QICPYEYKELHELISQAKSKTDRSVLLVADGINDPHNLGAIIRTGEALGIQGLVIPQRRA 170

Query: 170 PSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKI 229
              ++ + K A+GALE+ P  R+ NL  AL+++   GF   G  +   +P+        I
Sbjct: 171 VGITSTVTKVAAGALENFPVARVINLNSALEELKKEGFWIYGTVAKDGEPIHTVKFTGAI 230

Query: 230 ALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNH 279
            L++G+EG+GL    Q+   ++  + M G   +LNVS A  +A+Y     
Sbjct: 231 VLVVGSEGEGLSLLIQKNCDALVSIPMSGSTPSLNVSVATGMAIYEIHRQ 280


>gi|291550111|emb|CBL26373.1| rRNA methylase, putative, group 3 [Ruminococcus torques L2-14]
          Length = 254

 Score =  134 bits (337), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 60/249 (24%), Positives = 109/249 (43%), Gaps = 11/249 (4%)

Query: 42  HTSQPENLFLYGVHTVSAALNNPSR--KIFQLLATKNALARLDWDANLPHPFPVKTVPPQ 99
                E   + G + V  A  +     KI+ L   ++   R        H   +  V  +
Sbjct: 5   REQGTETFVIEGRNAVLEAFRSGRTIDKIYVLDGCQDGPVRTIVREAKKHGSLINFVTKE 64

Query: 100 TIDKIVGKEAVHQGLALETAPLLSPTLDAV-------RNSQLLMVLDHVNDPHNIGAILR 152
            + ++  +   HQG+    A     T+D +         +  L++LD++ DPHN+GAI+R
Sbjct: 65  RLSQLS-ETGKHQGVIAHAAAYEYSTIDDMLKLAEERGEAPFLILLDNIEDPHNLGAIIR 123

Query: 153 SAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGL 212
           +A      G+I  KR +   +A +AK+++GAL + P  +++NL   ++++   G   +  
Sbjct: 124 TANLAGAHGVIIPKRRAVGLTATVAKTSAGALNYTPVAKVTNLVKTMEELKEKGLWFVCA 183

Query: 213 SSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVA 272
                + +        I L++G EG+G+    +E    +A + M G I +LN S AA V 
Sbjct: 184 -DMDGEQMYDLNLTGPIGLVIGNEGEGVGRLVKENCDFVAGIPMKGQINSLNASVAAGVL 242

Query: 273 LYITQNHFA 281
            Y       
Sbjct: 243 AYEIVRQRI 251


>gi|242238241|ref|YP_002986422.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Dickeya dadantii
           Ech703]
 gi|242130298|gb|ACS84600.1| RNA methyltransferase, TrmH family, group 3 [Dickeya dadantii
           Ech703]
          Length = 244

 Score =  134 bits (337), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 67/241 (27%), Positives = 104/241 (43%), Gaps = 8/241 (3%)

Query: 48  NLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANL---PHPFPVKTVPPQTIDKI 104
           +  +YG+H V A L    ++  ++   K    R               VK    Q +D+ 
Sbjct: 2   SEIIYGIHAVKALLERDPQRFLEVFTLKGREDRRLLPLIAELEATGIAVKVANRQWLDEK 61

Query: 105 VGKEAVHQGLALETAPLLSPTLD-----AVRNSQLLMVLDHVNDPHNIGAILRSAVAFSC 159
                    +A           D       R++  L+VLD V DPHN+GA LRSA A   
Sbjct: 62  AEGAVHQGIIARVREGRQYQENDLPGLLETRDTPFLLVLDGVTDPHNLGACLRSADAAGV 121

Query: 160 DGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKP 219
             +I  +  S   +A   K A GA E +P IR++NL   L+ +       +G + ++   
Sbjct: 122 HAVIVPRDRSAQLNATAKKVACGAAESVPLIRVTNLARTLRFLQERNVWIVGTAGEADHT 181

Query: 220 LEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNH 279
           L Q      +AL++GAEG+G+R  T+E    +  + M G + +LNVS A  V L+     
Sbjct: 182 LYQSKLTGPLALVMGAEGEGMRRLTREHCDELISIPMAGSVSSLNVSVATGVCLFEAVRQ 241

Query: 280 F 280
            
Sbjct: 242 R 242


>gi|197251745|ref|YP_002149283.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Salmonella enterica
           subsp. enterica serovar Agona str. SL483]
 gi|197215448|gb|ACH52845.1| RNA methyltransferase, TrmH family, group 3 [Salmonella enterica
           subsp. enterica serovar Agona str. SL483]
          Length = 243

 Score =  134 bits (337), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 68/243 (27%), Positives = 110/243 (45%), Gaps = 10/243 (4%)

Query: 48  NLFLYGVHTVSAALNNPSRKIFQLLATKNALARLD---WDANLPHPFPVKTVPPQTIDKI 104
           +  +YG+H V A L     +  ++   K    +       A       ++    Q +D+ 
Sbjct: 2   SEMIYGIHAVQALLERAPERFQEVFILKGREDKRLLPLIHALESQGVVIQLANRQYLDEK 61

Query: 105 VGKEAVHQGLALETAPLLSP------TLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFS 158
               AVHQG+     P           L A+ +   L++LD V DPHN+GA LRSA A  
Sbjct: 62  SD-GAVHQGIIARVKPGRQYQENDLPDLIALHDRPFLLILDGVTDPHNLGACLRSADAAG 120

Query: 159 CDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKK 218
              +I  K  S   +A   K A GA E +P IR++NL   ++ +       +G + ++  
Sbjct: 121 VHAVIVPKDRSAQLNATAKKVACGAAESVPLIRVTNLARTMRMLREENIWIVGTAGEADH 180

Query: 219 PLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQN 278
            L Q     ++AL++GAEG+G+R  T+E    +  + M G + +LNVS A  + L+    
Sbjct: 181 TLYQSKMPGRMALVMGAEGEGMRRLTREHCDELISIPMAGSVSSLNVSVATGICLFEAVR 240

Query: 279 HFA 281
              
Sbjct: 241 QRT 243


>gi|77456761|ref|YP_346266.1| RNA methyltransferase TrmH, group 3 [Pseudomonas fluorescens Pf0-1]
 gi|77380764|gb|ABA72277.1| 23S rRNA Gm-2251 2'-O-methyltransferase [Pseudomonas fluorescens
           Pf0-1]
          Length = 255

 Score =  134 bits (337), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 76/238 (31%), Positives = 118/238 (49%), Gaps = 8/238 (3%)

Query: 51  LYGVHTVSAALNNPSRKIFQLLATKNA-LARLDWDANLPHPFPVKTVPPQTIDKIVGKEA 109
           +YGVH V A L +  +++ Q+   ++    R+     L +   V+    +  +     E 
Sbjct: 7   IYGVHAVEALLRHHPKRVKQIWLAESRNDPRVQTLIELANENRVQIGQAERREMDAWVEG 66

Query: 110 VHQGLALETAPLLSP-------TLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGI 162
           VHQG+  + +P            LD    + LL+VLD V DPHN+GA LRSA A     +
Sbjct: 67  VHQGVVADVSPSQVWGEAMLDELLDRTEGAPLLLVLDGVTDPHNLGACLRSADAAGALAV 126

Query: 163 ITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQ 222
           I  K  S + + V+ K A GA E IP + ++NL   L+K+   G   +G + +++  +  
Sbjct: 127 IVPKDKSATLTPVVRKVACGAAEVIPLVAVTNLARTLEKLQQRGLWIVGTAGEAEVSIYD 186

Query: 223 EIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
           +       LI+GAEGKG+R  T+E    + HL M G + +LNVS A  V L+  Q   
Sbjct: 187 QDLTGPTILIMGAEGKGMRRLTREHCDYLVHLPMAGSVSSLNVSVATGVCLFEAQRQR 244


>gi|308188261|ref|YP_003932392.1| hypothetical tRNA/rRNA methyltransferase [Pantoea vagans C9-1]
 gi|308058771|gb|ADO10943.1| hypothetical tRNA/rRNA methyltransferase [Pantoea vagans C9-1]
          Length = 244

 Score =  134 bits (337), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 70/243 (28%), Positives = 110/243 (45%), Gaps = 10/243 (4%)

Query: 48  NLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDW---DANLPHPFPVKTVPPQTIDKI 104
           +  ++G+H V A L    ++  ++   K    R       A       ++    + +D  
Sbjct: 2   SEIIFGIHAVQALLERDPQRFQEVFILKGRDDRRLQPVVAALETQGIVIQLAERKWLDSQ 61

Query: 105 VGKEAVHQGLALETAPLLSP------TLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFS 158
           V +  VHQG+     P           L        L+VLD V DPHN+GA LRSA A  
Sbjct: 62  V-EGGVHQGIVARVKPGRQYQEGDLPDLLQSLEKPFLLVLDGVTDPHNLGACLRSADAAG 120

Query: 159 CDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKK 218
              II  K  S   +A   K ASGA E++P IR++NL   L+ +  +    +G + ++  
Sbjct: 121 VHAIIVPKDRSAPLNATAKKVASGAAENVPLIRVTNLARTLRLLQEYNIWVVGTAGEADH 180

Query: 219 PLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQN 278
            + Q      +AL++GAEG+G+R  T+E    +  + M G + +LNVS A  V L+    
Sbjct: 181 TVFQSKMTGPMALVMGAEGEGMRRLTREHCDELISIPMAGSVSSLNVSVATGVCLFEAVR 240

Query: 279 HFA 281
              
Sbjct: 241 QRN 243


>gi|126656411|ref|ZP_01727672.1| tRNA/rRNA methyltransferase (SpoU) [Cyanothece sp. CCY0110]
 gi|126622097|gb|EAZ92804.1| tRNA/rRNA methyltransferase (SpoU) [Cyanothece sp. CCY0110]
          Length = 261

 Score =  134 bits (337), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 51/255 (20%), Positives = 105/255 (41%), Gaps = 4/255 (1%)

Query: 26  NHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDA 85
            +   K+++  + +++   +   L L G H V  A       +      +          
Sbjct: 6   RNPLIKQIRKLH-RTKGRREQNLLLLEGTHLVETAYQEGCSLMTLCYTEQWRDRYPQLWE 64

Query: 86  NLPHPFPVKT-VPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDHVNDP 144
           N+         V  + +  I     V+    + TA     T + + + QL +V++ + DP
Sbjct: 65  NVSKRVKRSELVSIEVLSNIT--TTVNPDGVVATALFQPRTEEEITDFQLGLVIERLQDP 122

Query: 145 HNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHS 204
            N+G I+R+A A   D I  +      ++  + ++++G+   +P    S+LT  ++K  +
Sbjct: 123 GNLGTIIRTAAATEIDAIWLSDDSVDIDNPKVLRASAGSWFQVPIFVTSDLTTVIKKSKN 182

Query: 205 WGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALN 264
            G   I    D+ +   Q        ++LG EG GL       A ++  + +   +++LN
Sbjct: 183 KGINIIATLPDATQSYWQLSFTKPTLILLGNEGSGLSNSLISLADNLVSIPLGPGVESLN 242

Query: 265 VSNAAAVALYITQNH 279
           V+ A A+ LY  +  
Sbjct: 243 VAIATALLLYEAKRQ 257


>gi|34496604|ref|NP_900819.1| RNA methyltransferase [Chromobacterium violaceum ATCC 12472]
 gi|52783300|sp|Q7NYX3|RLMB_CHRVO RecName: Full=23S rRNA (guanosine-2'-O-)-methyltransferase RlmB;
           AltName: Full=23S rRNA Gm2251 2'-O-methyltransferase
 gi|34102459|gb|AAQ58824.1| probable RNA methyltransferase [Chromobacterium violaceum ATCC
           12472]
          Length = 248

 Score =  134 bits (337), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 64/238 (26%), Positives = 114/238 (47%), Gaps = 7/238 (2%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLA---TKNALARLDWDANLPHPFPVKTVPPQTIDKIVG 106
            ++G H ++A L    + + ++       +A A+   D        +  V  + +D + G
Sbjct: 6   LIHGFHAINARLWQNPKSLIEIWLAGGRHDARAKAVLDKAGAENVKLHIVDKERLDSMSG 65

Query: 107 KEAVHQGLALETAPLLSPTLDAV----RNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGI 162
                  +A+  A +    LD V        LL++LD V DPHN+GA LR A A     +
Sbjct: 66  NARHQGVVAMIDASMNYVDLDDVLENLSEPPLLLILDGVTDPHNLGACLRVADAMGAHAV 125

Query: 163 ITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQ 222
           I  K  S + +A ++K A GA E +PYI ++NL   L+ +   G    G + ++   L  
Sbjct: 126 IAPKDRSATLNATVSKVACGAAEVVPYITVTNLARTLRDLKDAGVWIAGTTMEADTDLYH 185

Query: 223 EIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
              +  +A ++GAEG+G+R  T+E    +  + M G +++LNVS ++ + L  ++   
Sbjct: 186 FDASGPLAWVMGAEGEGMRRLTREHCDVLVSIPMFGTVESLNVSVSSGMVLSESRRQR 243


>gi|261342841|ref|ZP_05970699.1| RNA methyltransferase, TrmH family, group 3 [Enterobacter
           cancerogenus ATCC 35316]
 gi|288314883|gb|EFC53821.1| RNA methyltransferase, TrmH family, group 3 [Enterobacter
           cancerogenus ATCC 35316]
          Length = 243

 Score =  134 bits (337), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 60/242 (24%), Positives = 105/242 (43%), Gaps = 8/242 (3%)

Query: 48  NLFLYGVHTVSAALNNPSRKIFQLLATKNALARLD---WDANLPHPFPVKTVPPQTIDKI 104
           +  +YG+H V A L     +  ++   K    +       A       ++    Q +D+ 
Sbjct: 2   SEMIYGIHAVQALLERAPERFQEVFILKGREDKRLMPLIHALEAQGVVIQLANRQYLDEK 61

Query: 105 VGKEAVHQGLALETAPLLSPTLDAVR-----NSQLLMVLDHVNDPHNIGAILRSAVAFSC 159
                    +A           D        ++   ++LD V DPHN+GA LRSA A   
Sbjct: 62  SEGAVHQGIIARVKPGRQYQENDLPDLIAGLDNPFFLILDGVTDPHNLGACLRSADAAGV 121

Query: 160 DGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKP 219
             +I  +  S   +A   K A GA E++P IR++NL   ++ +       +G + ++   
Sbjct: 122 HAVIVPRDRSAQLNATAKKVACGAAENVPLIRVTNLARTMRLLQEENIWIVGTAGEADHT 181

Query: 220 LEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNH 279
           L Q     ++AL++GAEG+G+R  T+E    +  + M G + +LNVS A  + L+     
Sbjct: 182 LYQSKMTGRMALVMGAEGEGMRRLTREHCDELISIPMAGSVSSLNVSVATGICLFEAVRQ 241

Query: 280 FA 281
            +
Sbjct: 242 RS 243


>gi|22298586|ref|NP_681833.1| putative tRNA/rRNA methyltransferase [Thermosynechococcus elongatus
           BP-1]
 gi|22294766|dbj|BAC08595.1| tll1042 [Thermosynechococcus elongatus BP-1]
          Length = 295

 Score =  134 bits (337), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 68/278 (24%), Positives = 128/278 (46%), Gaps = 22/278 (7%)

Query: 24  RRNHRDYKKMQSFNQKSRHTSQPEN----------LFLYGVHTVSAALNNPSRKIFQLLA 73
           ++N    K+     +++      +             LYG H V +AL +  R   ++  
Sbjct: 9   KKNRPPAKRPPRLQRRTPAQPLQKAPPTAPAADAPELLYGRHAVLSALESG-RPCNRIWV 67

Query: 74  TK----NALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDA- 128
                 +       +        + TV P+ +D++  +   HQG+A++ A     +L+  
Sbjct: 68  IPSLRYDPRFHQRLNEAKQQGAIIDTVTPERLDQLC-QRGRHQGIAIQVAAYNYWSLEDL 126

Query: 129 -----VRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGA 183
                  N  +L+  D + DP N+GA++R+A A    G+I  +R +   +A +AK+A+GA
Sbjct: 127 LAKAATVNQPVLLAADGITDPQNLGAMIRTAEALGMQGVIIPQRRAVGITATVAKAAAGA 186

Query: 184 LEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPK 243
           LE++P  R+ NL  AL+ + + G+   GLS     PL +   +     ++G+EG+G+  +
Sbjct: 187 LEYLPVARVINLNQALETLKAAGYWIYGLSEHGAVPLPKITFDRPTVFVVGSEGEGISLQ 246

Query: 244 TQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHFA 281
           TQ+    +  + + G   +LN S A  +ALY      +
Sbjct: 247 TQKHCDEIVAIPLAGRTNSLNASVAVGIALYEINCQRS 284


>gi|224824690|ref|ZP_03697797.1| RNA methyltransferase, TrmH family, group 3 [Lutiella nitroferrum
           2002]
 gi|224603183|gb|EEG09359.1| RNA methyltransferase, TrmH family, group 3 [Lutiella nitroferrum
           2002]
          Length = 251

 Score =  134 bits (337), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 64/238 (26%), Positives = 113/238 (47%), Gaps = 7/238 (2%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLA---TKNALARLDWDANLPHPFPVKTVPPQTIDKIVG 106
            ++G H V+A L    + + ++      ++A A+   D        +  V    +D + G
Sbjct: 6   LIHGFHAVNARLWQNPKSLLEIWLAGGRQDARAQAVLDKAAAENIKLHIVDKARLDSMSG 65

Query: 107 KEAVHQGLALETAPLLSPTLDAV----RNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGI 162
                  +A+  A     +LD V        LL++LD V DPHN+GA LR A A     +
Sbjct: 66  NARHQGVVAMIDASRSYVSLDDVLENLSEPPLLLILDGVTDPHNLGACLRVADAMGAHAV 125

Query: 163 ITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQ 222
           I  K  S + +A ++K A GA E +PYI ++NL   L+ +   G    G + ++   L  
Sbjct: 126 IAPKDRSATLNATVSKVACGAAEVVPYITVTNLARTLRDLKDAGVWIAGTTMEADTDLYH 185

Query: 223 EIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
                 +A ++G+EG+G+R  T+E    +  + M G +++LNVS ++ + L  ++   
Sbjct: 186 FDAAGPLAWVMGSEGEGMRRLTREHCDVLVSIPMFGSVESLNVSVSSGMVLSESRRQR 243


>gi|160871681|ref|ZP_02061813.1| RNA methyltransferase, TrmH family, group 3 [Rickettsiella grylli]
 gi|159120480|gb|EDP45818.1| RNA methyltransferase, TrmH family, group 3 [Rickettsiella grylli]
          Length = 253

 Score =  134 bits (337), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 75/252 (29%), Positives = 119/252 (47%), Gaps = 15/252 (5%)

Query: 43  TSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARL---DWDANLPHPFPVKTVPPQ 99
            +QPE  F++G HT++A L +  +KI  L   ++   +      +    H  P+ T+   
Sbjct: 2   RNQPEKEFIFGFHTITALLKSAPQKIDTLYCREDRQDKRVQSIRNLAKLHGIPIGTLSKV 61

Query: 100 TIDKIVGKEAVHQGLALET-----------APLLSPTLDAVRNSQLLMVLDHVNDPHNIG 148
             ++I    AVHQG+  +               L   L    N   L+VLD V DPHN+G
Sbjct: 62  QCNEIA-PNAVHQGVFAKIKKTSRLNEQDLMIFLHHRLHNNLNPPFLLVLDGVQDPHNLG 120

Query: 149 AILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQ 208
           A LRSA A   D +I  +  + +++ ++ K+A+GA E      ++NL   L+++   G  
Sbjct: 121 ACLRSANAAGVDAVIIPQDRAVNKTPIVQKTAAGAAEVTSLFTVTNLATCLERLKKCGIW 180

Query: 209 TIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNA 268
             GL     + +        +AL+LGAEGKGLR  T+     +  + M G + +LNVS A
Sbjct: 181 CYGLDQSGTRLIYDAPLTGPLALVLGAEGKGLRRLTKVCCDDLVAIPMVGTVGSLNVSVA 240

Query: 269 AAVALYITQNHF 280
           A V L+      
Sbjct: 241 AGVGLFEVVRQR 252


>gi|148381081|ref|YP_001255622.1| RNA methyltransferase, TrmH family [Clostridium botulinum A str.
           ATCC 3502]
 gi|153930840|ref|YP_001385454.1| RNA methyltransferase [Clostridium botulinum A str. ATCC 19397]
 gi|153936028|ref|YP_001388861.1| RNA methyltransferase [Clostridium botulinum A str. Hall]
 gi|168179627|ref|ZP_02614291.1| RNA methyltransferase, TrmH family [Clostridium botulinum NCTC
           2916]
 gi|148290565|emb|CAL84694.1| putative RNA methylase [Clostridium botulinum A str. ATCC 3502]
 gi|152926884|gb|ABS32384.1| RNA methyltransferase, TrmH family [Clostridium botulinum A str.
           ATCC 19397]
 gi|152931942|gb|ABS37441.1| RNA methyltransferase, TrmH family [Clostridium botulinum A str.
           Hall]
 gi|182669725|gb|EDT81701.1| RNA methyltransferase, TrmH family [Clostridium botulinum NCTC
           2916]
          Length = 259

 Score =  134 bits (337), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 55/262 (20%), Positives = 107/262 (40%), Gaps = 9/262 (3%)

Query: 24  RRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDW 83
            ++++  K+++   +K ++ +Q ++  + G      AL + S  + ++   + +L +L+ 
Sbjct: 4   SKDNQLIKEVRKLREK-KYRTQNKSFIVEGFRFFEEALKSNS-SVNKVFIEEKSLNKLEE 61

Query: 84  ---DANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDH 140
                N+ +      V    +  I G     QG+           LD      +L+  D 
Sbjct: 62  LYKKYNINNDIETYVVSYSVLKSI-GNTENPQGIVSVINYFKKEKLDLQNGFYILV--DK 118

Query: 141 VNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQ 200
           V DP N+G I+R+A A    GIITTK      +    +S  G++ +IP I   NL     
Sbjct: 119 VQDPGNMGTIIRTAHAAGALGIITTKGTVDIYNEKTLRSTMGSIFYIPIIEDENLEVVKS 178

Query: 201 KMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGII 260
                    +     +    +  +K D + + +G EG G+       +     + MPG  
Sbjct: 179 LRKKGFKLLVSSLDTNSNFYDVNMK-DNMIIAVGNEGNGISEVLNTLSDIKVKIPMPGAA 237

Query: 261 KALNVSNAAAVALYITQNHFAK 282
           ++LNV+ A ++  +       K
Sbjct: 238 ESLNVAVACSIMTFERIRQINK 259


>gi|294791945|ref|ZP_06757093.1| RNA methyltransferase, TrmH family, group 3 [Veillonella sp.
           6_1_27]
 gi|294457175|gb|EFG25537.1| RNA methyltransferase, TrmH family, group 3 [Veillonella sp.
           6_1_27]
          Length = 243

 Score =  134 bits (337), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 58/238 (24%), Positives = 109/238 (45%), Gaps = 8/238 (3%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLATKNALARLDWD--ANLPHPFPVKTVPPQTIDKIVGK 107
           ++ G + V  AL +       L++       L             V+  P + ++K    
Sbjct: 4   YIVGRNAVKEALKSGRSIQRILVSEDKVKTGLADIVGLAKSQGIEVRPTPIKQMNKY-DL 62

Query: 108 EAVHQGLALETAPLLSPTL-----DAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGI 162
           E  HQG+    + +    L     +      LL++ D V DPHN+GAI+R+A       +
Sbjct: 63  EVPHQGVIALVSAVQFKELGEVLQETTHEVPLLILTDGVEDPHNMGAIIRTAECVGATAV 122

Query: 163 ITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQ 222
           +  KR++   +A +AK+++GA+E IP +++ N+   ++++   GF  +G   +  + L +
Sbjct: 123 LIPKRHNAPINATVAKTSAGAIEQIPLVQVGNVAQTIKQLQKQGFWVMGAHMEGDRTLYE 182

Query: 223 EIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
                   +++G EGKG+    +E    +  + M G + +LN S AAAV +Y      
Sbjct: 183 ADMTIPTVIVIGNEGKGISRVVKEACDFLVTIPMYGNLNSLNASVAAAVLMYEAVRQR 240


>gi|152995437|ref|YP_001340272.1| RNA methyltransferase [Marinomonas sp. MWYL1]
 gi|150836361|gb|ABR70337.1| RNA methyltransferase, TrmH family, group 3 [Marinomonas sp. MWYL1]
          Length = 255

 Score =  134 bits (337), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 67/249 (26%), Positives = 115/249 (46%), Gaps = 13/249 (5%)

Query: 46  PENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDW---DANLPHPFPVKTVPPQTID 102
            +  ++YG+H V  ALN    +I ++   +    +           +      V  + +D
Sbjct: 2   SDLEWIYGIHAVENALNQQPERIKEVRFQEGRDDKKTQRLMQLCKANKVRHSVVARRDLD 61

Query: 103 KIVG---KEAVHQGLALETAPLLSPTLDAVR-------NSQLLMVLDHVNDPHNIGAILR 152
           ++        VHQG+   TA   +     +         + L+++LD V DPHN+GA LR
Sbjct: 62  QLFTANKDRVVHQGVVAYTAMNKAGNEADLHSLVAGLEETPLIIILDGVTDPHNLGACLR 121

Query: 153 SAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGL 212
           SA A     ++  K  S   +A ++K A GA E IP   ++NL   ++K+   G    G 
Sbjct: 122 SADAAGAHAVVMPKDNSAPLNATVSKVACGAAESIPVYAVTNLARTMKKLQDQGVWIFGT 181

Query: 213 SSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVA 272
           + ++ + + ++      A+++GAEG G+R  T+E    +  L M G++ +LNVS A  V 
Sbjct: 182 AGEATQTIYEQDLTIPTAIVMGAEGDGMRRLTREQCDYLVKLPMAGVVSSLNVSVATGVC 241

Query: 273 LYITQNHFA 281
           LY      A
Sbjct: 242 LYEVVRQRA 250


>gi|310659526|ref|YP_003937247.1| hypothetical protein CLOST_2222 [Clostridium sticklandii DSM 519]
 gi|308826304|emb|CBH22342.1| putative enzyme [Clostridium sticklandii]
          Length = 242

 Score =  134 bits (337), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 55/240 (22%), Positives = 93/240 (38%), Gaps = 13/240 (5%)

Query: 51  LYGVHTVSAALNNPSRKIFQLLA---TKNALARLDWDANLPHPFPVKTVPPQTIDKIVGK 107
           + G + V  AL +  R I  L      K    +            +K V    +D++  +
Sbjct: 3   ISGRNPVLEALKSN-RTIDCLYIKAGDKEGSIKKILSIAKEQKILIKEVDKTKLDELA-E 60

Query: 108 EAVHQGLALETAPLLSPTLDA-------VRNSQLLMVLDHVNDPHNIGAILRSAVAFSCD 160
              HQG+           L+               ++LD + DPHN+GAI+RSA      
Sbjct: 61  GTQHQGVVALVTDYKYYELEEVLDEIREKDEKPFFIILDEIEDPHNLGAIIRSAEGAGAH 120

Query: 161 GIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPL 220
           G+I  KR S S +A + K+A+GA  +   +       +  +        I       +  
Sbjct: 121 GVIIPKRRSASVNATVEKTAAGAASY-MKVIKVTNLVSTVEKLKKEGIWIYALDMDGESY 179

Query: 221 EQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
           +       +AL++G EGKG+    ++       + M G + +LN S AA++ LY      
Sbjct: 180 DTVDLKGSVALVVGNEGKGISRLLKDNCDFTLKIPMKGNVGSLNASVAASILLYEVVRQR 239


>gi|121602580|ref|YP_989621.1| RNA methyltransferase [Bartonella bacilliformis KC583]
 gi|120614757|gb|ABM45358.1| RNA methyltransferase, TrmH family [Bartonella bacilliformis KC583]
          Length = 274

 Score =  134 bits (337), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 44/256 (17%), Positives = 86/256 (33%), Gaps = 5/256 (1%)

Query: 26  NHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATK---NALARLD 82
           ++   K +++ N+K +  +Q       G+  V  ALN        + +     N      
Sbjct: 12  SNPIIKDLKALNKKKK-RNQEGLFMAEGLKLVIDALNLGWTIQTLIFSKSTQGNTTIENT 70

Query: 83  WDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDHVN 142
               L +   V     + ++ I  ++     + +                 + + LD V 
Sbjct: 71  AAHILANGGYVIRASQKIMESITHRDNPQTVVGIFKQQWHPIETITESAKDVYIALDRVR 130

Query: 143 DPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKM 202
           DP N+G I+R+A A    G+I     +    +     ++        +   N    L   
Sbjct: 131 DPGNLGTIIRTADAVGAKGVILI-GETTDPFSPETVRSTMGSIFSIPLYRFNENAFLDWS 189

Query: 203 HSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKA 262
            ++    IG                 I L++G E +GL          +A +   G   +
Sbjct: 190 TNFKGMIIGAHLQGAVDYRTIDFKGPIILLMGNEQQGLSNALANRCHQLARIPQNGHADS 249

Query: 263 LNVSNAAAVALYITQN 278
           LN++ A A+ LY  + 
Sbjct: 250 LNLAIATAIMLYEIRR 265


>gi|295091183|emb|CBK77290.1| rRNA methylases [Clostridium cf. saccharolyticum K10]
          Length = 278

 Score =  134 bits (337), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 47/267 (17%), Positives = 109/267 (40%), Gaps = 15/267 (5%)

Query: 26  NHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDA 85
           ++   K++ +  ++++   +     + G    S     P  ++ +   T++ L +   +A
Sbjct: 6   SNSQVKQVSAIAKRAKARRESGLFIVEGEKMFSEL---PKERLHRTYVTESFLRQQGEEA 62

Query: 86  -NLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLS-----------PTLDAVRNSQ 133
             L      +TV  + +  +   +     LAL                        +   
Sbjct: 63  DRLLAGCRYETVTDEVMKAMADTQTPQGILALCRQFSYELSDILGERKEGDEHTQEKAPA 122

Query: 134 LLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRIS 193
            L++L+ + DP N+G ILR+       G+I     +   +  + +S  G++  +P++ + 
Sbjct: 123 QLVILETLQDPGNLGTILRAGEGAGITGVIMNSTTADIYNPKVIRSTMGSVYRVPFVYVE 182

Query: 194 NLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAH 253
           +L  A++++   G +        +K  +Q+        ++G E  GL  +T E A +   
Sbjct: 183 DLAGAVRRVKQAGVRLYAAHLKGEKNYDQQDYTGSTGFLIGNEANGLSDETAELADAYIK 242

Query: 254 LHMPGIIKALNVSNAAAVALYITQNHF 280
           + M G +++LN + AA++ +Y T    
Sbjct: 243 IPMLGKVESLNAAVAASILMYETARQR 269


>gi|256847491|ref|ZP_05552937.1| tRNA/rRNA methyltransferase [Lactobacillus coleohominis 101-4-CHN]
 gi|256716155|gb|EEU31130.1| tRNA/rRNA methyltransferase [Lactobacillus coleohominis 101-4-CHN]
          Length = 257

 Score =  134 bits (337), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 52/270 (19%), Positives = 103/270 (38%), Gaps = 16/270 (5%)

Query: 9   SEKIFSLKDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKI 68
            E+I S+ + H           K  +    + +   +     L G H V  A ++  R I
Sbjct: 2   REQITSVHNQH----------VKDWRKLQTR-KGRKKFGQYLLDGWHLVQEASHSNQRLI 50

Query: 69  FQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDA 128
             + + +      D  A   +   V  V P+ I  I         +A+   P ++   + 
Sbjct: 51  ALIGSAEELSQHEDIVARFEN---VYEVTPEIIKHITETNTPQGIVAVVEMPDVNQVTNP 107

Query: 129 VRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIP 188
              + LL+  D V DP N+G ++R+A A    G++ +KR +   +  + +S  G+  H+ 
Sbjct: 108 KTGAWLLL--DRVQDPGNVGTMVRTADAAGFAGVVASKRTADFFNPKVVRSMQGSQFHLQ 165

Query: 189 YIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETA 248
            +                       +   K           AL++G EG+G+  +     
Sbjct: 166 LVVADLKRWINDFQDDQHPVYGTQLNPLAKNFRHVQPGKDFALVMGNEGQGMAEELLNQT 225

Query: 249 TSMAHLHMPGIIKALNVSNAAAVALYITQN 278
           T+  ++ M G  ++LNV+ +A + ++    
Sbjct: 226 TTNLYIPMRGNAESLNVAVSAGILMFQLNQ 255


>gi|116630022|ref|YP_815194.1| rRNA methylase [Lactobacillus gasseri ATCC 33323]
 gi|238853791|ref|ZP_04644157.1| rRNA methylase [Lactobacillus gasseri 202-4]
 gi|282851363|ref|ZP_06260728.1| RNA methyltransferase, TrmH family [Lactobacillus gasseri 224-1]
 gi|311110348|ref|ZP_07711745.1| rRNA methylase [Lactobacillus gasseri MV-22]
 gi|116095604|gb|ABJ60756.1| rRNA methylase [Lactobacillus gasseri ATCC 33323]
 gi|238833600|gb|EEQ25871.1| rRNA methylase [Lactobacillus gasseri 202-4]
 gi|282557331|gb|EFB62928.1| RNA methyltransferase, TrmH family [Lactobacillus gasseri 224-1]
 gi|311065502|gb|EFQ45842.1| rRNA methylase [Lactobacillus gasseri MV-22]
          Length = 253

 Score =  134 bits (337), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 55/251 (21%), Positives = 105/251 (41%), Gaps = 6/251 (2%)

Query: 26  NHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDA 85
           N+   K ++   QK ++  + +   + G H V  AL N    ++ +L T  AL +L    
Sbjct: 8   NNPTIKNLRKLEQK-KYRKKTQTYLIEGFHLVEEALKNHENYLY-ILGTSEALEKLTTSY 65

Query: 86  NLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDHVNDPH 145
            L     +K            K +    + L      S + +  +     +VLD++ DP 
Sbjct: 66  RLKDDKVIKITDAIAEHLSSTKNSQDIFMVLPINQPKSFSFEYGKW----VVLDNLTDPG 121

Query: 146 NIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSW 205
           N+G I+R+A A   DG++ ++      +  + +S  G+  HI  ++   L        + 
Sbjct: 122 NVGTIIRTADAAGFDGVVLSEESVDLYNPKVQRSMQGSQFHIQIVQNPILEAISSFKENG 181

Query: 206 GFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNV 265
               + +   + K L   I   ++AL++G E  G      ETA    ++ + G  ++LN 
Sbjct: 182 IPVYVSILDKTAKSLNNCIPVPQLALVIGNEAHGASKDVIETADKKIYIPIKGKAESLNA 241

Query: 266 SNAAAVALYIT 276
           + AA + +Y  
Sbjct: 242 AVAAGIMIYHF 252


>gi|260588913|ref|ZP_05854826.1| RNA methyltransferase, TrmH family, group 3 [Blautia hansenii DSM
           20583]
 gi|260540692|gb|EEX21261.1| RNA methyltransferase, TrmH family, group 3 [Blautia hansenii DSM
           20583]
          Length = 269

 Score =  134 bits (337), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 48/266 (18%), Positives = 109/266 (40%), Gaps = 12/266 (4%)

Query: 26  NHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDA 85
           ++   KK+Q   +K++   + +   + G+   S    +  +K++  L+   A        
Sbjct: 6   SNVQIKKVQQILKKAKVRREEQVFAVEGIKMFSEVPKSRLQKVY--LSQSFARKEECEKI 63

Query: 86  NLPHPFPVKT------VPPQTIDKIVGKEAVHQGLALETAPLLSP--TLDAVRNSQLLMV 137
            L     ++       V  +    +       QG+             + +   + LLM+
Sbjct: 64  LLEKGISIEETEYVELVDDKIFKNLSD-TVTPQGVLCLVKMENYTLSEILSGEENPLLMI 122

Query: 138 LDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTD 197
           L+ + DP N+G ILR+       G+I ++      +  + +S  G++  +P I ++++ +
Sbjct: 123 LEDLQDPGNLGTILRTGEGAGVTGVIMSRTSVDVFNPKVIRSTMGSVYRMPIIYVNSIEE 182

Query: 198 ALQKM-HSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHM 256
            +  +    G  T       +   ++E      A ++G EG GL  +  E+A ++  + M
Sbjct: 183 EVLPLLKEKGITTYAAHLKGRNDYDEECYTKGTAFLIGNEGNGLTEQLTESADTLIKIPM 242

Query: 257 PGIIKALNVSNAAAVALYITQNHFAK 282
            G +++LN + A+ + +Y       K
Sbjct: 243 QGKVESLNAAMASGILMYEAYRQRRK 268


>gi|167745715|ref|ZP_02417842.1| hypothetical protein ANACAC_00408 [Anaerostipes caccae DSM 14662]
 gi|167655027|gb|EDR99156.1| hypothetical protein ANACAC_00408 [Anaerostipes caccae DSM 14662]
          Length = 246

 Score =  134 bits (337), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 58/243 (23%), Positives = 105/243 (43%), Gaps = 12/243 (4%)

Query: 47  ENLFLYGVHTVSAALNNPS--RKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKI 104
           E   L G + V  AL       KI+ L   ++   R            +  V  + +D++
Sbjct: 4   EEYLLAGRNAVLEALRAGKPIDKIYILDGCQDGPVRTIVREAKKTDAVLNFVEKERLDQL 63

Query: 105 VGKEAVHQGLALETAPLLSPTLDA-------VRNSQLLMVLDHVNDPHNIGAILRSAVAF 157
             +   HQG+    A      ++         +     ++LD + DPHN+GAI+R+A   
Sbjct: 64  TKEH--HQGVVAMAAAYEYGQMEDLFARAEEKKEDPFFILLDGIEDPHNLGAIIRTANLA 121

Query: 158 SCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSK 217
              G+I  KR +   +  +AK+++GAL + P ++++NL+  ++++   G   +       
Sbjct: 122 GAHGVIIPKRRAVGLTPTVAKTSAGALNYTPVVKVTNLSKTMEELKERGLWFVCA-DMDG 180

Query: 218 KPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQ 277
             + ++     I L++G EG G+    +E     A + M G I +LN S AA V  Y   
Sbjct: 181 DMMYRQNLTGPIGLVIGNEGSGVSRLVKERCDYTASIPMNGDIDSLNASVAAGVLAYEIV 240

Query: 278 NHF 280
              
Sbjct: 241 RQR 243


>gi|320539669|ref|ZP_08039333.1| putative 23S rRNA (Gm2251)-methyltransferase [Serratia symbiotica
           str. Tucson]
 gi|320030281|gb|EFW12296.1| putative 23S rRNA (Gm2251)-methyltransferase [Serratia symbiotica
           str. Tucson]
          Length = 255

 Score =  134 bits (337), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 71/242 (29%), Positives = 113/242 (46%), Gaps = 10/242 (4%)

Query: 48  NLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLP---HPFPVKTVPPQTIDKI 104
           +  +YG+H V A L    ++  ++   K    R               V+    Q +D+ 
Sbjct: 2   SEIIYGIHAVKALLERDPQRFLEVFIPKGRGDRRLQPLITELETTGLAVQVASRQWLDEK 61

Query: 105 VGKEAVHQGLALETAPLLSPTLDAVR------NSQLLMVLDHVNDPHNIGAILRSAVAFS 158
           V + AVHQG+         P  + +       ++  L+VLD V DPHN+GA LRSA A  
Sbjct: 62  V-EGAVHQGIIARVREGRKPQENDLPALLESVDTPFLLVLDGVTDPHNLGACLRSADAAG 120

Query: 159 CDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKK 218
              +I  +  S   +A   K A GA E++P IR++NL   L+ +       +G S ++  
Sbjct: 121 VHAVIVPRDRSAQLNATAKKVACGASENVPLIRVTNLVRTLRLLQEMNVWVVGTSGEADH 180

Query: 219 PLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQN 278
            L Q      +AL++GAEGKG+R  T+E    +  + M G++ +LNVS A  + L+    
Sbjct: 181 TLYQSKMTGPMALVMGAEGKGMRRLTREHCDELISIPMAGMVSSLNVSVATGICLFEAVR 240

Query: 279 HF 280
             
Sbjct: 241 QR 242


>gi|183600321|ref|ZP_02961814.1| hypothetical protein PROSTU_03883 [Providencia stuartii ATCC 25827]
 gi|188020111|gb|EDU58151.1| hypothetical protein PROSTU_03883 [Providencia stuartii ATCC 25827]
          Length = 249

 Score =  134 bits (337), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 64/243 (26%), Positives = 105/243 (43%), Gaps = 8/243 (3%)

Query: 48  NLFLYGVHTVSAAL---NNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKI 104
           +  +YG+H V A L    +  ++++ L   ++                V+    Q +D  
Sbjct: 2   SEIIYGIHAVKALLDRDASRFKEVYILKGREDRRLMPIIHEIESLGIVVQVANRQWMDAQ 61

Query: 105 VGKEAVHQGLALETAPLLSPTLDAVRN-----SQLLMVLDHVNDPHNIGAILRSAVAFSC 159
                    +A           D         +  L+VLD V DPHN+GA LRSA A   
Sbjct: 62  TEGAVHQGIIAKVLPGKQYQEGDLPDFLESTDTPFLLVLDGVTDPHNLGACLRSADAAGV 121

Query: 160 DGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKP 219
             +I  K  S   +A   K A GA E +P  R++NL   L+ +  +    +G + ++   
Sbjct: 122 HAVIVPKDKSAQLNATAKKVACGAAESVPLFRVTNLARTLRLLKEYNVWIVGTAGEADHT 181

Query: 220 LEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNH 279
           L Q      +AL++GAEG+G+R  T+E    +  + M G + +LNVS A  + L+     
Sbjct: 182 LYQSKLTGPMALVMGAEGEGMRRLTREHCDELISIPMAGTVSSLNVSVATGICLFEAVRQ 241

Query: 280 FAK 282
            A+
Sbjct: 242 RAE 244


>gi|331083397|ref|ZP_08332509.1| RNA methyltransferase [Lachnospiraceae bacterium 6_1_63FAA]
 gi|330404090|gb|EGG83638.1| RNA methyltransferase [Lachnospiraceae bacterium 6_1_63FAA]
          Length = 269

 Score =  134 bits (337), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 51/264 (19%), Positives = 112/264 (42%), Gaps = 8/264 (3%)

Query: 26  NHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIF--QLLATKNALARLDW 83
           ++   KK+Q   +K++   + +   + G+   S    +  +K++  Q  A K    R+  
Sbjct: 6   SNVQIKKVQQILKKAKVRREEQVFAVEGIKMFSEVPKSRLQKVYLSQSFAEKEECGRILQ 65

Query: 84  D--ANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSP--TLDAVRNSQLLMVLD 139
           +   ++     V+ V  +    +       QG+             + +   + LLM+L+
Sbjct: 66  EKGISIEETAYVEIVDDKIFKNLSD-TVTPQGVLCLVKMENFTLSEILSGEENPLLMILE 124

Query: 140 HVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDAL 199
            + DP N+G ILR+       G+I ++      +  + +S  G++  +P I ++++ D +
Sbjct: 125 DLQDPGNLGTILRTGEGAGVTGVIMSRTSVDVFNPKVIRSTMGSVYRMPIIYVNSIEDEV 184

Query: 200 QKM-HSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPG 258
             +    G  T     + +   ++E      A ++G EG GL     E A ++  + M G
Sbjct: 185 LPLLKEKGITTYAAHLEGRNDYDKECYTKGTAFLIGNEGNGLSEHLTERADTLIKIPMQG 244

Query: 259 IIKALNVSNAAAVALYITQNHFAK 282
            +++LN + A+ + +Y       K
Sbjct: 245 KVESLNAAMASGILMYEAYRQRRK 268


>gi|227489408|ref|ZP_03919724.1| tRNA/rRNA methyltransferase [Corynebacterium glucuronolyticum ATCC
           51867]
 gi|227541002|ref|ZP_03971051.1| tRNA/rRNA methyltransferase [Corynebacterium glucuronolyticum ATCC
           51866]
 gi|227090586|gb|EEI25898.1| tRNA/rRNA methyltransferase [Corynebacterium glucuronolyticum ATCC
           51867]
 gi|227183262|gb|EEI64234.1| tRNA/rRNA methyltransferase [Corynebacterium glucuronolyticum ATCC
           51866]
          Length = 302

 Score =  134 bits (337), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 66/245 (26%), Positives = 122/245 (49%), Gaps = 5/245 (2%)

Query: 40  SRHTSQPENLFLYGVHTVSAALNN--PSRKIFQLLATKNALAR-LDWDANLPHPFPVKTV 96
             +     +  + G + V   L+   P+  +F  + TKN        +       P+  V
Sbjct: 47  RHYKPNMSDELVVGRNPVIECLHAKVPAVAMFVAIGTKNDQRLVEAVNIAASRSIPIVEV 106

Query: 97  PPQTIDKIVGKEAVHQGLALETAPLLSPTL-DAVRNSQLLMVLDHVNDPHNIGAILRSAV 155
             Q +D++ G   +HQG+ L+        L D + +  +++ LD++ DP N+GA++RS  
Sbjct: 107 SKQKLDEMTG-NGLHQGIGLQIPEYHYADLEDLITHDGMVVFLDNITDPRNLGAVIRSVA 165

Query: 156 AFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSD 215
           AF  DG++  +R S S +AV  +S++G    +P  +++N+T AL++    G+Q IGL + 
Sbjct: 166 AFGADGVVIPERRSASVTAVTWRSSAGTAARVPVAKVTNMTRALKQFQEAGYQAIGLDAG 225

Query: 216 SKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYI 275
            +   +       + +++G+EGKGL    +ET  ++  + M G +++LN S AA V L  
Sbjct: 226 GEHTHDSYDGTGPVVIVVGSEGKGLSRLVKETCDTIVTIPMEGWVESLNASVAAGVVLAE 285

Query: 276 TQNHF 280
                
Sbjct: 286 FARQR 290


>gi|305666461|ref|YP_003862748.1| putative rRNA methylase [Maribacter sp. HTCC2170]
 gi|88708728|gb|EAR00963.1| putative rRNA methylase [Maribacter sp. HTCC2170]
          Length = 268

 Score =  134 bits (337), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 48/259 (18%), Positives = 98/259 (37%), Gaps = 5/259 (1%)

Query: 26  NHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDA 85
            +   K       +SR   +     L G   ++ A+      I  +   K  ++  + D 
Sbjct: 11  QNPLIKNAVQLRDRSRERKKTGLFILEGKRELTLAIKANY-IIQTVFICKEIISDQEIDL 69

Query: 86  NLPH---PFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDHVN 142
            L +    F +  V      K+  +E+    LA+      S     +R + L++V +   
Sbjct: 70  VLSNIHDGFELIEVTKIVYHKMAYRESTEGILAIVKGKNHSLENIRLRKNALILVAEAPE 129

Query: 143 DPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKM 202
            P NIGA+LR+A A + D ++                +S        I + + +  +  +
Sbjct: 130 KPGNIGALLRTADAANLDAVLI-ANPKGDLYNPNIVRSSVGCVFTNQIGLGSTSQIIDFL 188

Query: 203 HSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKA 262
                     +  + +P  Q       A+++G E  GL  +    +T+   + M G I +
Sbjct: 189 KKKQINLFCAALSASQPYTQVNFEKAAAIVVGTESTGLSQEWLNASTNNIIIPMEGEIDS 248

Query: 263 LNVSNAAAVALYITQNHFA 281
           +NVS +AA+ ++  +   +
Sbjct: 249 MNVSVSAAILIFEAKRQRS 267


>gi|290473408|ref|YP_003466274.1| putative tRNA/rRNA methyltransferase [Xenorhabdus bovienii SS-2004]
 gi|289172707|emb|CBJ79478.1| putative tRNA/rRNA methyltransferase [Xenorhabdus bovienii SS-2004]
          Length = 245

 Score =  134 bits (337), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 66/242 (27%), Positives = 105/242 (43%), Gaps = 8/242 (3%)

Query: 48  NLFLYGVHTVSAALNNPSRKIFQLLATKNA-LARLDWDANLPH--PFPVKTVPPQTIDKI 104
           +  +YG+H V A L+   ++  ++   K     RL             V+    Q +D  
Sbjct: 2   SEIIYGIHAVKALLDREPQRFMEVYVLKGREDRRLTPLLRELEDIGITVQLANRQWLDTQ 61

Query: 105 VGKEAVHQGLALETAPLLSPTLDAVRN-----SQLLMVLDHVNDPHNIGAILRSAVAFSC 159
                    +A           D            L+VLD V DPHN+GA LR+A A   
Sbjct: 62  TESAVHQGIIAKVKPGRQYQESDLPDFLSQLDRPFLLVLDGVTDPHNLGACLRTADAAGV 121

Query: 160 DGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKP 219
           D +I  +  S   +A   K A GA E++P IR++NL   L+ +       +G + ++   
Sbjct: 122 DAVIIPRDRSAQLNATTKKVACGAAENVPLIRVTNLARTLRLLQESNIWIVGTAGEATHS 181

Query: 220 LEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNH 279
           L Q      +AL++GAEG+G+R  T+E    +  + M G + +LNVS A  V L+     
Sbjct: 182 LYQSKLTGPVALVMGAEGEGMRRLTREHCDELISIPMAGSVSSLNVSVATGVCLFEIMRQ 241

Query: 280 FA 281
            +
Sbjct: 242 RS 243


>gi|228476493|ref|ZP_04061183.1| rRNA methylase [Streptococcus salivarius SK126]
 gi|228251914|gb|EEK10960.1| rRNA methylase [Streptococcus salivarius SK126]
          Length = 245

 Score =  134 bits (337), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 58/274 (21%), Positives = 106/274 (38%), Gaps = 31/274 (11%)

Query: 1   MNLISKKKSEKIFSLKDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAA 60
           M +I  K++  I S +                      + +H        L G H    A
Sbjct: 1   MEIIQSKQNASIKSARKL-------------------LQRKHRKTS--YLLEGWHLFEEA 39

Query: 61  LNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAP 120
                  I Q+   +    R+       +   VK V P+ + ++   +   QG+  E A 
Sbjct: 40  -KASGADILQVFVLEEMANRV------ANMAKVKLVSPEVLKELCETQ-TPQGIVAEVAK 91

Query: 121 LLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSA 180
                 +++    LL+  + V DP N+G ++R+A A   DG+  + + +   +    +S 
Sbjct: 92  QSQALPESLSGKYLLL--EDVQDPGNVGTMIRTADAAGYDGVFLSDKSADIYNQKTLRSM 149

Query: 181 SGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGL 240
            G+  H+P  R   L                  SD     +    +   AL++G EG+G+
Sbjct: 150 QGSHFHLPIYRGPILDMVEACKKQGVPVLATTLSDISVDYKAVKTDGNFALVMGNEGQGI 209

Query: 241 RPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
                E+A  + H+ MPG  ++LNV+ AA + ++
Sbjct: 210 SQDMAESADQLVHISMPGQAESLNVAVAAGILMF 243


>gi|317129877|ref|YP_004096159.1| tRNA/rRNA methyltransferase (SpoU) [Bacillus cellulosilyticus DSM
           2522]
 gi|315474825|gb|ADU31428.1| tRNA/rRNA methyltransferase (SpoU) [Bacillus cellulosilyticus DSM
           2522]
          Length = 250

 Score =  134 bits (337), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 48/277 (17%), Positives = 95/277 (34%), Gaps = 28/277 (10%)

Query: 1   MNLISKKKSEKIFSLKDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAA 60
           M+ I    + ++ + K  H                     +   +     + GVH +  A
Sbjct: 1   MDPIESTSNPRVKTWKKLH-------------------SRKGREKTGLFLVEGVHLIEEA 41

Query: 61  LNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAP 120
           L         ++     + +           P   V  + + +I   E            
Sbjct: 42  LKAFIHMKELVI----DVDKEIPVEWKVSNVPQVFVTNKVMKEICETETPQG---FVAIC 94

Query: 121 LLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSA 180
            L    +        + LD + DP N+GAI+R+A A   +G++  +      +  + ++ 
Sbjct: 95  ELPDNKNVPLERGKFLFLDGLQDPGNVGAIIRTADAAGINGVVLGEGTVDPFNGKVIRAT 154

Query: 181 SGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGL 240
            G++ H+P  R+        ++       +  +S            D  ALI+G EG G+
Sbjct: 155 QGSIFHLPVQRMDL--KEAVQICKEKNIPVFGTSLQGSTYNAIQPQDNFALIVGNEGSGV 212

Query: 241 RPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQ 277
                E      ++ + G  ++LNVS A  + LY  +
Sbjct: 213 EDTLLEMTDQNLYIPIHGKAESLNVSIATGILLYHLR 249


>gi|170759752|ref|YP_001788451.1| RNA methyltransferase [Clostridium botulinum A3 str. Loch Maree]
 gi|169406741|gb|ACA55152.1| RNA methyltransferase, TrmH family [Clostridium botulinum A3 str.
           Loch Maree]
          Length = 259

 Score =  134 bits (337), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 55/262 (20%), Positives = 107/262 (40%), Gaps = 9/262 (3%)

Query: 24  RRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDW 83
            ++++  K+++   +K ++ +Q ++  + G      AL + S  + ++   + +L +L+ 
Sbjct: 4   SKDNQLIKEVRKLREK-KYRTQNKSFIVEGFRFFEEALKSNS-SVNKVFIEEKSLNKLEE 61

Query: 84  ---DANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDH 140
                N+ +      V    +  I G     QG+           LD      +L+  D 
Sbjct: 62  LYKKYNINNDIETYVVNYSVLKSI-GNTENPQGIVSVINYFKREKLDLQNGFYILV--DK 118

Query: 141 VNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQ 200
           V DP N+G I+R+A A    G+ITTK      +    +S  G++ +IP I   NL     
Sbjct: 119 VQDPGNMGTIIRTAHAAGALGVITTKGTVDIYNEKTLRSTMGSIFYIPIIEDENLEVVKL 178

Query: 201 KMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGII 260
                    +     +    +  +K D I + +G EG G+       +     + MPG  
Sbjct: 179 LQKKGFKLLVSSLDTNSNFYDVNMK-DNIIIAVGNEGNGISEVLNTLSDIKVKIPMPGAA 237

Query: 261 KALNVSNAAAVALYITQNHFAK 282
           ++LNV+ A ++  +       K
Sbjct: 238 ESLNVAVACSIMTFERIRQINK 259


>gi|307543249|gb|ADN44264.1| TrmH family RNA methyltransferase [Pseudomonas syringae]
          Length = 255

 Score =  134 bits (337), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 71/239 (29%), Positives = 116/239 (48%), Gaps = 8/239 (3%)

Query: 51  LYGVHTVSAALNNPSRKIFQLLATKNA-LARLDWDANLPHPFPVKTVPPQTIDKIVGKEA 109
           +YG+H V A L +  +++ Q+   ++    R+     L     +     +  +  V  E 
Sbjct: 7   IYGIHAVEALLRHHPKRVKQVWLAESRNDPRVQTLIALAAENRIDVGNAERREMDVWVEG 66

Query: 110 VHQGLALETAPLLSP-------TLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGI 162
           VHQG+  + +P            LD    + L++VLD V DPHN+GA LR+A A     +
Sbjct: 67  VHQGVVADVSPSQVWGEAMLNELLDRTEGAPLILVLDGVTDPHNLGACLRTADAAGALAV 126

Query: 163 ITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQ 222
           I  K  S + +  + K A GA E IP + ++NL   L+K+   G   +G + ++++ L  
Sbjct: 127 IVPKDKSATLTPTVQKVACGAAEVIPLVAVTNLAATLKKLQQRGLWIVGTAGEAEQELYD 186

Query: 223 EIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHFA 281
           +       LI+GAEGKG+R  T+E    +  L M G + +LNVS A  V L+      +
Sbjct: 187 QDMTGPTILIMGAEGKGMRRLTREHCDYLVRLPMAGSVSSLNVSVATGVCLFEALRQRS 245


>gi|295133533|ref|YP_003584209.1| rRNA methylase [Zunongwangia profunda SM-A87]
 gi|294981548|gb|ADF52013.1| putative rRNA methylase [Zunongwangia profunda SM-A87]
          Length = 268

 Score =  134 bits (337), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 42/260 (16%), Positives = 99/260 (38%), Gaps = 6/260 (2%)

Query: 26  NHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDA 85
            ++  K +     KSR+  +     + G+     AL     K+ ++       +  ++ +
Sbjct: 9   QNKRIKHLLQLQDKSRNRRKESQFVVEGLRETGLALQ-GGFKLLEVYFCPEFFSENEFKS 67

Query: 86  N---LPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLS-PTLDAVRNSQLLMVLDHV 141
                     +  +  +   K+  + +    + +  +   +   L+   N+ L++V +  
Sbjct: 68  IPDFEHADAEIIEISSEVYQKLAYRTSTEGVITVFASKENALQKLNFSHNNPLILVAEAP 127

Query: 142 NDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQK 201
             P NIGA+LR+A A + D ++                +S        I I   ++ ++ 
Sbjct: 128 EKPGNIGALLRTADAANVDAVLI-ANPKTDLYNPNIIRSSVGCVFTNKIAIGTTSEIIKF 186

Query: 202 MHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIK 261
           +          +  + +   +       A+++G E  GL  + +E AT    + M G I 
Sbjct: 187 LQHKNIAIYAAALQASEIYTKIDFTKASAIVVGTEATGLNQEWREAATQNIIIPMNGAID 246

Query: 262 ALNVSNAAAVALYITQNHFA 281
           ++NVS AA + ++  +   +
Sbjct: 247 SMNVSVAAGILIFEAKRQRS 266


>gi|322436781|ref|YP_004218993.1| RNA methyltransferase, TrmH family, group 3 [Acidobacterium sp.
           MP5ACTX9]
 gi|321164508|gb|ADW70213.1| RNA methyltransferase, TrmH family, group 3 [Acidobacterium sp.
           MP5ACTX9]
          Length = 263

 Score =  134 bits (336), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 68/247 (27%), Positives = 114/247 (46%), Gaps = 13/247 (5%)

Query: 48  NLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDW------DANLPHPFPVKTVPPQTI 101
              LYG+H V  A+ +  R++  +L +++   + D       +        V   P   +
Sbjct: 1   MEVLYGLHPVEEAIRSGGRRLEYVLISRDRRDKGDDRLTKLVELCKLAGVRVSIEPKDQL 60

Query: 102 DKIVGKEAVHQGLALETAPLLSPTLDA------VRNSQLLMVLDHVNDPHNIGAILRSAV 155
            ++ G +A HQG            ++         + +  + LD V DPHN+GA+LRSA 
Sbjct: 61  TRVAGTDA-HQGAVAAVRERQFLAIEDLLAAKGNFDKRFFLALDGVEDPHNLGALLRSAD 119

Query: 156 AFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSD 215
               DG++   R S   S V+AK+++GA EH+   R++NL  +L++M       +GL   
Sbjct: 120 GAGVDGVVLPDRRSAPLSGVVAKTSAGASEHVKIARVTNLVRSLEQMKRANIWVLGLDER 179

Query: 216 SKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYI 275
                     N    L+LG+EG GL   T++T   +  + M G + +LNVS A AV +Y 
Sbjct: 180 GTPDYTAFDFNSDCVLVLGSEGTGLHDLTKKTCDHLLRIPMAGSVSSLNVSVAGAVVMYE 239

Query: 276 TQNHFAK 282
                ++
Sbjct: 240 ALRQRSQ 246


>gi|238750079|ref|ZP_04611582.1| 23S rRNA (guanosine-2'-O-)-methyltransferase rlmB [Yersinia rohdei
           ATCC 43380]
 gi|238711623|gb|EEQ03838.1| 23S rRNA (guanosine-2'-O-)-methyltransferase rlmB [Yersinia rohdei
           ATCC 43380]
          Length = 246

 Score =  134 bits (336), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 68/242 (28%), Positives = 109/242 (45%), Gaps = 8/242 (3%)

Query: 48  NLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANL---PHPFPVKTVPPQTIDKI 104
           +  +YG+H+V A L+N  ++  ++   K    R               V+    Q +D  
Sbjct: 2   SEIIYGIHSVKALLDNDPQRFLEVFILKGRDDRRLQPLIAELEAAGLVVQVASRQWLDSQ 61

Query: 105 VGKEAVHQGLALETAPLLSPTLDAVR-----NSQLLMVLDHVNDPHNIGAILRSAVAFSC 159
           V        +A           D         +  L+VLD V DPHN+GA LRSA A   
Sbjct: 62  VEGGVHQGIVARVREGRQYQENDLPALLASVETPFLLVLDGVTDPHNLGACLRSADAAGV 121

Query: 160 DGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKP 219
             +I  +  S   +A+  K ASGA E++P I+++NL   L+ +       +G + ++   
Sbjct: 122 HAVIVPRDRSAQLNAIAKKVASGAAENVPLIKVTNLARTLRVLQENNVWIVGTAGEADHT 181

Query: 220 LEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNH 279
           L Q      +AL++GAEG+G+R  T+E    +  + M G + +LNVS A  V L+     
Sbjct: 182 LYQSKMTGPMALVMGAEGEGMRRLTREHCDELISIPMAGSVSSLNVSVATGVCLFEAVRQ 241

Query: 280 FA 281
            A
Sbjct: 242 RA 243


>gi|253991546|ref|YP_003042902.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Photorhabdus
           asymbiotica subsp. asymbiotica ATCC 43949]
 gi|211638424|emb|CAR67046.1| 23s rrna (guanosine-2'-o-)-methyltransferase rlmb (ec 2.1.1.-) (23
           rrna gm2251 2'-o-methyltransferase) [Photorhabdus
           asymbiotica subsp. asymbiotica ATCC 43949]
 gi|253782996|emb|CAQ86161.1| 23S rRNA (guanosine-2'-o-)-methyltransferase [Photorhabdus
           asymbiotica]
          Length = 245

 Score =  134 bits (336), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 66/242 (27%), Positives = 106/242 (43%), Gaps = 8/242 (3%)

Query: 48  NLFLYGVHTVSAALNNPSRKIFQLLATKNA-LARLDWDANLPH--PFPVKTVPPQTIDKI 104
           +  +YG+H V A L+   ++  ++   K     RL+   +        V+    Q +D  
Sbjct: 2   SEIIYGIHAVKALLDRDPQRFMEVYVLKGREDRRLNPLIHELENIGVTVQLANRQWLDNQ 61

Query: 105 VGKEAVHQGLALETAPLLSPTLDAVR-----NSQLLMVLDHVNDPHNIGAILRSAVAFSC 159
                    +A           D         +  L+VLD V DPHN+GA LRSA A   
Sbjct: 62  TEGAVHQGVIAKVKPGRQYQENDLPDLLAKVETPFLLVLDGVTDPHNLGACLRSADAAGV 121

Query: 160 DGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKP 219
             +I  +  S   +A   K A GA E +P +R++NL   L+ +       +G + ++   
Sbjct: 122 HVVIVPRDRSAQLNATAKKVACGAAESVPLVRVTNLARTLRVLQEHNIWVVGTAGEADHT 181

Query: 220 LEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNH 279
           L Q      IAL++GAEG+G+R  T+E    +  + M G + +LNVS A  V L+     
Sbjct: 182 LYQSKLTGPIALVMGAEGEGMRRLTREHCDELISIPMTGSVSSLNVSVATGVCLFEAVRQ 241

Query: 280 FA 281
            +
Sbjct: 242 RS 243


>gi|160941168|ref|ZP_02088505.1| hypothetical protein CLOBOL_06061 [Clostridium bolteae ATCC
           BAA-613]
 gi|158435729|gb|EDP13496.1| hypothetical protein CLOBOL_06061 [Clostridium bolteae ATCC
           BAA-613]
          Length = 270

 Score =  134 bits (336), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 50/260 (19%), Positives = 104/260 (40%), Gaps = 10/260 (3%)

Query: 26  NHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDA 85
           +++  K++ S   K++   +     + G+             +  L  T+N       + 
Sbjct: 6   SNKQVKRVVSLRSKAKARREEGMYVVEGLRMCREL---NPEDVDALYVTENFAGD-ADNR 61

Query: 86  NLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQL-----LMVLDH 140
                F  +TV    ++ +   +   QG+            D V+ +       +MVL+ 
Sbjct: 62  KWMGRFRPETVSDVVMNVMADTQ-TPQGVLAVVRQKRYTMDDIVKPAPDGRSLAIMVLET 120

Query: 141 VNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQ 200
           + DP N+G I+R+       GI+     +   +  + +S  G++  +P++   +L DA  
Sbjct: 121 IQDPGNLGTIIRAGEGAGITGIVMNHDTADIYNPKVIRSTMGSIFRMPFVYADDLQDACL 180

Query: 201 KMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGII 260
            M + G +            +QE   D +  ++G E  GL  +T   A  +  + M G +
Sbjct: 181 LMKNRGVRLFAAHLKGMNNYDQEDYTDNVGFLIGNEANGLTEETTSLADCLVKIPMEGKV 240

Query: 261 KALNVSNAAAVALYITQNHF 280
           ++LN + AA+V ++ T    
Sbjct: 241 ESLNAAIAASVLMFETARQR 260


>gi|315640328|ref|ZP_07895445.1| 23S rRNA (guanosine-2'-O-)-methyltransferase RlmB [Enterococcus
           italicus DSM 15952]
 gi|315483990|gb|EFU74469.1| 23S rRNA (guanosine-2'-O-)-methyltransferase RlmB [Enterococcus
           italicus DSM 15952]
          Length = 278

 Score =  134 bits (336), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 79/271 (29%), Positives = 131/271 (48%), Gaps = 10/271 (3%)

Query: 19  HYAKLRRNHRDYKKMQSFNQKSRHTSQPENL---FLYGVHTVSAALNNPS-RKIFQLLAT 74
           +Y K  RN  + K  +    +       E L   F++G H V  AL      K+F L   
Sbjct: 4   NYKKESRNVGNKKDTRKQTVRKDKEMTAEELAENFVFGHHAVVEALKKGRGNKLFLLEDA 63

Query: 75  KNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLD----AVR 130
           +        + +     PVK VP Q +++   ++ VHQG+ L   P    +LD       
Sbjct: 64  RGERIDEVKELSKEQSVPVKWVPKQKLEQYS-QQGVHQGMVLAITPYEYLSLDELLAKSP 122

Query: 131 NSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYI 190
                ++LD++ DPHN G+ILR+A A   DGII  K  +   + V+ K+++GA+EH+P  
Sbjct: 123 EKPFFIILDNLEDPHNFGSILRTADASGVDGIIIPKHRAVGITPVVVKTSTGAVEHVPIA 182

Query: 191 RISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATS 250
           R++NL+ A+Q +   GF T G + +             IALI+G EG+G+    +++   
Sbjct: 183 RVTNLSQAVQTLKERGFWTFGTAMEGTNYRSWNT-QGAIALIIGNEGRGMSEGLKKSVDE 241

Query: 251 MAHLHMPGIIKALNVSNAAAVALYITQNHFA 281
           +  + M G +++LN S AA + +Y      +
Sbjct: 242 LLTIPMVGHVQSLNASVAAGLLMYEAFMQRS 272


>gi|313902851|ref|ZP_07836248.1| RNA methyltransferase, TrmH family, group 3 [Thermaerobacter
           subterraneus DSM 13965]
 gi|313466971|gb|EFR62488.1| RNA methyltransferase, TrmH family, group 3 [Thermaerobacter
           subterraneus DSM 13965]
          Length = 306

 Score =  134 bits (336), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 57/238 (23%), Positives = 94/238 (39%), Gaps = 8/238 (3%)

Query: 51  LYGVHTVSAALNNPS--RKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKE 108
           + G   V   L +    R ++     + A              PV  + P  + + V  E
Sbjct: 44  VEGRQPVLELLRSGHPVRHVWVAAGRRGAALAELEALARRRGVPVTEIDPAELQRRVQTE 103

Query: 109 AVHQGLALETAPLLSPTLD------AVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGI 162
                +AL         LD        R   LL++   + DPHN+GA+ RSA A    G 
Sbjct: 104 GHQGVIALAAPLPQPDPLDLLEVASRRREPPLLVICAGIQDPHNLGAVFRSAEAAGAHGA 163

Query: 163 ITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQ 222
           +     S        KS++GAL H+   +++NL   +++    G   +    +  +P +Q
Sbjct: 164 VVPVHRSAPLGPTAFKSSAGALVHLAVAQVANLNQVVRRFKEQGVWVVAADPEGAQPYDQ 223

Query: 223 EIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
                  AL+LG+EG+G+ P           + M G + +LNVS AA + L+      
Sbjct: 224 WDWTRPTALVLGSEGRGIPPLLLRQCDGRVFIPMAGKVASLNVSVAAGILLFEAARQR 281


>gi|53803949|ref|YP_114407.1| RNA methyltransferase [Methylococcus capsulatus str. Bath]
 gi|53757710|gb|AAU92001.1| RNA methyltransferase, TrmH family, group 3 [Methylococcus
           capsulatus str. Bath]
          Length = 250

 Score =  134 bits (336), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 65/241 (26%), Positives = 110/241 (45%), Gaps = 9/241 (3%)

Query: 51  LYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANL---PHPFPVKTVPPQTIDKIVGK 107
           ++G+H   AAL+    KI +     + +                 +     + +D++   
Sbjct: 7   VWGIHAAEAALDYSPDKIVKAWLDDHRMQNRLQAVATRLDELGVEIVRADRKRLDRLADP 66

Query: 108 EAVHQGLALETAPLLS------PTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDG 161
                 L     P          TLDA     L +VLDHV DPHN+GA LR+  A    G
Sbjct: 67  RKHQGILLELDLPGEQGEAELLDTLDAADGHPLYLVLDHVQDPHNLGACLRTCDAAGVKG 126

Query: 162 IITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLE 221
           ++ TK  S   +  +AK ASGA E +P  R++NL   L +    G+  +G + ++++ L 
Sbjct: 127 LVVTKDQSVGLTPTVAKVASGAAETVPVYRVTNLARCLDRFKQRGYWVVGAAGEAERTLY 186

Query: 222 QEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHFA 281
           +      + +++GAEG GLR  T+E    +  + M G +++LN+S A  + LY      +
Sbjct: 187 ELDLRLPLVVVMGAEGVGLRRLTRERCDFLLRIPMVGGVESLNLSVATGIVLYEVMRQRS 246

Query: 282 K 282
           +
Sbjct: 247 R 247


>gi|313624066|gb|EFR94149.1| rRNA methyltransferase [Listeria innocua FSL J1-023]
          Length = 252

 Score =  134 bits (336), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 54/278 (19%), Positives = 106/278 (38%), Gaps = 26/278 (9%)

Query: 1   MNLISKKKSEKIFSLKDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAA 60
           M  I   K++++ + K                        +   +     + G H V  A
Sbjct: 1   MEQIQSVKNDRVKTWKKLQT-------------------RKGRDKTGTYLVEGFHLVEEA 41

Query: 61  LNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAP 120
           L      + +LL +       +W   L   + V  +    I  ++      QG+    A 
Sbjct: 42  LRQDG-LVLELLVSSGVSVPEEW---LKGDYDVFEIS-SEISHLISDTMTEQGVFAVVAI 96

Query: 121 LLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSA 180
                   +   + L+++D V DP N+G ++R+A A   D ++  +  +   +  + +S 
Sbjct: 97  SE--PDMMLLYGKKLLLVDAVQDPGNVGTLIRTADAAGYDCVVLGRGSADLYNPKVIRST 154

Query: 181 SGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGL 240
            G+  HIP I+                    +  D  K L    K + +AL++G EG G+
Sbjct: 155 QGSHFHIPVIQADLFEWVGNLEEEGVPVIGAVLDDQAKSLNDMPKRETLALMVGNEGNGI 214

Query: 241 RPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQN 278
             + Q+  +   ++ + G  ++LNV+ AA + LY  + 
Sbjct: 215 SEELQDRLSEKVYIPIYGDSESLNVAVAAGILLYGLRK 252


>gi|16800250|ref|NP_470518.1| hypothetical protein lin1181 [Listeria innocua Clip11262]
 gi|16413640|emb|CAC96412.1| lin1181 [Listeria innocua Clip11262]
 gi|313619318|gb|EFR91052.1| rRNA methyltransferase [Listeria innocua FSL S4-378]
          Length = 252

 Score =  134 bits (336), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 54/278 (19%), Positives = 106/278 (38%), Gaps = 26/278 (9%)

Query: 1   MNLISKKKSEKIFSLKDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAA 60
           M  I   K++++ + K                        +   +     + G H V  A
Sbjct: 1   MEQIQSVKNDRVKTWKKLQT-------------------RKGRDKTGTYLVEGFHLVEEA 41

Query: 61  LNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAP 120
           L      + +LL +       +W   L   + V  +    I  ++      QG+    A 
Sbjct: 42  LRQDG-LVLELLISSGVSVPEEW---LKGDYDVFEIS-SEISHLISDTMTEQGVFAVVAI 96

Query: 121 LLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSA 180
                   +   + L+++D V DP N+G ++R+A A   D ++  +  +   +  + +S 
Sbjct: 97  SE--PDMMLLYGKKLLLVDAVQDPGNVGTLIRTADAAGYDCVVLGRGSADLYNPKVIRST 154

Query: 181 SGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGL 240
            G+  HIP I+                    +  D  K L    K + +AL++G EG G+
Sbjct: 155 QGSHFHIPVIQADLFEWVANLEEEGVPVIGAVLDDQAKSLNDMPKRETLALMVGNEGNGI 214

Query: 241 RPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQN 278
             + Q+  +   ++ + G  ++LNV+ AA + LY  + 
Sbjct: 215 SEELQDRLSEKVYIPIYGDSESLNVAVAAGILLYGLRK 252


>gi|306829232|ref|ZP_07462422.1| RNA methyltransferase [Streptococcus mitis ATCC 6249]
 gi|304428318|gb|EFM31408.1| RNA methyltransferase [Streptococcus mitis ATCC 6249]
          Length = 242

 Score =  134 bits (336), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 74/240 (30%), Positives = 121/240 (50%), Gaps = 9/240 (3%)

Query: 48  NLFLYGVHTVSAAL-NNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVG 106
           N  +YGVH V+ AL  N   K++     +        +        +     +++ ++  
Sbjct: 4   NDIVYGVHAVTEALLANTGNKLYLQEDIRGKNVEKVKELAAEKKVSISWTSKKSLSEMT- 62

Query: 107 KEAVHQGLALETAPLLSPTLDA------VRNSQLLMVLDHVNDPHNIGAILRSAVAFSCD 160
           + AVHQG  L  +      LD          + LL++LD + DPHN+G+ILR+A A +  
Sbjct: 63  EGAVHQGFVLRVSEFAYSELDHILAKTRQEENPLLLILDGLTDPHNLGSILRTADATNVS 122

Query: 161 GIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPL 220
           G+I  K  +   + V+AK+A+GA+EH+P  R++NL+  L K+   GF T G   +     
Sbjct: 123 GVIIPKHRAVGVTPVVAKTATGAIEHVPIARVTNLSQTLDKLKDEGFWTFGTDMNGTPCH 182

Query: 221 EQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
           +   K  KIALI+G EGKG+    ++    M  + M G +++LN S AAA+ +Y    + 
Sbjct: 183 KWNTK-GKIALIIGNEGKGISSNIKKQVDEMITIPMNGHVQSLNASVAAAILMYEVFRNR 241


>gi|108804991|ref|YP_644928.1| RNA methyltransferase TrmH, group 3 [Rubrobacter xylanophilus DSM
           9941]
 gi|108766234|gb|ABG05116.1| RNA methyltransferase TrmH, group 3 [Rubrobacter xylanophilus DSM
           9941]
          Length = 237

 Score =  134 bits (336), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 65/234 (27%), Positives = 112/234 (47%), Gaps = 6/234 (2%)

Query: 49  LFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKE 108
             +YGV  V   L +  R + ++L   +   R            V+ VP   + ++ G  
Sbjct: 3   EVVYGVRPVIEVLRSRRRAVHEVL--DSTGNREVERLAADAGVGVRRVPRGRVARLAG-G 59

Query: 109 AVHQGLALETAPLLSPTLDAV--RNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTK 166
             HQG+A    P     L+ V    + L+ VLD V DP N+GA+LR+A   +  G++  K
Sbjct: 60  GAHQGVAARVGPYPYAALEDVLGGENPLVAVLDGVTDPRNLGAVLRAADGAAASGVVVPK 119

Query: 167 RYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKN 226
             +   +    K+++GA EH+   R++NL  A+ +M   G   +  +    +   +   +
Sbjct: 120 DRAAGVTPAAVKASAGASEHVRLARVTNLRRAVDRMKEEGLW-VYAAEPGGENYAEADLS 178

Query: 227 DKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
             +AL+LG+EG+G+R   +E    +  + M G + +LNVS AAA+ LY  +   
Sbjct: 179 GPVALVLGSEGRGVRRLVREGCDGVLSIPMLGAVSSLNVSVAAAILLYEARRQR 232


>gi|328543340|ref|YP_004303449.1| RNA methyltransferase, TrmH family, group 3 [polymorphum gilvum
           SL003B-26A1]
 gi|326413085|gb|ADZ70148.1| RNA methyltransferase, TrmH family, group 3 [Polymorphum gilvum
           SL003B-26A1]
          Length = 265

 Score =  134 bits (336), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 106/253 (41%), Positives = 154/253 (60%), Gaps = 2/253 (0%)

Query: 28  RDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANL 87
           R          +         + LYG+HTV AA  NP R+  +L AT+NAL RL+     
Sbjct: 12  RRAGGFVKPAPRRPGLPPEGPILLYGLHTVEAAFQNPDRRRHKLFATENALRRLEERGIR 71

Query: 88  PHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDHVNDPHNI 147
           P   PV+ + P+ +D++V ++AVHQG+ LE   L +  +D ++ ++L++ LD V DPHN+
Sbjct: 72  P-DVPVEILAPRALDRMVTRDAVHQGVVLEADALPAYGVDELKGARLVLALDQVTDPHNV 130

Query: 148 GAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGF 207
           GAILRSAVA + D ++TT+R++P E  VLAK+ASGAL+ I ++R+ N+   L +M   GF
Sbjct: 131 GAILRSAVALAADAVVTTERHAPEEGPVLAKAASGALDMIRHVRVKNMARFLVEMGEQGF 190

Query: 208 QTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSN 267
             + L SD +  LEQ    DK  L+LG+EGKG+R   +     +A L MPG I++LNVSN
Sbjct: 191 FRVALDSDGEASLEQTPFGDKTVLVLGSEGKGVRQGVRAACDRLARLDMPGRIRSLNVSN 250

Query: 268 AAAVALYITQNHF 280
           AA +ALY      
Sbjct: 251 AAVLALY-VARQR 262


>gi|323142974|ref|ZP_08077682.1| RNA methyltransferase, TrmH family, group 3 [Succinatimonas hippei
           YIT 12066]
 gi|322417247|gb|EFY07873.1| RNA methyltransferase, TrmH family, group 3 [Succinatimonas hippei
           YIT 12066]
          Length = 254

 Score =  134 bits (336), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 64/250 (25%), Positives = 105/250 (42%), Gaps = 9/250 (3%)

Query: 41  RHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLP----HPFPVKTV 96
           R   +     +YGV+ V AAL     KI      K           +     +   V+T 
Sbjct: 3   RRNGKQNRELVYGVNAVEAALETAPEKIVSAFIIKGREDDKRISRIMALMNNYGIKVQTA 62

Query: 97  PPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVR-----NSQLLMVLDHVNDPHNIGAIL 151
              T+D+I         +    A       D         +   +VLD V DP N+GA +
Sbjct: 63  MRHTLDEITDNGVHQGVVIEMVATPPKNEGDLEELLDTLENPFFLVLDGVTDPRNLGAAM 122

Query: 152 RSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIG 211
           RSA A    G+I  K  S S S    K+ASGA + +P   ++NL   L+ +     + IG
Sbjct: 123 RSAWAAGAHGVIVPKDKSASFSPAARKAASGAADVLPLFAVTNLARTLEMLKERFVRVIG 182

Query: 212 LSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAV 271
           +  ++   +        +A+++G+E  G+R  T+E    +  + M   +++LNVS AA +
Sbjct: 183 MDGEASDNIYATDLTGPLAIVMGSEESGMRRLTREKCDDITKIPMAEGVESLNVSVAAGI 242

Query: 272 ALYITQNHFA 281
           AL+      +
Sbjct: 243 ALFEAVRQRS 252


>gi|67925525|ref|ZP_00518860.1| tRNA/rRNA methyltransferase (SpoU) [Crocosphaera watsonii WH 8501]
 gi|67852637|gb|EAM48061.1| tRNA/rRNA methyltransferase (SpoU) [Crocosphaera watsonii WH 8501]
          Length = 261

 Score =  134 bits (336), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 48/255 (18%), Positives = 103/255 (40%), Gaps = 4/255 (1%)

Query: 26  NHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDA 85
            +   K+++  + +++   +   L L G H V  A       +      +          
Sbjct: 6   RNPLIKQIRKLH-RTKGRREEGLLLLEGTHLVETAYEANCSLMTLCYTEQWRTRYPQLWE 64

Query: 86  NLPHPF-PVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDHVNDP 144
           N+      ++ V  + +  +     ++    + TA     T   + + +L +V++ + DP
Sbjct: 65  NVSKKVQRLELVSLEVLTAMT--TTINPDGVVATALFEPFTEGEITDFRLGLVIERLQDP 122

Query: 145 HNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHS 204
            N+G I+R+A A   DGI  +      +   + ++++GA   +P    S+L   ++K  +
Sbjct: 123 GNLGTIIRTAAATGIDGIWLSDDSVDVDHPKVLRASAGAWFQVPIFISSDLKRIVEKYKN 182

Query: 205 WGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALN 264
            GF  +    ++ +            ++LG EG GL       A  +  + +   I++LN
Sbjct: 183 NGFNIVATLPNTTQTYWHLQLTKPTLILLGNEGSGLSDSLVSLANEIVSIPLSEGIESLN 242

Query: 265 VSNAAAVALYITQNH 279
           V+ A A+ LY     
Sbjct: 243 VAIATALILYEAXRQ 257


>gi|331002509|ref|ZP_08326027.1| hypothetical protein HMPREF0491_00889 [Lachnospiraceae oral taxon
           107 str. F0167]
 gi|330410325|gb|EGG89759.1| hypothetical protein HMPREF0491_00889 [Lachnospiraceae oral taxon
           107 str. F0167]
          Length = 261

 Score =  134 bits (336), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 43/263 (16%), Positives = 97/263 (36%), Gaps = 9/263 (3%)

Query: 24  RRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDW 83
              ++  K++ +  +KS    +     + G+           +K   L    +       
Sbjct: 4   SSGNKKIKELMALIKKSSARKKQNAYIIEGIRMFREL-----KKDEILDVFVSESFDALN 58

Query: 84  DANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLD----AVRNSQLLMVLD 139
              +   +P   V    I + V      QG+ +          +           L++LD
Sbjct: 59  KKLISEIYPGYEVVSDKIFESVSDTKTPQGVMVVVKRKEYTLENILTVRGEFPHNLLILD 118

Query: 140 HVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDAL 199
            + DP N+G ++R+       GII  +      +  + +S  G++  +P+I + +L D +
Sbjct: 119 SLQDPGNLGTLVRAGEGAGITGIIMNESTVDIYNPKVIRSTMGSVFRVPFIYVKDLKDII 178

Query: 200 QKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGI 259
           +++++        S +     +       IA I+G E  G+     +   +   + M G 
Sbjct: 179 EELYARKIDIYASSLEGATEYDAPDYRGSIAFIIGNEAAGISKDVLDAVKNKVKIPMLGE 238

Query: 260 IKALNVSNAAAVALYITQNHFAK 282
           +++LN + A ++ +Y       K
Sbjct: 239 VESLNAAVAGSILMYEAARQRRK 261


>gi|322376908|ref|ZP_08051401.1| RNA methyltransferase, TrmH family, group 3 [Streptococcus sp.
           M334]
 gi|321282715|gb|EFX59722.1| RNA methyltransferase, TrmH family, group 3 [Streptococcus sp.
           M334]
          Length = 253

 Score =  134 bits (336), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 73/240 (30%), Positives = 120/240 (50%), Gaps = 9/240 (3%)

Query: 48  NLFLYGVHTVSAALNNP-SRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVG 106
           N  +YGVH V+ AL      K++     +        +        +     +++ +I  
Sbjct: 15  NDIVYGVHAVTEALRANTGNKLYLQEDLRGKNLEKVKELATEKKVSISWTSKKSLSEIT- 73

Query: 107 KEAVHQGLALETAPLLSPTLDA------VRNSQLLMVLDHVNDPHNIGAILRSAVAFSCD 160
           + AVHQG  L  +      LD          + LL++LD + DPHN+G+ILR+A A +  
Sbjct: 74  EGAVHQGFVLRVSEFAYSELDHILAKTHQEENPLLLILDGLTDPHNLGSILRTADATNVS 133

Query: 161 GIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPL 220
           G+I  K  +   + V++K+A+GA+EH+P  R++NL+  L K+   GF T G   +     
Sbjct: 134 GVIIPKHRAVGVTPVVSKTATGAIEHVPIARVTNLSQTLDKLKDEGFWTFGTDMNGTPCH 193

Query: 221 EQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
           +   K  KIALI+G EGKG+    ++    M  + M G +++LN S AAA+ +Y    + 
Sbjct: 194 KWNTK-GKIALIIGNEGKGISSNIKKQVDEMITIPMNGHVQSLNASVAAAILMYEVFRNR 252


>gi|312792760|ref|YP_004025683.1| RNA methyltransferase, TrmH family, group 3 [Caldicellulosiruptor
           kristjanssonii 177R1B]
 gi|312179900|gb|ADQ40070.1| RNA methyltransferase, TrmH family, group 3 [Caldicellulosiruptor
           kristjanssonii 177R1B]
          Length = 253

 Score =  134 bits (336), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 55/242 (22%), Positives = 103/242 (42%), Gaps = 12/242 (4%)

Query: 51  LYGVHTVSAALNNPSRKIFQLLATKNALARL---DWDANLPHPFPVKTVPPQTIDKIVGK 107
           + G + V  AL + + KI ++  + +A  R      +        VK V    IDK+  +
Sbjct: 4   IEGKNPVKEALRSGA-KITEVYISNSAKDRETAQIINLCKQSGIVVKFVDKSKIDKMA-Q 61

Query: 108 EAVHQGLALETAPLLSPTLD-------AVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCD 160
               QG+           +D           +  L++LD + DP N G+I+RSA      
Sbjct: 62  TKNPQGVIAIAREFEYCDIDDILAEARQRGETPFLVLLDGITDPQNFGSIIRSAHLCGAH 121

Query: 161 GIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPL 220
           GI+   R S   +  + K+++GA+E++   R+ NL   ++++   G       +   KP+
Sbjct: 122 GIVIEARNSCPVTPAVEKASAGAVEYMKIARVVNLRRTIEELKEKGIWVFATDASGPKPV 181

Query: 221 EQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
            +        +++G+EGKG+    +E A  +  +   G + + N S AA +  +      
Sbjct: 182 YECDFTIPTCIVIGSEGKGISRLVKEGADFLIKIPQKGYVNSFNASVAAGIIFFEVLKQR 241

Query: 281 AK 282
            K
Sbjct: 242 LK 243


>gi|303232156|ref|ZP_07318859.1| RNA methyltransferase, TrmH family [Veillonella atypica
           ACS-049-V-Sch6]
 gi|302513262|gb|EFL55301.1| RNA methyltransferase, TrmH family [Veillonella atypica
           ACS-049-V-Sch6]
          Length = 264

 Score =  134 bits (336), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 58/273 (21%), Positives = 108/273 (39%), Gaps = 10/273 (3%)

Query: 8   KSEKIFSLKDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRK 67
           +S KI  ++        ++++  K + S  Q+ ++  +     + G+  V+         
Sbjct: 2   ESPKIDYIQ-------SKDNKTIKHIISLQQR-KYRQKFGEYTVEGIRAVTDIGK--KDC 51

Query: 68  IFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLD 127
           +  +L  ++  + L+             V   +I   +      QG+       ++    
Sbjct: 52  LRSILIRESKRSELEPLVQKGFTVSSVYVVQDSIFDKIEHSVNGQGILGIAKKCVNDLHS 111

Query: 128 AVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHI 187
            +    L + LD V DP N+G I+R+AVA    GI   K      +    +S   AL +I
Sbjct: 112 FIVEDGLYVALDGVQDPGNLGTIIRTAVAAGAKGIFLLKGTVDPYNEKCVRSTMSALCNI 171

Query: 188 PYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQET 247
           P      L++    +     +T   S ++ KP        +  +ILG EG G+  +  E 
Sbjct: 172 PIFEDVTLSEFYDFIKDNTIKTYVTSLENAKPYHTISYPKRTMIILGNEGNGVSREIIEM 231

Query: 248 ATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
                 + M G I++LNVS AAA+ +Y  +   
Sbjct: 232 CDQAITIPMYGDIESLNVSIAAALCMYKVREQI 264


>gi|153813242|ref|ZP_01965910.1| hypothetical protein RUMOBE_03658 [Ruminococcus obeum ATCC 29174]
 gi|149830655|gb|EDM85746.1| hypothetical protein RUMOBE_03658 [Ruminococcus obeum ATCC 29174]
          Length = 247

 Score =  134 bits (336), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 57/239 (23%), Positives = 108/239 (45%), Gaps = 11/239 (4%)

Query: 51  LYGVHTVSAALNNPS--RKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKE 108
           + G + V  A  +     K+F L   ++   R            +  V  + +D++    
Sbjct: 5   IEGRNAVLEAFRSGKCVDKLFILDGCQDGPVRTIAREARKTDTIINYVSKERLDQLSETH 64

Query: 109 AVHQGLALETAPLLSPTLDAV-------RNSQLLMVLDHVNDPHNIGAILRSAVAFSCDG 161
           A HQG+  + A     T+D +         +  L++LD+V DPHN+GAI+R+A      G
Sbjct: 65  A-HQGVIAQVAAYDYSTVDEILARAEEKGEAPFLIILDNVEDPHNLGAIIRTANLAGAHG 123

Query: 162 IITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLE 221
           +I  KR +   ++ +AK+++GA+ + P  +++N+   ++++   G   +       + + 
Sbjct: 124 VIIPKRRAVGLTSTVAKTSAGAINYTPVAKVTNIVRTIEELKEKGIWFVCA-DMGGETMY 182

Query: 222 QEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
                  + L++G EG+G+    +E     A + M G I +LN S AA V  Y      
Sbjct: 183 DLDLTGPMGLVIGNEGEGVSRLVREACDFTASIPMKGDIDSLNASVAAGVLAYEIVRQR 241


>gi|332685573|ref|YP_004455347.1| TrmH family tRNA/rRNA methyltransferase YacO [Melissococcus
           plutonius ATCC 35311]
 gi|332369582|dbj|BAK20538.1| TrmH family tRNA/rRNA methyltransferase YacO [Melissococcus
           plutonius ATCC 35311]
          Length = 279

 Score =  134 bits (336), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 72/278 (25%), Positives = 120/278 (43%), Gaps = 11/278 (3%)

Query: 11  KIFSLKDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPS-RKIF 69
           K    K S      +     K  Q   +K+  T++ +N  ++G H V  A+      K+F
Sbjct: 2   KNKQSKISQNKHRYKEKNTAKNEQKKMKKTGITTEEDNF-VFGYHAVVEAIQQGRGNKLF 60

Query: 70  QLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDA- 128
               +K                PVK VP   ++     + VHQG+ L        +L+  
Sbjct: 61  LQEDSKGEKIDKLKQLAQERSLPVKWVPKTKLEMWS-NQGVHQGMVLAITAYEYLSLNEL 119

Query: 129 ------VRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASG 182
                    +   ++LD + DPHN G+I R+A A   DGII  K  S   + V+ K+++G
Sbjct: 120 LEQVKVKTKTPFFLILDGLEDPHNFGSIFRTADATGVDGIIIPKHRSVGITPVVTKTSTG 179

Query: 183 ALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRP 242
           A+E+IP  R++NL+  + K+    F   G           +     +ALI+G EGKG+  
Sbjct: 180 AVEYIPVARVTNLSQIIAKLKEQQFWIFGTDMTGIDYRNWD-ATGALALIIGNEGKGISA 238

Query: 243 KTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
             ++ A  +  + M G +++LN   AA + +Y      
Sbjct: 239 GLKKEADELITIPMSGHVQSLNAGVAAGLLMYEAYRKR 276


>gi|154505273|ref|ZP_02042011.1| hypothetical protein RUMGNA_02787 [Ruminococcus gnavus ATCC 29149]
 gi|153794471|gb|EDN76891.1| hypothetical protein RUMGNA_02787 [Ruminococcus gnavus ATCC 29149]
          Length = 275

 Score =  134 bits (336), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 51/266 (19%), Positives = 103/266 (38%), Gaps = 14/266 (5%)

Query: 26  NHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLA---TKNALARLD 82
           +++  K++    +KS+  S+       G+  V      P  ++  L      +    +  
Sbjct: 11  SNQRVKELSQIQKKSKIRSREGIFIAEGIRMVRE---TPHERLVGLYFSESFEKKYGKEV 67

Query: 83  WDANLPHPFPVKTVPPQTIDKIV-------GKEAVHQGLALETAPLLSPTLDAVR-NSQL 134
            D        V+    +  + +              QG+      +              
Sbjct: 68  LDVISGGDLKVREQIRKKTEILSDAVFSYVSDTKTPQGVLAVVHQMEYTLGQMTEGAIPH 127

Query: 135 LMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISN 194
           LM+LD++ DP N+G I R+A A    GII ++      +    +S  GAL  +P++ + +
Sbjct: 128 LMILDNLQDPGNLGTIFRTAEAAGVTGIIMSRDCVDIYNPKTIRSTMGALYRMPFVYVED 187

Query: 195 LTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHL 254
           L + +  +     ++     D K   ++E      A ++G EG GLR +  + A +   +
Sbjct: 188 LRETIHTLKEKNIKSYAAHLDGKNTYDKEDYRQGTAFLIGNEGNGLREEIAQCADTWIRI 247

Query: 255 HMPGIIKALNVSNAAAVALYITQNHF 280
            M G +++LN + AA V ++      
Sbjct: 248 PMCGQVESLNAAVAATVLMFEVSRQR 273


>gi|331701543|ref|YP_004398502.1| tRNA/rRNA methyltransferase SpoU [Lactobacillus buchneri NRRL
           B-30929]
 gi|329128886|gb|AEB73439.1| tRNA/rRNA methyltransferase (SpoU) [Lactobacillus buchneri NRRL
           B-30929]
          Length = 256

 Score =  134 bits (336), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 49/273 (17%), Positives = 94/273 (34%), Gaps = 24/273 (8%)

Query: 2   NLISKKKSEKIFSLKDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAAL 61
             I+  ++ ++                         Q  +   +     + G H V  A+
Sbjct: 4   ERITSNQNNRVKEWTK-------------------MQSKKGRVKSGEYVIEGWHIVDEAI 44

Query: 62  NNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPL 121
            +       ++  ++ L  L  D        +  + P+    I   E   QG+       
Sbjct: 45  RHRQTIKQLMVVDESYLGDLPVD----DDTEIFLITPEIAKHISSTE-TPQGVFAVLNTE 99

Query: 122 LSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSAS 181
                         ++LD++ DP NIG ++R+A A   +GI+  K  +   +  + +S  
Sbjct: 100 DYHEQIPDDLKGAWLLLDNIQDPGNIGTMVRTADAAGLNGIVFGKGSADLYNPKVVRSMQ 159

Query: 182 GALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLR 241
           G+  H+       L        +         +D            + ALI+G EG G+ 
Sbjct: 160 GSQFHMKLFTGDILEWMAAFKEAGVKTYGTELNDQAISYYDITPTKQFALIMGNEGNGVD 219

Query: 242 PKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
           PK  E      ++ M G  ++LNV+ A  + L+
Sbjct: 220 PKILEKTDQNLYIPMNGEAESLNVAVATGILLF 252


>gi|227889545|ref|ZP_04007350.1| RNA methyltransferase [Lactobacillus johnsonii ATCC 33200]
 gi|227850023|gb|EEJ60109.1| RNA methyltransferase [Lactobacillus johnsonii ATCC 33200]
          Length = 253

 Score =  134 bits (336), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 54/251 (21%), Positives = 106/251 (42%), Gaps = 6/251 (2%)

Query: 26  NHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDA 85
           N+   K ++   QK ++  + +   + G H V  AL +    ++ L  T  AL +LD   
Sbjct: 8   NNPTIKSLRKLEQK-KYRKKTQTYLIEGFHLVEDALKSHENYLYVL-GTAEALKKLDASY 65

Query: 86  NLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDHVNDPH 145
            L     ++     +      K +    + L      S + +  +     +VLD++ DP 
Sbjct: 66  KLKDDKVIQITDAISQHLSSTKNSQDIFMVLPINQPKSFSFEYGKW----VVLDNLTDPG 121

Query: 146 NIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSW 205
           N+G I+R+A A   DG++ ++      +  + +S  G+  HI  I+   L        + 
Sbjct: 122 NVGTIIRTADAAGFDGVVLSEESVDLYNPKVQRSMQGSQFHIQIIQNPILEAISSFKENG 181

Query: 206 GFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNV 265
               + +   + K L       ++AL++G E  G   +  ETA    ++ + G  ++LN 
Sbjct: 182 LPVYVSILDKTAKSLNNCTPVPQLALVIGNEAHGASKEVIETADKKIYIPIKGKAESLNA 241

Query: 266 SNAAAVALYIT 276
           + AA + +Y  
Sbjct: 242 AVAAGIMIYHF 252


>gi|16331014|ref|NP_441742.1| hypothetical protein slr0955 [Synechocystis sp. PCC 6803]
 gi|3915411|sp|P74328|Y955_SYNY3 RecName: Full=Uncharacterized tRNA/rRNA methyltransferase slr0955
 gi|1653509|dbj|BAA18422.1| slr0955 [Synechocystis sp. PCC 6803]
          Length = 384

 Score =  134 bits (336), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 77/291 (26%), Positives = 129/291 (44%), Gaps = 29/291 (9%)

Query: 17  DSHYAKLRRNHRDYK--KMQSFNQKSRHTS--------------QPENLFLYGVHTVSAA 60
            S +    R+   Y   + +   QK                   Q     LYG H V AA
Sbjct: 76  KSRFKDKDRDKPRYGDDRPRRSGQKPPFGKTFPAAPPPMDSEQAQEALDLLYGHHAVLAA 135

Query: 61  LNNPSRKIFQLLA----TKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLAL 116
           L+   R++ ++        +   R        +   V  V    +++I    A HQG+A 
Sbjct: 136 LD-GDRQLNRIWITSHLRHDIRYRTKIQTAKANGTVVDEVDNFRLNQIT-HNANHQGIAA 193

Query: 117 ETAPLLSPTL-------DAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYS 169
           + AP     L        +   + +L+++D + DPHN+GAI+R+A AF   G++  +R  
Sbjct: 194 QVAPYHYWELGDLIDKAKSQSTAPVLIIIDSITDPHNLGAIIRTAEAFGAQGMVLPQRRV 253

Query: 170 PSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKI 229
              ++ + K A+GALEH P  R+ NL+ AL+ +   GF   G  +  +  L Q    + +
Sbjct: 254 AGITSTVMKVAAGALEHFPVARVVNLSRALETLKESGFWIYGTVAGKQTALHQADLREPM 313

Query: 230 ALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
            L++G+EG+GL   TQ+    +  + + G   +LN S AAA++LY      
Sbjct: 314 GLVIGSEGEGLSLLTQKHCDHLITIPLAGKTPSLNASVAAAISLYEIFRQR 364


>gi|325686893|gb|EGD28918.1| RNA methyltransferase [Streptococcus sanguinis SK72]
          Length = 242

 Score =  134 bits (336), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 71/242 (29%), Positives = 117/242 (48%), Gaps = 9/242 (3%)

Query: 46  PENLFLYGVHTVSAALNNP-SRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKI 104
            +N  +YGVH V  AL      K++     +        D        +   P +T+ ++
Sbjct: 2   EKNDIVYGVHAVKEALAANTGNKLYIQDDLRGKKVEKIKDLAAEKKVSISWTPKKTLQEM 61

Query: 105 VGKEAVHQGLALETAPLLSPTLD------AVRNSQLLMVLDHVNDPHNIGAILRSAVAFS 158
               AVHQG  L  A       +         ++ LL++LD + DPHN+G+ILR+A A +
Sbjct: 62  TD-GAVHQGFVLRVAEFAYTDFEVLLKKAEQEDNPLLLILDGLTDPHNLGSILRTADATN 120

Query: 159 CDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKK 218
             G+I  K  +   + V+AK+++GA+EHIP  R++N++  L K+   GF   G       
Sbjct: 121 VAGVIIPKHRAVGVTPVVAKTSTGAIEHIPIARVTNISQTLDKLKEAGFWIFGTDMQGTP 180

Query: 219 PLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQN 278
             +      K+ALI+G EGKG+    ++    M  + M G +++LN S AAA+ +Y    
Sbjct: 181 SHKWNTA-GKLALIIGNEGKGISSNIKKQVDEMISIPMNGHVQSLNASVAAAILMYEVFR 239

Query: 279 HF 280
           + 
Sbjct: 240 NR 241


>gi|228993286|ref|ZP_04153202.1| RNA methyltransferase, TrmH [Bacillus pseudomycoides DSM 12442]
 gi|228766354|gb|EEM14997.1| RNA methyltransferase, TrmH [Bacillus pseudomycoides DSM 12442]
          Length = 257

 Score =  134 bits (336), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 49/277 (17%), Positives = 98/277 (35%), Gaps = 29/277 (10%)

Query: 1   MNLISKKKSEKIFSLKDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAA 60
           M  I   ++ ++   K                        +   +    F+ G H V  A
Sbjct: 4   MKNIDSVQNPRVKQWKKLQTK-------------------KERDKKGLFFVEGFHLVEEA 44

Query: 61  LNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAP 120
           L      I +L+ +       DW         +  VP   +  +   E      A+    
Sbjct: 45  LKAG--VITELIVSDQTDLPKDWTV---TDVEMYIVPEAIVKVLRETETTQGVFAVCEKH 99

Query: 121 LLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSA 180
                L   +     ++LD + DP N+G I+R+A A     ++  +    + ++ + +S 
Sbjct: 100 EKEIALTDGK----FLLLDGLQDPGNLGTIIRTADAAGIHAVVLGEGCVDAYNSKVLRST 155

Query: 181 SGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGL 240
            G++ H+P ++ +      +              ++  P  +       ALI+G EG G+
Sbjct: 156 QGSIFHLPIVKGNLEEWVDKLKEKNVPVYGTA-LENGVPYGEVTPAGSFALIVGNEGNGV 214

Query: 241 RPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQ 277
           R +         ++ + G  ++LNV+ AA +  Y  Q
Sbjct: 215 RQEVLAKCDQNLYIPIYGGAESLNVAVAAGILTYYLQ 251


>gi|254517454|ref|ZP_05129510.1| RNA methyltransferase [Clostridium sp. 7_2_43FAA]
 gi|226911203|gb|EEH96404.1| RNA methyltransferase [Clostridium sp. 7_2_43FAA]
          Length = 298

 Score =  134 bits (336), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 54/266 (20%), Positives = 110/266 (41%), Gaps = 12/266 (4%)

Query: 25  RNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLA---TKNALARL 81
           + +++  +    N  +    +     + G + V   L +  R I  +           ++
Sbjct: 32  KENKNGGEYIRENVSNASELETREDLIIGRNAVMEVLKSD-RTIECVYISNGNMEGSIKV 90

Query: 82  DWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAV-------RNSQL 134
             +        +K V  + +D +      HQG+     P     +  +            
Sbjct: 91  IINIAREKGLVLKEVDRKKLDAMS-NGTNHQGVIALVTPFKYCQIADMLNDAKEKGEDPF 149

Query: 135 LMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISN 194
           ++VLD + DPHN+G+I+R+A      GII  KR +   ++ + K + GA+EH+   +++N
Sbjct: 150 IIVLDEIEDPHNLGSIIRTAELCGVHGIIIPKRRNVGITSTVYKCSVGAIEHMKIAKVTN 209

Query: 195 LTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHL 254
           +  A+ ++   G    G     ++   Q   N   A+++G+EG+G+   T +    +  +
Sbjct: 210 INSAIDELKESGLWVYGADIAGEEYSYQVDFNGPCAMVIGSEGRGISKLTLKKCDKLVKI 269

Query: 255 HMPGIIKALNVSNAAAVALYITQNHF 280
            M G I +LN S A  + +Y      
Sbjct: 270 PMVGKINSLNASVAGGIMMYEILKGR 295


>gi|254492112|ref|ZP_05105287.1| RNA methyltransferase, TrmH family, group 3 [Methylophaga
           thiooxidans DMS010]
 gi|224462664|gb|EEF78938.1| RNA methyltransferase, TrmH family, group 3 [Methylophaga
           thiooxydans DMS010]
          Length = 246

 Score =  134 bits (336), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 75/241 (31%), Positives = 119/241 (49%), Gaps = 11/241 (4%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLA---TKNALARLDWDANLPHPFPVKTVPPQTIDKIVG 106
            ++G+H V AAL+ P  +I ++      ++        A       V      T+DKI  
Sbjct: 5   VIFGLHAVQAALDVPVSRIKEIWLAADRQDQRVDALLKAAEQQGVVVHKAERDTLDKIA- 63

Query: 107 KEAVHQGLALETAPLLSPTL-------DAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSC 159
               HQG A    PL S          +++    LL++LD V DPHN+GA LR+A A   
Sbjct: 64  PNVQHQGCAARCKPLESLDEKGLMTLVESLNEPALLLILDGVQDPHNLGACLRTAEAAGA 123

Query: 160 DGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKP 219
             +I  K  +   +A   K +SGA E +P+ +++NL+  ++++   G   +G S DS+  
Sbjct: 124 HAVIAPKDRASGLTATAVKISSGAAERVPFAQVTNLSRLMRELQDAGVWLVGTSGDSELS 183

Query: 220 LEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNH 279
           L Q      +A++LGAEGKG+R  T++    + ++ M G  ++LNVS AA V LY     
Sbjct: 184 LFQAELKGSMAIVLGAEGKGIRRLTRDNCDQVVYIPMQGEAESLNVSVAAGVCLYEAYRQ 243

Query: 280 F 280
            
Sbjct: 244 R 244


>gi|115378458|ref|ZP_01465617.1| RNA methyltransferase, TrmH family, group 3 [Stigmatella aurantiaca
           DW4/3-1]
 gi|310822269|ref|YP_003954627.1| RNA methyltransferase, TrmH family [Stigmatella aurantiaca DW4/3-1]
 gi|115364520|gb|EAU63596.1| RNA methyltransferase, TrmH family, group 3 [Stigmatella aurantiaca
           DW4/3-1]
 gi|309395341|gb|ADO72800.1| RNA methyltransferase, TrmH family [Stigmatella aurantiaca DW4/3-1]
          Length = 273

 Score =  134 bits (336), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 71/259 (27%), Positives = 122/259 (47%), Gaps = 12/259 (4%)

Query: 33  MQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALAR----LDWDANLP 88
           M+  + +S+   +    ++YGV+ V  AL     ++ +L   +  L              
Sbjct: 1   MRDRSSQSQEPRERGERYVYGVNPVLEALRARPDEVERLFIVEGQLGSKAAAEILSRARD 60

Query: 89  HPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTL-------DAVRNSQLLMVLDHV 141
                + V  + +  +  +  VHQG+A E        +        A   + L++VLD +
Sbjct: 61  SGIRTERVARERLTTLA-EGGVHQGVAAELRGFEYVDVPDLLEAAKASGRAPLVVVLDGI 119

Query: 142 NDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQK 201
            DPHN+GAI+RSA A    GI+  K  +   + V+AK+++GA+EH P  R+ N++ AL++
Sbjct: 120 QDPHNLGAIIRSAHALGAHGIVIGKDRAVQVTGVVAKASAGAVEHCPIARVVNISRALEE 179

Query: 202 MHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIK 261
           +   G       + SK+PL     +  +AL++GAEG G+R    +       + M G + 
Sbjct: 180 LKEAGLWVAAADTHSKEPLWGARLDGPLALVVGAEGAGVREGVLKHCDFRLGIPMVGQVG 239

Query: 262 ALNVSNAAAVALYITQNHF 280
           +LN S +AAV LY      
Sbjct: 240 SLNASVSAAVLLYEVARQR 258


>gi|161505128|ref|YP_001572240.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Salmonella enterica
           subsp. arizonae serovar 62:z4,z23:-- str. RSK2980]
 gi|160866475|gb|ABX23098.1| hypothetical protein SARI_03262 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 243

 Score =  134 bits (336), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 69/243 (28%), Positives = 111/243 (45%), Gaps = 10/243 (4%)

Query: 48  NLFLYGVHTVSAALNNPSRK---IFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKI 104
           +  +YG+H V A L     +   +F L   ++        A       ++    Q +D+ 
Sbjct: 2   SEMIYGIHAVQALLERAPERFQDVFILKGREDKRLLPLIHALEAQGVVIQLANRQFLDEK 61

Query: 105 VGKEAVHQGLALETAPLLSP------TLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFS 158
             + AVHQG+     P           L A+     L++LD V DPHN+GA LRSA A  
Sbjct: 62  S-EGAVHQGIIARVKPGRQYQENDLPDLIALHERPFLLILDGVTDPHNLGACLRSADAAG 120

Query: 159 CDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKK 218
              +I  K  S   +A   K A GA E +P IR++NL   ++ +       +G + ++  
Sbjct: 121 VHAVIVPKDRSAQLNATAKKVACGAAESVPLIRVTNLARTMRMLQEENIWIVGTAGEADH 180

Query: 219 PLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQN 278
            L Q     ++AL++GAEG+G+R  T+E    +  + M G + +LNVS A  + L+    
Sbjct: 181 TLYQSKMPGRMALVMGAEGEGMRRLTREHCDELISIPMAGSVSSLNVSVATGICLFEAVR 240

Query: 279 HFA 281
              
Sbjct: 241 QRI 243


>gi|319891496|ref|YP_004148371.1| TrmH family tRNA/rRNA methyltransferase YacO [Staphylococcus
           pseudintermedius HKU10-03]
 gi|317161192|gb|ADV04735.1| TrmH family tRNA/rRNA methyltransferase YacO [Staphylococcus
           pseudintermedius HKU10-03]
 gi|323465333|gb|ADX77486.1| RNA methyltransferase, TrmH family, group 3 [Staphylococcus
           pseudintermedius ED99]
          Length = 249

 Score =  134 bits (336), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 68/243 (27%), Positives = 118/243 (48%), Gaps = 11/243 (4%)

Query: 47  ENLFLYGVHTVSAALNNPS--RKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKI 104
           ++  + G H V  A+ +     KI      K                 V+TVP   +D++
Sbjct: 2   DSEIIVGRHAVREAVISGHTINKILIQEGIKKQQIEEILKVAKSSKLVVQTVPKSKLDQL 61

Query: 105 VGKEAVHQGLALETAPLLSPTLDAVRNSQ-------LLMVLDHVNDPHNIGAILRSAVAF 157
               A HQG+A   AP     L+     Q        +++LD + DPHN+G+ILR+A A 
Sbjct: 62  A--NAPHQGVAAFVAPYEYADLNQFLAEQAQKEGLSTVLILDGLEDPHNLGSILRTADAT 119

Query: 158 SCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSK 217
             DGII  KR S S +  +AK+++GA++H+P IR++NL+  +  +   G+   G  + + 
Sbjct: 120 GVDGIIIPKRRSVSLTQTVAKASTGAIQHVPVIRVTNLSQTMDVLKDKGYWIAGAEASNA 179

Query: 218 KPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQ 277
               Q   +  +A+++G+EG+G+  + +E       + M G + +LN S AA++ +Y   
Sbjct: 180 TDYRQMQADMPLAIVIGSEGQGMSRRVKEKCDFYIKIPMVGHVNSLNASVAASLMMYEVF 239

Query: 278 NHF 280
              
Sbjct: 240 RKR 242


>gi|313633669|gb|EFS00423.1| RNA methyltransferase [Listeria seeligeri FSL N1-067]
 gi|313638236|gb|EFS03476.1| RNA methyltransferase [Listeria seeligeri FSL S4-171]
          Length = 252

 Score =  134 bits (336), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 55/278 (19%), Positives = 108/278 (38%), Gaps = 26/278 (9%)

Query: 1   MNLISKKKSEKIFSLKDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAA 60
           M  I   K++++ + K                        +   +     + G H V  A
Sbjct: 1   MEQIQSVKNDRVKTWKKLQT-------------------RKGRDKTGTYLVEGFHLVEEA 41

Query: 61  LNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAP 120
           +      + +LL +K      +W   L   + V  +  + I  ++ +    QG+      
Sbjct: 42  IRQDGLVV-ELLVSKGVSVPEEW---LKGNYDVFEISTE-ISHLISETMTEQGVFAVVTT 96

Query: 121 LLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSA 180
                   +   + L+++D V DP N+G ++R+A A   D +I  +  +   +  + +S 
Sbjct: 97  TE--PDMMLLYGKKLLLVDAVQDPGNVGTLIRTADAAGYDAVILGRGSADLYNPKVIRST 154

Query: 181 SGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGL 240
            G+  HIP I+ +                  +  +  K L    K D +ALI+G EG G+
Sbjct: 155 QGSHFHIPVIQANLFDWVANLEEEGVPVIGAVLDEQAKSLNDISKRDTLALIVGNEGNGI 214

Query: 241 RPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQN 278
             + Q   +   ++ + G  ++LNV+ AA + LY  + 
Sbjct: 215 SEELQARLSEKVYIPIYGKSESLNVAVAAGILLYGLRK 252


>gi|116511397|ref|YP_808613.1| rRNA methylase [Lactococcus lactis subsp. cremoris SK11]
 gi|116107051|gb|ABJ72191.1| rRNA methylase [Lactococcus lactis subsp. cremoris SK11]
          Length = 252

 Score =  134 bits (336), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 56/277 (20%), Positives = 104/277 (37%), Gaps = 30/277 (10%)

Query: 1   MNLISKKKSEKIFSLKDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAA 60
           M +IS K ++K+   +     K R+N                     +  + G H +  A
Sbjct: 1   MEIISSKDNKKVKEARKLLTKKYRKN---------------------SYLIEGFHLLEEA 39

Query: 61  LNNPSRKIFQLLATKNALARLDWDANLPH---PFPVKTVPPQTIDKIVGKEAVHQGLALE 117
           L      I Q+   +N LA+L              V  V    +  +   E+    +A  
Sbjct: 40  LKAGH-SIKQIFVEENKLAKLTAMIGSEKSLTDLSVNLVSKDVLKSLADSESPQGLIAEV 98

Query: 118 TAPLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLA 177
                     A +     ++L++V DP N+G ++R+A A     +I     +   S  + 
Sbjct: 99  AKIEEVIDFSASK----FLLLENVQDPGNVGTMIRTADAAGFSAVILLGETADLYSPKVM 154

Query: 178 KSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEG 237
           +S  G+  H+   R++          +         S +    +        AL++G EG
Sbjct: 155 RSMQGSNFHLAIARMNEEECFAALKQAKISILTTTLSANSVSYKTVE-ESSFALVMGNEG 213

Query: 238 KGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
            G+     E+A  + H+ MPG  ++LNV+ AA + ++
Sbjct: 214 AGVSDFAVESADKLVHIDMPGQAESLNVAVAAGILIF 250


>gi|148264836|ref|YP_001231542.1| RNA methyltransferase [Geobacter uraniireducens Rf4]
 gi|146398336|gb|ABQ26969.1| RNA methyltransferase, TrmH family, group 3 [Geobacter
           uraniireducens Rf4]
          Length = 242

 Score =  134 bits (336), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 65/242 (26%), Positives = 117/242 (48%), Gaps = 8/242 (3%)

Query: 47  ENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDA---NLPHPFPVKTVPPQTIDK 103
           ++  +YG+++V  AL    R+ F+L        R              PV+    + I +
Sbjct: 2   KDEIIYGLNSVMEALR-GKRRAFELFVAPGGSDRRLEKLLALAAEKGVPVRQRDKRDIAR 60

Query: 104 IVGKEAVHQGLALETAPLLSPTLDA---VRNSQLLMVLDHVNDPHNIGAILRSAVAFSCD 160
           + G E  HQG+AL   P     L          LL+VLD V DPHN+GA++RSA      
Sbjct: 61  LCGTE-HHQGVALRAEPFAYAQLSDILVPGTDGLLLVLDGVQDPHNLGALIRSAACAGAQ 119

Query: 161 GIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPL 220
           G+I  +  +   +A + K+++GA+E IP   ++N+   L+++ + GF   G   +S   +
Sbjct: 120 GVIIPRDRAVGVTATVEKASAGAIETIPVAEVTNVAHTLEELKNAGFWIYGADGESPLSI 179

Query: 221 EQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
             +     + L++G+EG+G+RP  ++    +  + + G + +LN S A  + L+      
Sbjct: 180 FDQKLTGAVVLVIGSEGEGIRPLVKKKCDFLVSIPLRGGVNSLNASVAGGILLFEVVRQR 239

Query: 281 AK 282
           +K
Sbjct: 240 SK 241


>gi|320160779|ref|YP_004174003.1| RNA methyltransferase [Anaerolinea thermophila UNI-1]
 gi|319994632|dbj|BAJ63403.1| RNA methyltransferase [Anaerolinea thermophila UNI-1]
          Length = 271

 Score =  134 bits (336), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 54/260 (20%), Positives = 102/260 (39%), Gaps = 6/260 (2%)

Query: 24  RRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLL----ATKNALA 79
              +   K+++   ++ +   +    FL G+  V+ A          ++       +   
Sbjct: 4   SPANEQVKRIRRLQER-KERERTGLFFLEGIRIVAEAAERGEAFETLIVSPDRLQSDFAW 62

Query: 80  RLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLD 139
           +L  +    +  P+  V     +++  KE      A+     +     +V N +  + LD
Sbjct: 63  KLVENLRR-NGTPILEVSSLVFERLSQKEGPQGIAAVVHQRWMPLGAVSVENGKPWVALD 121

Query: 140 HVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDAL 199
            V DP N+G ILR+  A    G+I   + +        +++ GAL  +  +R S      
Sbjct: 122 SVADPGNLGTILRTLDAVGGAGVILLDQSTDPYDPSCVRASMGALFDLHLVRTSFEQFRD 181

Query: 200 QKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGI 259
                 G   IG S  +K+         ++ L++G+E  GL+P   E    +  + M G 
Sbjct: 182 WIKRQTGVALIGTSGAAKQDYHDFPYPSRLVLLMGSERLGLQPYHLELCDEVVRIPMVGR 241

Query: 260 IKALNVSNAAAVALYITQNH 279
             +LN++ A AV LY   N 
Sbjct: 242 SDSLNLAVATAVVLYEIFNQ 261


>gi|254828578|ref|ZP_05233265.1| RNA methyltransferase [Listeria monocytogenes FSL N3-165]
 gi|258600976|gb|EEW14301.1| RNA methyltransferase [Listeria monocytogenes FSL N3-165]
          Length = 252

 Score =  134 bits (336), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 57/278 (20%), Positives = 110/278 (39%), Gaps = 26/278 (9%)

Query: 1   MNLISKKKSEKIFSLKDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAA 60
           M  I   K++++ + K                        +   +     + G H V  A
Sbjct: 1   MEQIQSVKNDRVKTWKKLQT-------------------RKGRDKTGTYLVEGFHLVEEA 41

Query: 61  LNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAP 120
           L      + +LL +       +W   L   + V  +  + I  ++ +    QG+    A 
Sbjct: 42  LRQDG-LVLELLVSSGVSVPEEW---LKGDYDVFEISTE-ISHLISETMTEQGVFAVVAT 96

Query: 121 LLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSA 180
                   +   + L+++D V DP N+G ++R+A A   D ++  K  +   +  + +S 
Sbjct: 97  SE--PDMMLLYGKKLLLVDAVQDPGNVGTLIRTADAAGYDCVVLGKGSADLYNPKVIRST 154

Query: 181 SGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGL 240
            G+  HIP I+ +                  +  D  K L    K D +AL++G EG G+
Sbjct: 155 QGSHFHIPVIQANLFDWIANLEEEGVPVIGAVLDDQAKSLNDMTKRDTLALMVGNEGNGI 214

Query: 241 RPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQN 278
            P+ Q+  +   ++ + G  ++LNV+ AA + LY  + 
Sbjct: 215 SPELQDRLSEKVYIPIYGDSESLNVAVAAGILLYGLRK 252


>gi|260870912|ref|YP_003237314.1| 23S rRNA (Gm2251)-methyltransferase [Escherichia coli O111:H- str.
           11128]
 gi|257767268|dbj|BAI38763.1| 23S rRNA (Gm2251)-methyltransferase [Escherichia coli O111:H- str.
           11128]
 gi|323176061|gb|EFZ61653.1| RNA 2'-O ribose methyltransferase substrate binding family protein
           [Escherichia coli 1180]
          Length = 243

 Score =  134 bits (336), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 62/242 (25%), Positives = 104/242 (42%), Gaps = 8/242 (3%)

Query: 48  NLFLYGVHTVSAALNNPSRKIFQLLATKNALARLD---WDANLPHPFPVKTVPPQTIDKI 104
           +  +YG+H V A L     +  ++   K    +       A       ++    Q +D+ 
Sbjct: 2   SEMIYGIHAVQALLERAPERFQEVFILKGREDKRLLPLIHALESQGVVIQLANRQYLDEK 61

Query: 105 VGKEAVHQGLALETAPLLSPTLDAVR-----NSQLLMVLDHVNDPHNIGAILRSAVAFSC 159
                    +A           D        +   L++LD V DPHN+GA LRSA A   
Sbjct: 62  SDGAVHQGIIARVKPGRQYQENDLPDLIASLDQPFLLILDGVTDPHNLGACLRSADAAGV 121

Query: 160 DGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKP 219
             +I  K  S   +A   K A GA E +P IR++NL   ++ +       +G + ++   
Sbjct: 122 HAVIVPKDRSAQLNATAKKVACGAAESVPLIRVTNLARTMRMLQEENIWIVGTAGEADHT 181

Query: 220 LEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNH 279
           L Q     ++AL++GAEG+G+R  T+E    +  + M G + +LNVS A  + L+     
Sbjct: 182 LYQSKMTGRLALVMGAEGEGMRRLTREHCDELICIPMAGSVSSLNVSVATGICLFEAVRQ 241

Query: 280 FA 281
            +
Sbjct: 242 RS 243


>gi|257060931|ref|YP_003138819.1| tRNA/rRNA methyltransferase (SpoU) [Cyanothece sp. PCC 8802]
 gi|256591097|gb|ACV01984.1| tRNA/rRNA methyltransferase (SpoU) [Cyanothece sp. PCC 8802]
          Length = 260

 Score =  134 bits (336), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 51/254 (20%), Positives = 104/254 (40%), Gaps = 4/254 (1%)

Query: 27  HRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALN-NPSRKIFQLLATKNALARLDWDA 85
           +   K+++  + +++   +   L   G H +  A   N S       A   +     W+ 
Sbjct: 7   NPLVKQIRQLH-RTKGRREQNLLLFEGTHLLETACEVNCSLDCLCYTAQWQSRYPQLWEL 65

Query: 86  NLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDHVNDPH 145
                  ++ V P+ +  +         +A         +   + + ++ ++L+ + DP 
Sbjct: 66  ATQKAQRIELVSPEVLQALATTVNPDGVIATAV--NPKISKPTIADFKIGLILERLQDPG 123

Query: 146 NIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSW 205
           N+G I+R+AVA   DGI  +      ++  + +S++GA  H+P I   +L+  ++   + 
Sbjct: 124 NLGTIIRTAVATEIDGIWLSSDSVDIDNPKVLRSSAGAWFHVPLIVSCDLSATIKHYQAS 183

Query: 206 GFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNV 265
           G Q I     +              ++LG EG GL  +    A     + +   I++LNV
Sbjct: 184 GVQVIATLPTATNTYWDVDLTQPSLILLGNEGAGLSEELASLADQTVSIPLGNTIESLNV 243

Query: 266 SNAAAVALYITQNH 279
           + A A+ LY  Q  
Sbjct: 244 AIACALLLYERQRQ 257


>gi|298368797|ref|ZP_06980115.1| RNA methyltransferase, TrmH family [Neisseria sp. oral taxon 014
           str. F0314]
 gi|298282800|gb|EFI24287.1| RNA methyltransferase, TrmH family [Neisseria sp. oral taxon 014
           str. F0314]
          Length = 262

 Score =  134 bits (336), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 50/280 (17%), Positives = 95/280 (33%), Gaps = 22/280 (7%)

Query: 1   MNLISKKKSEKIFSLKDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAA 60
           M LI+  +++++                  K +     +++         L GVH + A 
Sbjct: 1   MKLITSAQNDRL------------------KYLSKLLSQAKARRASGQTVLEGVHLLQAY 42

Query: 61  LNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAP 120
           L      +   +       R           P + V       +    ++ +   + T  
Sbjct: 43  LQAGLTPVQVYIPESKLQQREILALIAA--LPEQAVTSVANAALSRITSLSEADDIMTLI 100

Query: 121 LLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSA 180
            +    DA   +   +VLD + DP N+G ++RSA A     ++     +   S  + ++A
Sbjct: 101 NIP-AQDAWPVNGDCVVLDRIQDPGNVGTVMRSAAAAGVGCLVVGIGSADVWSPKVLRAA 159

Query: 181 SGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGL 240
            GA   +       L   +       + T  L   +   L     +   A I G EG G+
Sbjct: 160 MGAHFLLKIHTEVRLAQWISSYRDKVWATA-LHHQNNHNLYNLDLHQSAAWIFGNEGSGV 218

Query: 241 RPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
                +  +    + M G  ++LNV+ AA V L+      
Sbjct: 219 DDNILDQVSGCVRIPMAGKTESLNVAMAATVCLFEQMRQR 258


>gi|238923821|ref|YP_002937337.1| putative tRNA/rRNA methyltransferase [Eubacterium rectale ATCC
           33656]
 gi|238875496|gb|ACR75203.1| putative tRNA/rRNA methyltransferase [Eubacterium rectale ATCC
           33656]
 gi|291524576|emb|CBK90163.1| rRNA methylase, putative, group 3 [Eubacterium rectale DSM 17629]
          Length = 255

 Score =  134 bits (336), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 53/241 (21%), Positives = 101/241 (41%), Gaps = 9/241 (3%)

Query: 50  FLYGVHTVSAALNNPSR--KIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIV-- 105
           ++ G + V  A  +     K+F L   ++   +        H   +  V  + +D++   
Sbjct: 13  YIEGRNAVLEAFRSGKTIDKLFVLDGCQDGPIKSITREARKHDAIINYVAKERLDQMSET 72

Query: 106 ----GKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDG 161
               G  AV           +    +       +++LD + DPHN+GAI+R+A      G
Sbjct: 73  GKHQGVIAVSAAYEYAEVSDILENAERKGEPPFIIILDGIEDPHNLGAIIRTANQAGAHG 132

Query: 162 IITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLE 221
           II  KR +   +  +AK+++GA+ + P  +++N+++ ++++   G   +         + 
Sbjct: 133 IIIPKRRAVGLTPTVAKTSAGAINYTPVAKVTNISNTIKELKEKGMWFVCA-DMGGTTMY 191

Query: 222 QEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHFA 281
                  I L++G EG G+    +E     A + M G I +LN S A  V  Y       
Sbjct: 192 DLNLTGPIGLVIGNEGDGVSKLVKENCDMTASIPMVGDIDSLNASVATGVLAYEIVRQRL 251

Query: 282 K 282
           K
Sbjct: 252 K 252


>gi|332982296|ref|YP_004463737.1| tRNA/rRNA methyltransferase SpoU [Mahella australiensis 50-1 BON]
 gi|332699974|gb|AEE96915.1| tRNA/rRNA methyltransferase (SpoU) [Mahella australiensis 50-1 BON]
          Length = 261

 Score =  134 bits (336), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 50/257 (19%), Positives = 98/257 (38%), Gaps = 3/257 (1%)

Query: 23  LRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLD 82
           +   +   K ++S    S    +    F+ G   +  A+      +F +  + +      
Sbjct: 3   ISDGNPRIKLVRSLA-SSHGRKKSGLYFIEGAKLIEEAIKANEDILFIVY-SSDFGDSTL 60

Query: 83  WDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDHVN 142
               +       +V P     I         LA+            +    LL+VLD V 
Sbjct: 61  LKLIIDRDIDNFSVLPDVFVNIADTATPQGVLAVLKQQQRDWHEIMMLEHCLLLVLDAVQ 120

Query: 143 DPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKM 202
           DP N+G ++R+A A     +I  +  +   +  + ++A G+  H+P      L +AL ++
Sbjct: 121 DPGNVGTMIRTADAMGFSAVIAGRGTADQYNPKVLRAAMGSSFHMPVYNDVPLPEALTEL 180

Query: 203 HSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKA 262
                  +         +++    D+ A+I+G E +G+  K  + A     + MPG  ++
Sbjct: 181 MERVSV-LAAVPRGGIDIDEAPLADRTAIIIGNEARGISDKVMDNAAYTVSIGMPGRAES 239

Query: 263 LNVSNAAAVALYITQNH 279
           LN S AA + +Y     
Sbjct: 240 LNASIAAGIIMYEISRR 256


>gi|291528371|emb|CBK93957.1| rRNA methylases [Eubacterium rectale M104/1]
          Length = 263

 Score =  134 bits (336), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 41/256 (16%), Positives = 93/256 (36%), Gaps = 4/256 (1%)

Query: 26  NHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDA 85
           +++  K +Q+   K++   +     + G      A   P   +  +  +++      +  
Sbjct: 6   SNKSIKNVQALLSKAKERKKQGVFVVEGPKMSFEA---PYDWVSAVYMSESFFYDDRFKE 62

Query: 86  NLPHPF-PVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDHVNDP 144
                    + V       +   +     LA+   P          +   L+VL+ + DP
Sbjct: 63  EKKRFLDKTEIVSDSVFKSMSDTQTPQGVLAIVKMPHYEIDELFKGDKTELLVLESIQDP 122

Query: 145 HNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHS 204
            N+G ++R+       GII  +      +    +S  G+L  +P+    +L + ++   S
Sbjct: 123 GNLGTMIRTGEGAGVSGIIMNRTTVDIFNPKTVRSTMGSLYRVPFYITDDLPETIEYAKS 182

Query: 205 WGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALN 264
            G          K   ++         ++G EG GL  +  + A +   + M G +++LN
Sbjct: 183 KGVSLYAAHLKGKCSYDRPDYTGACGFMIGNEGNGLSDEIADMADTYIRIPMEGAVESLN 242

Query: 265 VSNAAAVALYITQNHF 280
            + +A + +Y      
Sbjct: 243 AAISATLLMYECNRQR 258


>gi|218245150|ref|YP_002370521.1| TrmH family RNA methyltransferase [Cyanothece sp. PCC 8801]
 gi|257058176|ref|YP_003136064.1| RNA methyltransferase, TrmH family, group 3 [Cyanothece sp. PCC
           8802]
 gi|218165628|gb|ACK64365.1| RNA methyltransferase, TrmH family, group 3 [Cyanothece sp. PCC
           8801]
 gi|256588342|gb|ACU99228.1| RNA methyltransferase, TrmH family, group 3 [Cyanothece sp. PCC
           8802]
          Length = 292

 Score =  134 bits (336), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 66/275 (24%), Positives = 116/275 (42%), Gaps = 16/275 (5%)

Query: 16  KDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLL--- 72
           +     +   +           + S    +  N  +YG H+V AAL +  +     +   
Sbjct: 17  QKPMVKRRLPSSPLI-----VAKPSPQEEEEANDLIYGRHSVLAALESDRQLNRIWITNK 71

Query: 73  ATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDA---- 128
              +A       A       +  V  Q ++++      HQG+A + AP     L+     
Sbjct: 72  LHYDARFHTLIQAAKAKGSVIDEVSIQRLNQLT-HGGNHQGVAAQVAPYAYHELETLIEQ 130

Query: 129 ---VRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALE 185
                N  ++++ D + DP N+GAI+R+A A    G++  +R +   ++ + K A+GALE
Sbjct: 131 AKASSNEPVIVIADGIADPQNLGAIIRTAEALGTQGLVIPQRRAAGVTSTVIKVAAGALE 190

Query: 186 HIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQ 245
             P  R+ NL+ AL+ +   GF   G ++   K L        I L++G+E  GL   T+
Sbjct: 191 SFPVARVVNLSRALETLKEAGFWIYGTAATGGKSLHNMELRGPIGLVIGSEESGLSLLTE 250

Query: 246 ETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
                +  + + G   +LN S AAA+ LY      
Sbjct: 251 RCCDQLISIPLTGKTPSLNASVAAAIVLYEVYRQR 285


>gi|254830028|ref|ZP_05234683.1| rRNA methylase [Listeria monocytogenes 10403S]
          Length = 252

 Score =  134 bits (336), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 57/278 (20%), Positives = 110/278 (39%), Gaps = 26/278 (9%)

Query: 1   MNLISKKKSEKIFSLKDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAA 60
           M  I   K++++ + K                        +   +     + G H V  A
Sbjct: 1   MEQIQSVKNDRVKTWKKLQT-------------------RKGRDKTGTYLVEGFHLVEEA 41

Query: 61  LNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAP 120
           L      + +LL +       +W   L   + V  +  + I  ++ +    QG+    A 
Sbjct: 42  LRQDG-LVLELLVSSGVSVPEEW---LKDDYDVFEISTE-ISHLISETMTEQGVFAVVAT 96

Query: 121 LLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSA 180
                   +   + L+++D V DP N+G ++R+A A   D ++  K  +   +  + +S 
Sbjct: 97  SE--PDMMLLYGKKLLLVDAVQDPGNVGTLIRTADAAGYDCVVLGKGSADLYNPKVIRST 154

Query: 181 SGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGL 240
            G+  HIP I+ +                  +  D  K L    K D +AL++G EG G+
Sbjct: 155 QGSHFHIPVIQANLFDWIANLEEEGVPVIGAVLDDQAKSLNDMTKRDTLALMVGNEGNGI 214

Query: 241 RPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQN 278
            P+ Q+  +   ++ + G  ++LNV+ AA + LY  + 
Sbjct: 215 SPELQDRLSEKVYIPIYGDSESLNVAVAAGILLYGLRK 252


>gi|187928382|ref|YP_001898869.1| tRNA/rRNA methyltransferase SpoU [Ralstonia pickettii 12J]
 gi|187725272|gb|ACD26437.1| tRNA/rRNA methyltransferase (SpoU) [Ralstonia pickettii 12J]
          Length = 260

 Score =  134 bits (336), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 52/257 (20%), Positives = 100/257 (38%), Gaps = 5/257 (1%)

Query: 24  RRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDW 83
            R++  +K +++ +  ++H  +     L GVH V A L+     +  L+       R   
Sbjct: 6   SRDNAVFKHLKALSGSTQHRRRAGQSVLDGVHLVVAYLDAGHMPVQCLV--SERHVRHPE 63

Query: 84  DANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDHVND 143
            A +       TV     +       V  G+ L      +            ++LD + D
Sbjct: 64  VAAVLDRVDPDTVILLADNLFGQLTTVVNGVDLMALVETAEGKLPQTIDADCVILDGIQD 123

Query: 144 PHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMH 203
             N+G+ILR A A     +  T   + + SA   ++A GA  H+  +          ++ 
Sbjct: 124 AGNVGSILRCAAAAGVRDVFMTPGCAFAWSAKTLRAAMGAHFHLNIVEHCTFQSVHSRLR 183

Query: 204 SWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKAL 263
                 +  SS +K+ +     +  +  + G EG G+  +     T+   +  PG +++L
Sbjct: 184 VPL---LATSSHAKQAVFDVPLSSPVGWVFGNEGAGVSQEWLSAVTTPVTIPQPGGMESL 240

Query: 264 NVSNAAAVALYITQNHF 280
           NV+ AAA+ L+      
Sbjct: 241 NVAAAAAICLFEAVRQR 257


>gi|320638938|gb|EFX08584.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Escherichia coli
           O157:H7 str. G5101]
          Length = 243

 Score =  133 bits (335), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 63/242 (26%), Positives = 105/242 (43%), Gaps = 8/242 (3%)

Query: 48  NLFLYGVHTVSAALNNPSRKIFQLLATKNALAR--LDWDANLPH-PFPVKTVPPQTIDKI 104
           +  +YG+H V A L     +  ++   K    +  L     L      ++    Q +D+ 
Sbjct: 2   SEMIYGIHAVQALLERAPERFQEVFILKGREDKRLLPLIHALESLGVVIQLANRQYLDEK 61

Query: 105 VGKEAVHQGLALETAPLLSPTLDAVR-----NSQLLMVLDHVNDPHNIGAILRSAVAFSC 159
                    +A           D        +   L++LD V DPHN+GA LRSA A   
Sbjct: 62  SDGAVHQGIIARVKPGRQYQENDLPDLIASLDQPFLLILDGVTDPHNLGACLRSADAAGV 121

Query: 160 DGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKP 219
             +I  K  S   +A   K A GA E +P IR++NL   ++ +       +G + ++   
Sbjct: 122 HAVIVPKDRSAQLNATAKKVACGAAESVPLIRVTNLARTMRMLQEENIWIVGTAGEADHT 181

Query: 220 LEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNH 279
           L Q     ++AL++GAEG+G+R  T+E    +  + M G + +LNVS A  + L+     
Sbjct: 182 LYQSKMTGRLALVMGAEGEGMRRLTREHCDELISIPMAGSVSSLNVSVATGICLFEAVRQ 241

Query: 280 FA 281
            +
Sbjct: 242 RS 243


>gi|295108534|emb|CBL22487.1| rRNA methylase, putative, group 3 [Ruminococcus obeum A2-162]
          Length = 247

 Score =  133 bits (335), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 57/239 (23%), Positives = 107/239 (44%), Gaps = 11/239 (4%)

Query: 51  LYGVHTVSAALNNPS--RKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKE 108
           + G + V  A  +     K+F L   ++   R            +  V  + +D++    
Sbjct: 5   IEGRNAVLEAFRSGKCVDKLFILDGCQDGPVRTIAREARKTDTIINYVSKERLDQLSETR 64

Query: 109 AVHQGLALETAPLLSPTLDAV-------RNSQLLMVLDHVNDPHNIGAILRSAVAFSCDG 161
           A HQG+  + A     T+D +            L++LD+V DPHN+GAI+R+A      G
Sbjct: 65  A-HQGVIAQAAAYEYSTVDEILARAEEKGEPPFLILLDNVEDPHNLGAIIRTANLAGAHG 123

Query: 162 IITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLE 221
           +I  KR +   ++ +AK+++GA+ + P  +++N+   ++++   G   +       + + 
Sbjct: 124 VIIPKRRAVGLTSTVAKTSAGAINYTPVAKVTNIVRMIEELKEKGIWFVCA-DMGGEIMY 182

Query: 222 QEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
                  + L++G EG+G+    +E     A + M G I +LN S AA V  Y      
Sbjct: 183 DLDLTGPMGLVIGNEGEGVSRLVREACDFTASIPMKGDIDSLNASVAAGVLAYEIVRQR 241


>gi|146283972|ref|YP_001174125.1| RNA methyltransferase [Pseudomonas stutzeri A1501]
 gi|145572177|gb|ABP81283.1| RNA methyltransferase, TrmH family, group 3 [Pseudomonas stutzeri
           A1501]
 gi|327482300|gb|AEA85610.1| RNA methyltransferase [Pseudomonas stutzeri DSM 4166]
          Length = 251

 Score =  133 bits (335), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 72/242 (29%), Positives = 117/242 (48%), Gaps = 12/242 (4%)

Query: 51  LYGVHTVSAALNNPSRKIFQLLATKNA---LARLDWDANLPHPFPVKTVPPQTIDKIVGK 107
           +YG+H V A L +  +++ Q+   +       ++  +        V     + +D  V  
Sbjct: 7   IYGLHAVEALLRHHPKRVKQVWLAEGRGDPRVQVLIELAAQARVSVGQCERREMDAWV-- 64

Query: 108 EAVHQGLALETAPLLSP-------TLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCD 160
           E VHQG+  + +P            LD      LL+VLD V DPHN+GA LR+A A    
Sbjct: 65  EGVHQGVVADVSPSQVWGEAMLDELLDRAEGPPLLLVLDGVTDPHNLGACLRTADAAGAL 124

Query: 161 GIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPL 220
            +I  K  S + +A + K A GA E IP + ++NL   L+K+   G   +G + ++++ L
Sbjct: 125 AVIVPKDKSATLNATVRKVACGAAEVIPLVAVTNLARTLEKLQQKGLWVVGTAGEAEQSL 184

Query: 221 EQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
             +     I L++GAEG+G+R  T+E    +  L M G + +LNVS A  V L+      
Sbjct: 185 YAQDLTGPIVLVMGAEGRGMRRLTREHCDYLVRLPMAGSVSSLNVSVATGVCLFEALRQR 244

Query: 281 AK 282
            +
Sbjct: 245 GR 246


>gi|71891873|ref|YP_277602.1| tRNA/rRNA methyltransferase [Candidatus Blochmannia pennsylvanicus
           str. BPEN]
 gi|71795979|gb|AAZ40730.1| probable tRNA/rRNA methyltransferase [Candidatus Blochmannia
           pennsylvanicus str. BPEN]
          Length = 247

 Score =  133 bits (335), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 61/244 (25%), Positives = 110/244 (45%), Gaps = 9/244 (3%)

Query: 48  NLFLYGVHTVSAALNNPSRKIFQLLAT---KNALARLDWDANLPHPFPVKTVPPQTIDKI 104
           +  +YG+H V + L+N S +I  +      K+   +L  D        ++    + +D  
Sbjct: 2   SELVYGIHAVKSVLDNYSHRIVSVCIIQKSKDLRLKLLIDQIKQRRISIRECSRRQLDIQ 61

Query: 105 VGKEAVHQGLALETAPLLSPT------LDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFS 158
                    +                 L   + + LL++LD V DPHN+GA LRSA A  
Sbjct: 62  TQGALHQGIIVKIVPNDCMQENDLPNFLMQCKTTPLLVILDGVTDPHNLGACLRSADAAG 121

Query: 159 CDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKK 218
              +I  +  S   +  + K ASG++++IP+++++NL   LQ +  +    IG    S++
Sbjct: 122 AHIVIAPRNRSACLNGTVRKVASGSVDNIPFMQVTNLIRTLQLLQKYNIWIIGTVMQSQR 181

Query: 219 PLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQN 278
            +        +A ++G+EG G+R  TQ+    +  + M G+  +LNVS A  + L+    
Sbjct: 182 LIFNSKLTRPLAFVMGSEGNGIRYLTQKKCDELVTIPMLGVATSLNVSVATGICLFEALR 241

Query: 279 HFAK 282
              K
Sbjct: 242 QRWK 245


>gi|302871991|ref|YP_003840627.1| tRNA/rRNA methyltransferase (SpoU) [Caldicellulosiruptor
           obsidiansis OB47]
 gi|302574850|gb|ADL42641.1| tRNA/rRNA methyltransferase (SpoU) [Caldicellulosiruptor
           obsidiansis OB47]
          Length = 270

 Score =  133 bits (335), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 52/284 (18%), Positives = 116/284 (40%), Gaps = 26/284 (9%)

Query: 2   NLISKKKSEKIFSLKDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAAL 61
             IS +++E I  +K  +                     ++  +  +  + G+  V  A+
Sbjct: 7   EFISSRENECIKRVKKLNDK-------------------KYREEFRSFIIEGLKLVKEAI 47

Query: 62  NNPSRKIFQLLATKNALARLDWD----ANLPHPFPVKTV--PPQTIDKIVGKEAVHQGLA 115
           N     I  ++ ++ A  R          L     +K V   P  + + +   +  QG+ 
Sbjct: 48  NYQIECINLVIFSQQAKDRYQEFYWECKRLLEDGKIKRVIEVPDKLFEYIATTSTPQGIL 107

Query: 116 LETAPLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAV 175
            E   +    ++ ++N + ++V D + DP N+G ++R A AF  D ++TTK      +  
Sbjct: 108 AECNFVDK-DINFIKNLKRVVVADKLQDPGNLGTLIRCADAFGFDAVVTTKGTVDIYNPK 166

Query: 176 LAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGA 235
             ++  G+L H+  +R +     ++ +    F     +      + + + + K  +++G 
Sbjct: 167 TIRATMGSLFHLQIMREAEEGKLIKILKDNSFAVYVATPYGDIEISKVVPDKKFCVVIGN 226

Query: 236 EGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNH 279
           E +G+     + A     + M G  ++LN + AA++ LY  +  
Sbjct: 227 ESEGVSDSFAKVAARKIKIPMAGKAESLNAAVAASIVLYELRKR 270


>gi|237729114|ref|ZP_04559595.1| 23S rRNA 2'-O-methyltransferase [Citrobacter sp. 30_2]
 gi|226908843|gb|EEH94761.1| 23S rRNA 2'-O-methyltransferase [Citrobacter sp. 30_2]
          Length = 243

 Score =  133 bits (335), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 68/242 (28%), Positives = 110/242 (45%), Gaps = 10/242 (4%)

Query: 48  NLFLYGVHTVSAALNNPSRK---IFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKI 104
           +  +YG+H V A L     +   +F L   ++        A       ++    Q +D+ 
Sbjct: 2   SEMIYGIHAVQALLERAPERFQDVFILKGREDKRLLPLIHALEAQGVVIQLANRQFLDEK 61

Query: 105 VGKEAVHQGLALETAPLLSP------TLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFS 158
             + AVHQG+     P           L A  +    ++LD V DPHN+GA LRSA A  
Sbjct: 62  S-EGAVHQGIIARVKPGRQYQENDLPDLIATLDQPFFLILDGVTDPHNLGACLRSADAAG 120

Query: 159 CDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKK 218
              +I  K  S   +A   K A GA E +P IR++NL   ++ +       +G + ++  
Sbjct: 121 VHAVIVPKDRSAQLNATAKKVACGAAESVPLIRVTNLARTMRMLQEENIWIVGTAGEADH 180

Query: 219 PLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQN 278
            L Q     ++AL++GAEG+G+R  T+E    +  + M G + +LNVS A  + L+    
Sbjct: 181 TLYQSKMTGRLALVMGAEGEGMRRLTREHCDELISIPMAGSVSSLNVSVATGICLFEAVR 240

Query: 279 HF 280
             
Sbjct: 241 QR 242


>gi|218297027|ref|ZP_03497704.1| tRNA/rRNA methyltransferase (SpoU) [Thermus aquaticus Y51MC23]
 gi|218242582|gb|EED09119.1| tRNA/rRNA methyltransferase (SpoU) [Thermus aquaticus Y51MC23]
          Length = 262

 Score =  133 bits (335), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 48/258 (18%), Positives = 98/258 (37%), Gaps = 8/258 (3%)

Query: 24  RRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDW 83
              +   K + +  ++ +   +     + G   V  AL    + +  LL  +   A    
Sbjct: 5   SPKNPRVKALAALKER-KERERVGLFLVEGRREVERALQAGLKPVTVLLGPRATPAEE-- 61

Query: 84  DANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDHVND 143
              L     V  +  + + ++  +E   Q +A+   P  +     +    L++VL  +  
Sbjct: 62  --ALAQG-EVLRLSEEALKRVSSRENPAQVIAVFPIPRRALKEVRLPQDPLVLVLLGLEK 118

Query: 144 PHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMH 203
           P N+GAILRSA       ++  +        V+    S  +     +      +A + + 
Sbjct: 119 PGNLGAILRSADGAGAHLVLVAEGVDLYSPQVIRN--STGVVFSLPVFPVAEEEAARFLE 176

Query: 204 SWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKAL 263
             G   +  +   ++   +E     +A +LGAE +GL     + A +   + M G   +L
Sbjct: 177 EKGLYPVAATPRGERVYWEEDYRRGVAFLLGAEDRGLPEVWLKRAQARVRIPMRGRADSL 236

Query: 264 NVSNAAAVALYITQNHFA 281
           NV+ +AA+ LY      +
Sbjct: 237 NVAVSAALLLYEALRQRS 254


>gi|332971600|gb|EGK10550.1| 23S rRNA (guanosine-2'-O-)-methyltransferase RlmB [Kingella kingae
           ATCC 23330]
          Length = 248

 Score =  133 bits (335), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 66/244 (27%), Positives = 110/244 (45%), Gaps = 9/244 (3%)

Query: 46  PENLFLYGVHTVSAALNNPSRKIFQLLATKN---ALARLDWDANLPHPFPVKTVPPQTID 102
                +YG H ++A L    + I +L   +N   A  R   +        +       ++
Sbjct: 2   SNQRLIYGFHAINARLWQNPKSITELYVLENKADARTREVLEKAAAENVKLHFADQDRLN 61

Query: 103 KIVGKEAVHQGLALET-----APLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAF 157
            +  K A HQG+            L   LD +R    L+VLD + DPHN+GA LR+A A 
Sbjct: 62  TMA-KGARHQGVVGFIDASKNHVHLEDVLDNLREPAFLLVLDGITDPHNLGACLRTADAM 120

Query: 158 SCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSK 217
               +I  K  S   +A ++K A GA E +PYI ++NL   L+++   G   +G      
Sbjct: 121 GVHAVIAPKDKSAGLNATVSKVACGAAETVPYITVTNLARTLRELKECGIWVVGTDMGGD 180

Query: 218 KPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQ 277
             L        +A ++G EG G+R  T+E   ++  + M G ++++N+S +A + L  T+
Sbjct: 181 ADLFHYDIPQSVAWVMGNEGDGMRRLTREHCDALVSIPMFGTVESMNISVSAGMVLAETR 240

Query: 278 NHFA 281
               
Sbjct: 241 RQRT 244


>gi|289434467|ref|YP_003464339.1| RNA methyltransferase, TrmH family [Listeria seeligeri serovar 1/2b
           str. SLCC3954]
 gi|289170711|emb|CBH27251.1| RNA methyltransferase, TrmH family [Listeria seeligeri serovar 1/2b
           str. SLCC3954]
          Length = 252

 Score =  133 bits (335), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 55/278 (19%), Positives = 105/278 (37%), Gaps = 26/278 (9%)

Query: 1   MNLISKKKSEKIFSLKDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAA 60
           M  I   K++++ + K                        +   +     + G H V  A
Sbjct: 1   MEQIQSVKNDRVKTWKKLQT-------------------RKGRDKTGTYLVEGFHLVEEA 41

Query: 61  LNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAP 120
           +      + +LL +K      +W   L   + +  +  +    I          A+ T  
Sbjct: 42  IRQDGLVV-ELLVSKGVSVPEEW---LKGNYDIFEISTEISHFISETMTEQGVFAVVTTT 97

Query: 121 LLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSA 180
                L   +    L+++D V DP N+G ++R+A A   D +I  +  +   +  + +S 
Sbjct: 98  EPDMMLLYGKK---LLLVDAVQDPGNVGTLIRTADAAGYDAVILGRGSADLYNPKVIRST 154

Query: 181 SGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGL 240
            G+  HIP I+ +                  +  +  K L    K D +ALI+G EG G+
Sbjct: 155 QGSHFHIPVIQANLFDWIANLEEEGVPVIGAVLDEQAKSLNDISKRDTLALIVGNEGNGI 214

Query: 241 RPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQN 278
             + Q   +   ++ + G  ++LNV+ AA + LY  + 
Sbjct: 215 SEELQARLSEKVYIPIYGKSESLNVAVAAGILLYGLRK 252


>gi|212212578|ref|YP_002303514.1| 23S rRNA Gm2251 methyltransferase [Coxiella burnetii CbuG_Q212]
 gi|212010988|gb|ACJ18369.1| 23S rRNA Gm2251 methyltransferase [Coxiella burnetii CbuG_Q212]
          Length = 270

 Score =  133 bits (335), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 70/240 (29%), Positives = 119/240 (49%), Gaps = 12/240 (5%)

Query: 51  LYGVHTVSAALNNPSRKIFQLLATKNAL-ARLDWDANLPHP--FPVKTVPPQTIDKIVGK 107
           +YG+H VSA L+   ++I +L   +N    RL             V  +    ++ +  +
Sbjct: 27  IYGIHAVSAVLDAAPQRIVKLYVQENRDDQRLQSLVEKAKGLGVKVILLSRTELNTLSNE 86

Query: 108 EAVHQGLALETAPLLSPT-------LDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCD 160
           +  HQG+  +   + +         L       LL++LD V DPHN+GA LRSA AF   
Sbjct: 87  K--HQGIVADCEEVENLDESALLSLLKKRETPALLLILDGVKDPHNLGACLRSANAFGVR 144

Query: 161 GIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPL 220
            +I  K  +   + V+ K A GA E  P+IR++NL+  +  +   G   +G + +++  +
Sbjct: 145 AVIAPKDRAVGVTPVVRKVACGAAEMTPFIRVTNLSRTIDWLQKEGVWIVGTAVEAETLI 204

Query: 221 EQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
           ++      IA++LG+EG GLR  T+E    +A + + G +++LNVS A  + LY  Q   
Sbjct: 205 QEIDLTGDIAIVLGSEGGGLRRLTKERCDFLAQIPLRGSVESLNVSVACGICLYEVQRQR 264


>gi|270293024|ref|ZP_06199235.1| RNA methyltransferase, TrmH family protein [Streptococcus sp. M143]
 gi|270279003|gb|EFA24849.1| RNA methyltransferase, TrmH family protein [Streptococcus sp. M143]
          Length = 253

 Score =  133 bits (335), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 73/246 (29%), Positives = 122/246 (49%), Gaps = 9/246 (3%)

Query: 42  HTSQPENLFLYGVHTVSAAL-NNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQT 100
           +     N  +YGVH V+ AL  N   K++     +        +        +     ++
Sbjct: 9   NRDMKTNDIVYGVHAVTEALLANTGNKLYLQDDLRGKNVEKVKELAAEKKVSISWTSKKS 68

Query: 101 IDKIVGKEAVHQGLALETAPLLSPTLDA------VRNSQLLMVLDHVNDPHNIGAILRSA 154
           + ++  + AVHQG  L  +      L+          + LL++LD + DPHN+G+ILR+A
Sbjct: 69  LSEMT-EGAVHQGFVLRVSEFAYSELEHILAKTRQEENPLLLILDGLTDPHNLGSILRTA 127

Query: 155 VAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSS 214
            A +  G+I  K  +   + V+AK+A+GA+EH+P  R++NL+  L K+   GF T G   
Sbjct: 128 DATNVSGVIIPKHRAVGVTPVVAKTATGAIEHVPIARVTNLSQTLDKLKDEGFWTFGTDM 187

Query: 215 DSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
           +     +   K  KIALI+G EGKG+    ++    M  + M G +++LN S AAA+ +Y
Sbjct: 188 NGTPCHKWNTK-GKIALIIGNEGKGISSNIKKQVDEMITIPMNGHVQSLNASVAAAILMY 246

Query: 275 ITQNHF 280
               + 
Sbjct: 247 EVFRNR 252


>gi|16803258|ref|NP_464743.1| hypothetical protein lmo1218 [Listeria monocytogenes EGD-e]
 gi|46907437|ref|YP_013826.1| RNA methyltransferase [Listeria monocytogenes serotype 4b str.
           F2365]
 gi|47092017|ref|ZP_00229811.1| RNA methyltransferase, TrmH family [Listeria monocytogenes str. 4b
           H7858]
 gi|47095060|ref|ZP_00232673.1| RNA methyltransferase, TrmH family [Listeria monocytogenes str.
           1/2a F6854]
 gi|217964716|ref|YP_002350394.1| rRNA methyltransferase, TrmH family [Listeria monocytogenes HCC23]
 gi|224499109|ref|ZP_03667458.1| rRNA methyltransferase, TrmH family protein [Listeria monocytogenes
           Finland 1988]
 gi|224502486|ref|ZP_03670793.1| rRNA methyltransferase, TrmH family protein [Listeria monocytogenes
           FSL R2-561]
 gi|226223818|ref|YP_002757925.1| rRNA methylase [Listeria monocytogenes Clip81459]
 gi|254823528|ref|ZP_05228529.1| RNA methyltransferase [Listeria monocytogenes FSL J1-194]
 gi|254852912|ref|ZP_05242260.1| RNA methyltransferase [Listeria monocytogenes FSL R2-503]
 gi|254898621|ref|ZP_05258545.1| rRNA methylase [Listeria monocytogenes J0161]
 gi|254911890|ref|ZP_05261902.1| conserved hypothetical protein [Listeria monocytogenes J2818]
 gi|254932904|ref|ZP_05266263.1| RNA methyltransferase [Listeria monocytogenes HPB2262]
 gi|254936215|ref|ZP_05267912.1| RNA methyltransferase [Listeria monocytogenes F6900]
 gi|254991828|ref|ZP_05274018.1| rRNA methylase [Listeria monocytogenes FSL J2-064]
 gi|255522191|ref|ZP_05389428.1| rRNA methylase [Listeria monocytogenes FSL J1-175]
 gi|284801538|ref|YP_003413403.1| hypothetical protein LM5578_1291 [Listeria monocytogenes 08-5578]
 gi|284994680|ref|YP_003416448.1| hypothetical protein LM5923_1244 [Listeria monocytogenes 08-5923]
 gi|300764367|ref|ZP_07074361.1| TrmH family RNA methyltransferase [Listeria monocytogenes FSL
           N1-017]
 gi|16410634|emb|CAC99296.1| lmo1218 [Listeria monocytogenes EGD-e]
 gi|46880705|gb|AAT04003.1| RNA methyltransferase, TrmH family [Listeria monocytogenes serotype
           4b str. F2365]
 gi|47016678|gb|EAL07598.1| RNA methyltransferase, TrmH family [Listeria monocytogenes str.
           1/2a F6854]
 gi|47019733|gb|EAL10472.1| RNA methyltransferase, TrmH family [Listeria monocytogenes str. 4b
           H7858]
 gi|217333986|gb|ACK39780.1| rRNA methyltransferase, TrmH family [Listeria monocytogenes HCC23]
 gi|225876280|emb|CAS04989.1| Putative rRNA methylase [Listeria monocytogenes serotype 4b str.
           CLIP 80459]
 gi|258606248|gb|EEW18856.1| RNA methyltransferase [Listeria monocytogenes FSL R2-503]
 gi|258608805|gb|EEW21413.1| RNA methyltransferase [Listeria monocytogenes F6900]
 gi|284057100|gb|ADB68041.1| hypothetical protein LM5578_1291 [Listeria monocytogenes 08-5578]
 gi|284060147|gb|ADB71086.1| hypothetical protein LM5923_1244 [Listeria monocytogenes 08-5923]
 gi|293584458|gb|EFF96490.1| RNA methyltransferase [Listeria monocytogenes HPB2262]
 gi|293589848|gb|EFF98182.1| conserved hypothetical protein [Listeria monocytogenes J2818]
 gi|293592748|gb|EFG00509.1| RNA methyltransferase [Listeria monocytogenes FSL J1-194]
 gi|300515019|gb|EFK42072.1| TrmH family RNA methyltransferase [Listeria monocytogenes FSL
           N1-017]
 gi|307570723|emb|CAR83902.1| rRNA methyltransferase, TrmH family [Listeria monocytogenes L99]
 gi|313609196|gb|EFR84870.1| RNA methyltransferase [Listeria monocytogenes FSL F2-208]
 gi|328466614|gb|EGF37749.1| RNA methyltransferase, TrmH family [Listeria monocytogenes 1816]
 gi|332311603|gb|EGJ24698.1| RNA methyltransferase [Listeria monocytogenes str. Scott A]
          Length = 252

 Score =  133 bits (335), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 57/278 (20%), Positives = 109/278 (39%), Gaps = 26/278 (9%)

Query: 1   MNLISKKKSEKIFSLKDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAA 60
           M  I   K++++ + K                        +   +     + G H V  A
Sbjct: 1   MEQIQSVKNDRVKTWKKLQT-------------------RKGRDKTGTYLVEGFHLVEEA 41

Query: 61  LNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAP 120
           L      + +LL +       +W   L   + V  +  + I  ++ +    QG+    A 
Sbjct: 42  LRQDG-LVLELLVSSGVSVPEEW---LKGDYDVFEISTE-ISHLISETMTEQGVFAVVAT 96

Query: 121 LLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSA 180
                   +   + L+++D V DP N+G ++R+A A   D ++  K  +   +  + +S 
Sbjct: 97  SE--PDMMLLYGKKLLLVDAVQDPGNVGTLIRTADAAGYDCVVLGKGSADLYNPKVIRST 154

Query: 181 SGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGL 240
            G+  HIP I+                    +  D  K L    K D +AL++G EG G+
Sbjct: 155 QGSHFHIPVIQADLFDWIANLEEEGVPVIGAVLDDQAKSLNDMTKRDTLALMVGNEGNGI 214

Query: 241 RPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQN 278
            P+ Q+  +   ++ + G  ++LNV+ AA + LY  + 
Sbjct: 215 SPELQDRLSEKVYIPIYGDSESLNVAVAAGILLYGLRK 252


>gi|255036422|ref|YP_003087043.1| RNA methyltransferase, TrmH family, group 3 [Dyadobacter fermentans
           DSM 18053]
 gi|254949178|gb|ACT93878.1| RNA methyltransferase, TrmH family, group 3 [Dyadobacter fermentans
           DSM 18053]
          Length = 256

 Score =  133 bits (335), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 61/256 (23%), Positives = 107/256 (41%), Gaps = 10/256 (3%)

Query: 34  QSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPV 93
           + +  +     Q +   ++G  +V   L +    I +L   +                P 
Sbjct: 4   RKYTVRKPAPKQSQADMVFGTQSVLETLRSGKE-IERLFIQREFGLAEIEKLAKELGVPY 62

Query: 94  KTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDA-------VRNSQLLMVLDHVNDPHN 146
           + VP + ++++      HQG+    +P+    L            + LL++LD V D  N
Sbjct: 63  QRVPVEKLNRVT--RKNHQGVIAFVSPIQYMPLHNVLTQVYEDGKTPLLLLLDRVTDVRN 120

Query: 147 IGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWG 206
            GAI R+A       II   +     +A   K++SGAL  +P  R  NL + L  + + G
Sbjct: 121 FGAIARTAECAGVQAIIVPTKGGAQINADAMKTSSGALNFLPICREPNLYETLTYLRNSG 180

Query: 207 FQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVS 266
            Q I  +  + K L          +I+G+E  G+  +  + A S A + + G +++LNVS
Sbjct: 181 LQIIACTEKTDKSLYDIDFTVPTVIIMGSEEDGISKEFIDLADSGARIPLAGQVESLNVS 240

Query: 267 NAAAVALYITQNHFAK 282
            A++V LY       K
Sbjct: 241 VASSVVLYEAVRQRIK 256


>gi|88798926|ref|ZP_01114508.1| hypothetical protein MED297_12747 [Reinekea sp. MED297]
 gi|88778406|gb|EAR09599.1| hypothetical protein MED297_12747 [Reinekea sp. MED297]
          Length = 252

 Score =  133 bits (335), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 80/249 (32%), Positives = 124/249 (49%), Gaps = 14/249 (5%)

Query: 46  PENLFLYGVHTVSAALNNPSRKIFQLLATK---NALARLDWDANLPHPFPVKTVPPQTID 102
            E+L++YG+H V +AL+N   ++ ++L  K   +A  +   D         + V     D
Sbjct: 2   SESLWIYGLHAVFSALDNHPERVKEVLLLKGRDDARMKKLLDQVTEVGVRYRLVSRDDFD 61

Query: 103 KIVGKEAV----HQGLALETA-------PLLSPTLDAVRNSQLLMVLDHVNDPHNIGAIL 151
           + + K+ +    HQG+   T          L   LD +    LL+VLD V DPHNIGA L
Sbjct: 62  RTLHKQQLKDIRHQGVLALTTAAPVLKENDLEALLDNLEEPPLLLVLDGVTDPHNIGACL 121

Query: 152 RSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIG 211
           R+  A    G+I  K  S + +A   K ASGA + +P+  ++NL   L+++   G    G
Sbjct: 122 RTCDAAGAHGLIVPKDKSATLTATAVKIASGATDTVPFFAVTNLARTLEELKQRGIWVYG 181

Query: 212 LSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAV 271
            + ++   + Q      IAL++GAEGKGLR  T+E    + H+ M G + +LNVS AA V
Sbjct: 182 TAGEASSEIYQNRLQGPIALVMGAEGKGLRRLTREVCDELIHIPMAGDVSSLNVSVAAGV 241

Query: 272 ALYITQNHF 280
            L+      
Sbjct: 242 CLFEVVRQR 250


>gi|16763188|ref|NP_458805.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Salmonella enterica
           subsp. enterica serovar Typhi str. CT18]
 gi|29144667|ref|NP_808009.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Salmonella enterica
           subsp. enterica serovar Typhi str. Ty2]
 gi|213021981|ref|ZP_03336428.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Salmonella enterica
           subsp. enterica serovar Typhi str. 404ty]
 gi|213417716|ref|ZP_03350838.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Salmonella enterica
           subsp. enterica serovar Typhi str. E01-6750]
 gi|213648977|ref|ZP_03379030.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Salmonella enterica
           subsp. enterica serovar Typhi str. J185]
 gi|52783319|sp|Q8Z182|RLMB_SALTI RecName: Full=23S rRNA (guanosine-2'-O-)-methyltransferase RlmB;
           AltName: Full=23S rRNA Gm2251 2'-O-methyltransferase
 gi|25316741|pir||AI1049 probable tRNA/rRNA methyltransferase (EC 2.1.1.-) [imported] -
           Salmonella enterica subsp. enterica serovar Typhi
           (strain CT18)
 gi|16505496|emb|CAD06846.1| probable tRNA/rRNA methyltransferase [Salmonella enterica subsp.
           enterica serovar Typhi]
 gi|29140306|gb|AAO71869.1| probable tRNA/rRNA methyltransferase [Salmonella enterica subsp.
           enterica serovar Typhi str. Ty2]
          Length = 243

 Score =  133 bits (335), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 68/243 (27%), Positives = 109/243 (44%), Gaps = 10/243 (4%)

Query: 48  NLFLYGVHTVSAALNNPSRKIFQLLATKNALARLD---WDANLPHPFPVKTVPPQTIDKI 104
           +  +YG+H V A L     +  +    K    +       A       ++    Q +D+ 
Sbjct: 2   SEMIYGIHAVQALLERAPERFQEAFILKGREDKRLLPLIHALESQGVVIQLANRQYLDEK 61

Query: 105 VGKEAVHQGLALETAPLLSP------TLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFS 158
               AVHQG+     P           L A+ +   L++LD V DPHN+GA LRSA A  
Sbjct: 62  SD-GAVHQGIIARVKPGRQYQENDLPDLIALHDRPFLLILDGVTDPHNLGACLRSADAAG 120

Query: 159 CDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKK 218
              +I  K  S   +A   K A GA E +P IR++NL   ++ +       +G + ++  
Sbjct: 121 VHAVIVPKDRSAQLNATAKKVACGAAESVPLIRVTNLARTMRMLQEENIWIVGTAGEADH 180

Query: 219 PLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQN 278
            L Q     ++AL++GAEG+G+R  T+E    +  + M G + +LNVS A  + L+    
Sbjct: 181 TLYQSKMPGRMALVMGAEGEGMRRLTREHCDELISIPMAGSVSSLNVSVATGICLFEAVR 240

Query: 279 HFA 281
              
Sbjct: 241 QRT 243


>gi|315281992|ref|ZP_07870501.1| RNA methyltransferase [Listeria marthii FSL S4-120]
 gi|313614371|gb|EFR88006.1| RNA methyltransferase [Listeria marthii FSL S4-120]
          Length = 252

 Score =  133 bits (335), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 55/278 (19%), Positives = 108/278 (38%), Gaps = 26/278 (9%)

Query: 1   MNLISKKKSEKIFSLKDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAA 60
           M  I   K++++ + K                        +   +     + G H V  A
Sbjct: 1   MEQIQSVKNDRVKTWKKLQT-------------------RKGRDKTGTYLVEGFHLVEEA 41

Query: 61  LNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAP 120
           L      + +LL +       +W   L   + V  +    I  ++ +    QG+    A 
Sbjct: 42  LRQDG-LVLELLVSSGVSVPEEW---LKGDYDVFEIS-AEISHLISETMTEQGVFAVVAT 96

Query: 121 LLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSA 180
                   +   + L+++D V DP N+G ++R+A A   D ++  +  +   +  + +S 
Sbjct: 97  SE--PDMMLLYGKKLLLVDAVQDPGNVGTLIRTADAAGYDCVVLGRGSADLYNPKVIRST 154

Query: 181 SGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGL 240
            G+  HIP I+                    +  D  K L    K + +AL++G EG G+
Sbjct: 155 QGSHFHIPVIQADLFDWIANLEEEGVPVIGAVLDDQAKSLNDMPKRETLALMVGNEGNGI 214

Query: 241 RPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQN 278
            P+ Q+  +   ++ + G  ++LNV+ AA + LY  + 
Sbjct: 215 SPELQDRLSEKVYIPIYGDSESLNVAVAAGILLYGLRK 252


>gi|293393205|ref|ZP_06637520.1| 23S rRNA (guanosine-2'-O-)-methyltransferase RlmB [Serratia
           odorifera DSM 4582]
 gi|291424351|gb|EFE97565.1| 23S rRNA (guanosine-2'-O-)-methyltransferase RlmB [Serratia
           odorifera DSM 4582]
          Length = 243

 Score =  133 bits (335), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 64/242 (26%), Positives = 105/242 (43%), Gaps = 8/242 (3%)

Query: 48  NLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANL---PHPFPVKTVPPQTIDKI 104
           +  +YG+H V A L    ++  ++   K    R               ++    Q +D  
Sbjct: 2   SEIIYGIHAVKALLERDPQRFLEVFILKGRDDRRLQPLIAELEATGIVIQVANRQWLDDK 61

Query: 105 VGKEAVHQGLALETAPLLSPTLDAVR-----NSQLLMVLDHVNDPHNIGAILRSAVAFSC 159
           V        +A           D        ++  L+VLD V DPHN+GA LRSA A   
Sbjct: 62  VEGAVHQGIVARVREGRQYQENDLPGLLESVDTPFLLVLDGVTDPHNLGACLRSADAAGV 121

Query: 160 DGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKP 219
             +I  +  S   +A   K A GA E++P IR++NL   L+ +       +G + ++   
Sbjct: 122 HAVIVPRDRSAQLNATAKKVACGAAENVPLIRVTNLARTLRLLQELNVWVVGTAGEADHT 181

Query: 220 LEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNH 279
           L Q      +AL++GAEG+G+R  T+E    +  + M G + +LNVS A  + L+     
Sbjct: 182 LYQSKMTGPMALVMGAEGEGMRRLTREHCDELIGIPMAGSVSSLNVSVATGICLFEAVRQ 241

Query: 280 FA 281
            +
Sbjct: 242 RS 243


>gi|299535511|ref|ZP_07048832.1| putative tRNA/rRNA methyltransferase [Lysinibacillus fusiformis
           ZC1]
 gi|298728711|gb|EFI69265.1| putative tRNA/rRNA methyltransferase [Lysinibacillus fusiformis
           ZC1]
          Length = 254

 Score =  133 bits (335), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 48/274 (17%), Positives = 92/274 (33%), Gaps = 24/274 (8%)

Query: 1   MNLISKKKSEKIFSLKDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAA 60
           M  I   +                  +   K  +      +   +     + G H V  A
Sbjct: 1   MKRIESTQ------------------NALVKYWKKLATTRKERERSGEFLVEGFHLVEEA 42

Query: 61  LNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAP 120
           L N   ++ Q++  +     + W  +      +  V      +    E      A     
Sbjct: 43  LKN-KNQVLQIIVREGIDLPMLWPID---DIAIVEVSTAVAKEFAETETSQGVFA--VCK 96

Query: 121 LLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSA 180
                 + +   + ++++D V DP NIG ++R+A A   D +I  K  +   +    ++A
Sbjct: 97  QPVLVDNVMTTWRKVLLIDAVQDPGNIGTMIRTADAADLDAVILGKGCADLYNPKTLRAA 156

Query: 181 SGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGL 240
            G+  HIP +R                       +   P          A+I+G EG G+
Sbjct: 157 QGSHFHIPVVRGDLAEWIDILQDQGVPVFGTALDEEAVPYSDIQHTGAFAIIMGNEGSGI 216

Query: 241 RPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
           +P+          + + G  ++LNV+ A  + LY
Sbjct: 217 QPQLLAMTDQNMIIPLFGQAESLNVAVATGIVLY 250


>gi|319407391|emb|CBI81042.1| tRNA/rRNA metyltransferase [Bartonella sp. 1-1C]
          Length = 272

 Score =  133 bits (335), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 138/270 (51%), Positives = 182/270 (67%), Gaps = 5/270 (1%)

Query: 15  LKDSHYAKLRRNHRDYK----KMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQ 70
           LKDSHYA+LRR +R+ K    +  ++ ++     Q E ++LYG+H V AAL NP R +  
Sbjct: 2   LKDSHYARLRRRYRNTKGSFFQSTTYVKQPPIPLQKEQIYLYGIHPVHAALKNPRRVLRH 61

Query: 71  LLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVR 130
           L AT NAL RL  + +     PV +  P+ ++  VG+EAVHQG+ LET PL S  L  + 
Sbjct: 62  LYATPNALKRLGINESNIA-CPVTSCLPKKLEMFVGREAVHQGIVLETEPLKSRPLSELT 120

Query: 131 NSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYI 190
           N+ L++++D + DPHN+GAI+RSAVAF    IITT R+SP ES VLAK+ASGALE I YI
Sbjct: 121 NTDLIIIMDQITDPHNVGAIMRSAVAFKAGAIITTNRHSPQESGVLAKAASGALELIEYI 180

Query: 191 RISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATS 250
            + NL   LQ++H   F + GL S+ K PLE  +K  KI+LILGAEGKGLR KT+E A S
Sbjct: 181 TVRNLFKTLQELHQMNFISFGLDSEGKFPLETALKGTKISLILGAEGKGLRQKTRENAYS 240

Query: 251 MAHLHMPGIIKALNVSNAAAVALYITQNHF 280
           +A L +PG IK+LNVSNAAA+ALY    + 
Sbjct: 241 LARLDLPGDIKSLNVSNAAAIALYAVHKYL 270


>gi|227821738|ref|YP_002825708.1| RNA methyltransferase, TrmH family, group 3 [Sinorhizobium fredii
           NGR234]
 gi|227340737|gb|ACP24955.1| RNA methyltransferase, TrmH family, group 3 [Sinorhizobium fredii
           NGR234]
          Length = 291

 Score =  133 bits (335), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 137/275 (49%), Positives = 184/275 (66%), Gaps = 13/275 (4%)

Query: 6   KKKSEKIFSLKDSHYAKLRRNHRDYKKMQS--FNQKSRHTSQ-----------PENLFLY 52
            K      S +DSHYA LRR HRD ++ +      +     +           P+ +FLY
Sbjct: 2   SKDKSGDKSARDSHYATLRRAHRDARRERGEIPTPRPDKRRKLPADWKPPALAPDEVFLY 61

Query: 53  GVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQ 112
           G+HTV AAL+NP R I +L  T+NA ARL+        FPV+ V PQ +D+ +G +A+HQ
Sbjct: 62  GLHTVRAALDNPDRTIIRLRVTQNAAARLELGDLSALRFPVEIVTPQDLDRALGPDAIHQ 121

Query: 113 GLALETAPLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSE 172
           G+ LET PL    L+A+ +  L+++LD V DPHN+GAI+RSAVAF    +ITT R+SP+E
Sbjct: 122 GVMLETRPLPHRKLEALSDCPLILLLDQVTDPHNVGAIMRSAVAFEAGALITTMRHSPTE 181

Query: 173 SAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALI 232
           S VLAKSASGALE IPYI+I+NL D ++++H  GFQTIGL S+  +PLE      K+AL+
Sbjct: 182 SGVLAKSASGALELIPYIQITNLADTIEELHKLGFQTIGLDSEGPQPLEDTFSGGKVALV 241

Query: 233 LGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSN 267
           LG+EGKGLR KT++T T++A L MPG IK+LNVSN
Sbjct: 242 LGSEGKGLRQKTRQTVTALARLDMPGAIKSLNVSN 276


>gi|89893016|ref|YP_516503.1| hypothetical protein DSY0270 [Desulfitobacterium hafniense Y51]
 gi|89332464|dbj|BAE82059.1| hypothetical protein [Desulfitobacterium hafniense Y51]
          Length = 285

 Score =  133 bits (335), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 50/287 (17%), Positives = 99/287 (34%), Gaps = 29/287 (10%)

Query: 2   NLISKKKSEKIFSLKDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAAL 61
           ++++  ++E++  + + H                   K +   +     + G   V   L
Sbjct: 14  DMLTSLQNEQVKYVVNLH-------------------KRKFREENGEFLIEGWRFVEEGL 54

Query: 62  NNPS--RKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETA 119
              +   K+F     KN       +A      PV  V  + + K+   E     LA+   
Sbjct: 55  ARGAHLTKVFFCSECKNESWPQLAEALKVKGVPVIEVDERVLRKMSDTENPQGILAVVKQ 114

Query: 120 PLLSPTLDA-------VRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSE 172
              +                 +L++LD V DP N G ILR+A+A     +  T+      
Sbjct: 115 SRWTWDDFIEIVNPAGRSAIPMLLILDGVQDPGNCGTILRTALAAGVTQVCLTEGTVDLY 174

Query: 173 SAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALI 232
           +  + +S  GA+  +         + L+   S         ++      +      +AL+
Sbjct: 175 NLKVLRSTMGAIFSLNIATHCQPEEILKVCRSHKIPVFVGDAEGTDLY-ETHFAQPMALV 233

Query: 233 LGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNH 279
           +G EG G     +        + M   +++LNV+ A  + LY  +  
Sbjct: 234 VGNEGNGPSAAFRGPGVKRITIPMSHQVESLNVAMATGIILYEVRRR 280


>gi|88810597|ref|ZP_01125854.1| RNA methyltransferase, TrmH family, group 3 [Nitrococcus mobilis
           Nb-231]
 gi|88792227|gb|EAR23337.1| RNA methyltransferase, TrmH family, group 3 [Nitrococcus mobilis
           Nb-231]
          Length = 256

 Score =  133 bits (335), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 64/240 (26%), Positives = 108/240 (45%), Gaps = 9/240 (3%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLATKNAL---ARLDWDANLPHPFPVKTVPPQTIDKIVG 106
            ++G+H+V AA+      + ++   + A     +           PV  V  + +D++  
Sbjct: 6   IIHGLHSVRAAVRYDPTHVVEVWLDRQARSGRWQALRRQLEALACPVHLVDRRQLDRLTS 65

Query: 107 KEAVH------QGLALETAPLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCD 160
            +          G        L   L  +    LL+VLD V DPHN+GA LR+A      
Sbjct: 66  GQVHQGVAIRYAGQPPRAEHELEALLSELGPDPLLLVLDQVQDPHNLGACLRTAAGAGVQ 125

Query: 161 GIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPL 220
            +IT +  +   +  + K+A+GA++HIP  +++NL   L+K+   G   IG +  +   L
Sbjct: 126 AVITPRDRAVGLTPTVYKAATGAVQHIPLFQVTNLARTLRKLREAGMWLIGAAEQADVTL 185

Query: 221 EQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
            +   +  + L++GAE  GLR  T+     +  + M G I +LNVS A  V LY      
Sbjct: 186 YEVDLSGPLVLVMGAEEAGLRRLTRACCDRLIRIPMLGAIDSLNVSVATGVVLYEVVRQR 245


>gi|331085693|ref|ZP_08334776.1| RNA methyltransferase [Lachnospiraceae bacterium 9_1_43BFAA]
 gi|330406616|gb|EGG86121.1| RNA methyltransferase [Lachnospiraceae bacterium 9_1_43BFAA]
          Length = 251

 Score =  133 bits (335), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 57/239 (23%), Positives = 105/239 (43%), Gaps = 11/239 (4%)

Query: 51  LYGVHTVSAALNNPS--RKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKE 108
           + G + V  A  +     K+F L   ++   R        H   +  V  + +D++  + 
Sbjct: 14  IEGRNAVLEAFRSGKPVDKLFVLDGCQDGPVRTIVREAKKHDTILNFVSKERLDQLS-ET 72

Query: 109 AVHQGLALETAPLLSPTLDAV-------RNSQLLMVLDHVNDPHNIGAILRSAVAFSCDG 161
             HQG+    A      ++ +             ++LD++ DPHN+GAI+R+A      G
Sbjct: 73  GKHQGVIAHAAAYEYSEIEDMFALAEKRGEDPFFILLDNIEDPHNLGAIIRTANLAGAHG 132

Query: 162 IITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLE 221
           +I  KR +   +A +AK+++GAL + P  +++NL   ++++   G   +      +    
Sbjct: 133 VIIPKRRAVGLTATVAKTSAGALNYTPVAKVTNLAKTMEELKERGLWFVCADMGGESMYR 192

Query: 222 QEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
                  I L++G EG+G+    +E    +A + M G I +LN S AA V  Y      
Sbjct: 193 MN-LTGPIGLVIGNEGEGVSRLVKEKCDFVASIPMKGDIDSLNASVAAGVLAYEIVRQR 250


>gi|323340004|ref|ZP_08080270.1| TrmH family RNA methyltransferase [Lactobacillus ruminis ATCC
           25644]
 gi|323092510|gb|EFZ35116.1| TrmH family RNA methyltransferase [Lactobacillus ruminis ATCC
           25644]
          Length = 255

 Score =  133 bits (335), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 45/274 (16%), Positives = 105/274 (38%), Gaps = 23/274 (8%)

Query: 1   MNLISKKKSEKIFSLKDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAA 60
           M++I+   ++++   K                      + +   +     L G H V  A
Sbjct: 1   MDIITSSSNQRVKDWKKL-------------------SQKKARIKQGKYMLDGWHLVKEA 41

Query: 61  LNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAP 120
           +    + I ++L T++   R   +  +P    V  +       +    +   G+      
Sbjct: 42  ILFD-QPISEILVTQDFKHR--NELEVPDNVEVIEISDNVAKHLSETPSPQ-GIFAVVNL 97

Query: 121 LLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSA 180
             +      + +   + LD V DP NIG ++R+A A    G++  +  +      + ++ 
Sbjct: 98  PENAEEKPKKATGAWLFLDGVQDPGNIGTMVRTADACGFSGVVFGEGCADMFQPKVVRAM 157

Query: 181 SGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGL 240
            G+  H+     + +  A +             +D  +  +Q  ++   AL++G EG G+
Sbjct: 158 QGSQFHLKLCSGNLIEWAKEFKQRKLPVFGSELNDQARSYDQVGRHSDFALVMGNEGNGM 217

Query: 241 RPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
             K  +  +   ++ + G  ++LNV+ AA + ++
Sbjct: 218 SEKLLKETSLNLYIPIKGHAESLNVAVAAGILMF 251


>gi|262281995|ref|ZP_06059764.1| RNA methyltransferase [Streptococcus sp. 2_1_36FAA]
 gi|262262449|gb|EEY81146.1| RNA methyltransferase [Streptococcus sp. 2_1_36FAA]
          Length = 243

 Score =  133 bits (335), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 72/242 (29%), Positives = 118/242 (48%), Gaps = 9/242 (3%)

Query: 46  PENLFLYGVHTVSAALNNP-SRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKI 104
            +N  +YGVH V+ AL      K++     +        D        +   P +T+ ++
Sbjct: 2   EKNDIVYGVHAVTEALAANTGNKLYIQDDLRGKKVDKIKDLAAEKKVSISWTPKKTLQEM 61

Query: 105 VGKEAVHQGLALETAPLLSPTLD------AVRNSQLLMVLDHVNDPHNIGAILRSAVAFS 158
               AVHQG  L  A       +         ++ LL++LD + DPHN+G+ILR+A A +
Sbjct: 62  TD-GAVHQGFVLRVAEFAYTDFEVLLKKAEQEDNPLLLILDGLTDPHNLGSILRTADATN 120

Query: 159 CDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKK 218
             G+I  K  +   + V+AK+++GA+EHIP  R++NL+  L K+   GF   G       
Sbjct: 121 VAGVIIPKHRAVGVTPVVAKTSTGAIEHIPIARVTNLSQTLDKLKEAGFWIFGTDMQGTP 180

Query: 219 PLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQN 278
             +      K+ALI+G EGKG+    ++    M  + M G +++LN S AAA+ +Y    
Sbjct: 181 SHKWNT-TGKLALIIGNEGKGISSNIKKQVDEMISIPMNGHVQSLNASVAAAILMYEVFR 239

Query: 279 HF 280
           + 
Sbjct: 240 NR 241


>gi|332827813|gb|EGK00548.1| hypothetical protein HMPREF9455_03191 [Dysgonomonas gadei ATCC
           BAA-286]
          Length = 263

 Score =  133 bits (335), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 47/282 (16%), Positives = 94/282 (33%), Gaps = 23/282 (8%)

Query: 1   MNLISKKKSEKIFSLKDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAA 60
           M  I+  ++ +I ++                       K++   +     + G   +S A
Sbjct: 1   MEKITSLQNPRIKNITKL-------------------AKNKERKEQNLFLIEGARELSLA 41

Query: 61  LNNPSRKIFQLLATKNALAR--LDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALET 118
           +      I  +        +       +      +  V     +KI  +E     L L  
Sbjct: 42  MTADYE-INSVYVCPELFRKTDYPDVLDSIGENKLFEVSEAVFEKIAYREGSDGLLTLAV 100

Query: 119 APLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAK 178
               +     +  +  +++L+ V  P N+GAILR+A A   D +I     +       A 
Sbjct: 101 PKNHTLKDLQLSENPFIIILEAVEKPGNLGAILRTADAAQADAVIIC-DPATDLYNPNAI 159

Query: 179 SASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGK 238
            +S          + +  DAL  +     ++      + +  +    +   A+++G E  
Sbjct: 160 RSSVGCLFTVKTAVCSSRDALDFLRHKKIKSFAAELQASQWYQDTDFSIPSAIVMGTEAD 219

Query: 239 GLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
           GL       A +   + M G I +LNVS + AV  +      
Sbjct: 220 GLTDFWLTNADARIKIPMRGKIDSLNVSVSTAVLTFEAMRQR 261


>gi|323702099|ref|ZP_08113767.1| tRNA/rRNA methyltransferase (SpoU) [Desulfotomaculum nigrificans
           DSM 574]
 gi|323532981|gb|EGB22852.1| tRNA/rRNA methyltransferase (SpoU) [Desulfotomaculum nigrificans
           DSM 574]
          Length = 264

 Score =  133 bits (335), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 56/259 (21%), Positives = 103/259 (39%), Gaps = 4/259 (1%)

Query: 26  NHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRK---IFQLLATKNALARLD 82
            +   K ++   Q++    +   L + GV  V  AL +  R    ++   A +N      
Sbjct: 7   QNPKIKYIRRLAQRN-FREKERKLVVEGVRLVEEALQSGWRTESFVYTYEAVQNERGSRL 65

Query: 83  WDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDHVN 142
            +           V    + ++   E     LA+   P             L++V+D V 
Sbjct: 66  LELAQRKCAQTYQVTAHIMSQLSDTETPQGVLAVLWQPDYVLADVLPGQPPLVVVVDGVQ 125

Query: 143 DPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKM 202
           DP N+G I+RSA A    G++  K      +    ++  G+L H+P ++  ++  AL  +
Sbjct: 126 DPGNLGTIVRSADAAGASGVLLLKGTVDIYNPKTIRATMGSLFHLPVVKAEDVDGALAYL 185

Query: 203 HSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKA 262
            S G   I       +P+ +      +A+++G EG G R           ++ MPG  ++
Sbjct: 186 ASAGVTLIVGDPVLGEPIFKANLKVPVAIMVGNEGAGPRADLDRFKHVKVNIPMPGRAES 245

Query: 263 LNVSNAAAVALYITQNHFA 281
           LNV+ A ++ LY       
Sbjct: 246 LNVAMATSIMLYEAVRQRT 264


>gi|332878309|ref|ZP_08446035.1| RNA methyltransferase, TrmH family [Capnocytophaga sp. oral taxon
           329 str. F0087]
 gi|332683760|gb|EGJ56631.1| RNA methyltransferase, TrmH family [Capnocytophaga sp. oral taxon
           329 str. F0087]
          Length = 269

 Score =  133 bits (335), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 56/283 (19%), Positives = 107/283 (37%), Gaps = 22/283 (7%)

Query: 1   MNLISKKKSEKIFSLKDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAA 60
           M  IS  +                  +   KK+ + ++K+R   +     + G   V  A
Sbjct: 1   MKEISSTQ------------------NPLIKKIFALSEKARMRKKEGLCVIEGAREVRLA 42

Query: 61  LNNPSRKIFQLLATKNALARLDWDANLP---HPFPVKTVPPQTIDKIVGKEAVHQGLALE 117
           +      I  LL              L     P  V  +  +  +++  + +    +A+ 
Sbjct: 43  IQ-GGYDIETLLFQPEIFKEEALQQLLALYRKPIEVIRLSKEVYERLSYRSSTEGLIAVA 101

Query: 118 TAPLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLA 177
             P  +    A+R   +L+V +    P NIGA+LR+A A + +G+I     +   +  + 
Sbjct: 102 KTPPHTLEALALRERSILLVAEAPEKPGNIGAMLRTADAANIEGVIIANPKTDLYNPNII 161

Query: 178 KSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEG 237
           +++ G +  +P    S                    S SK   E        A+++G E 
Sbjct: 162 RASVGCVFTVPIAVGSTTEVIDYLKKKDFNIYCAALSASKPYYEVPFAEKNTAIVVGTED 221

Query: 238 KGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
           +GL  +  + +T    + M G+I ++NVS AAAV ++  +   
Sbjct: 222 EGLTQEWLKNSTQNIIIPMEGVIDSMNVSVAAAVLIFEAKKMR 264


>gi|322374580|ref|ZP_08049094.1| RNA methyltransferase, TrmH family, group 3 [Streptococcus sp.
           C300]
 gi|321280080|gb|EFX57119.1| RNA methyltransferase, TrmH family, group 3 [Streptococcus sp.
           C300]
          Length = 253

 Score =  133 bits (335), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 74/240 (30%), Positives = 121/240 (50%), Gaps = 9/240 (3%)

Query: 48  NLFLYGVHTVSAAL-NNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVG 106
           N  +YGVH V+ AL  N   K++     +        +        +     +++ ++  
Sbjct: 15  NDIVYGVHAVTEALLANTGNKLYLQEDLRGKNVEKVKELATEKKVSISWTSKKSLSEMT- 73

Query: 107 KEAVHQGLALETAPLLSPTLDA------VRNSQLLMVLDHVNDPHNIGAILRSAVAFSCD 160
           + AVHQG  L  +      LD          + LL++LD + DPHN+G+ILR+A A +  
Sbjct: 74  EGAVHQGFVLRVSEFAYSELDHILAKTRQEENPLLLILDGLTDPHNLGSILRTADATNVS 133

Query: 161 GIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPL 220
           G+I  K  +   + V+AK+A+GA+EH+P  R++NL+  L K+   GF T G   +     
Sbjct: 134 GVIIPKHRAVGVTPVVAKTATGAIEHVPIARVTNLSQTLDKLKDQGFWTFGTDMNGTPCH 193

Query: 221 EQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
           +   K  KIALI+G EGKG+    ++    M  + M G +++LN S AAA+ +Y    + 
Sbjct: 194 KWNTK-GKIALIIGNEGKGISSNIKKQVDEMITIPMNGHVQSLNASVAAAILMYEVFRNR 252


>gi|225376828|ref|ZP_03754049.1| hypothetical protein ROSEINA2194_02470 [Roseburia inulinivorans DSM
           16841]
 gi|225211324|gb|EEG93678.1| hypothetical protein ROSEINA2194_02470 [Roseburia inulinivorans DSM
           16841]
          Length = 284

 Score =  133 bits (335), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 43/255 (16%), Positives = 100/255 (39%), Gaps = 6/255 (2%)

Query: 26  NHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDA 85
           +++  K +    +K++  ++ E   + G          P   + Q+  +++  A  D   
Sbjct: 18  SNQQMKNLMLLMKKAKARNEQELFVVEGRKMFQEV---PEEWLKQVYVSESFFAENDKML 74

Query: 86  NLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDHVNDPH 145
                +  + V       +   +     L L   P              L++L+ + DP 
Sbjct: 75  A---GYTYEIVSDSVFKAVSDTQTPQGILCLVRKPQYRLEELLKGADTHLLILESIQDPG 131

Query: 146 NIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSW 205
           N+G +LR+       G++         +    +S  G++  +P+    +L + + ++ + 
Sbjct: 132 NLGTMLRTGEGAGISGVVMNHTTVDLFNPKTIRSTMGSIYRMPFFVTRDLAETICELKNA 191

Query: 206 GFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNV 265
           G +T       K   ++       A ++G EG GL  +T + A +   + M G +++LN 
Sbjct: 192 GVKTYAAHLKGKMQYDEPDYTGATAFMIGNEGNGLSDETADLADTYIKIPMCGQVESLNA 251

Query: 266 SNAAAVALYITQNHF 280
           + +A++ +Y T    
Sbjct: 252 AISASLLMYETNRQR 266


>gi|299067280|emb|CBJ38477.1| tRNA guanosine-2'-O-methyltransferase [Ralstonia solanacearum
           CMR15]
          Length = 249

 Score =  133 bits (335), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 76/239 (31%), Positives = 118/239 (49%), Gaps = 7/239 (2%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLATKNALARLDWD---ANLPHPFPVKTVPPQTIDKIVG 106
            L G H V+A L + +R I ++    N   R   D   A       +     + +  I G
Sbjct: 6   LLIGFHAVTARLRHDARSIDEIYFEANRRDRRMQDFLKAAEAAGVRMIPADNERLRGIAG 65

Query: 107 KEAVHQGLALETAP----LLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGI 162
            +     +A   A      L   LD +    LL+VLD V DPHN+GA LR A A     +
Sbjct: 66  TDRHQGVVAKAEALSLALNLDELLDGIEGPPLLLVLDGVTDPHNLGACLRVADAAGAHAV 125

Query: 163 ITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQ 222
           I  K  S   +  +AK ASGA E +PYI ++NL   L+++   G   IG + ++++ L +
Sbjct: 126 IAPKDRSVGINTTVAKVASGAAETVPYITVTNLARTLRELQQRGVWVIGTADEAEQDLYR 185

Query: 223 EIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHFA 281
                 IAL++GAEG+G+R  T+ET  ++  + M G +++LNVS A+ V L+      +
Sbjct: 186 ADFKGPIALVMGAEGEGMRRLTRETCDALVSIPMAGSVESLNVSVASGVCLFEAVRQRS 244


>gi|283795501|ref|ZP_06344654.1| RNA methyltransferase, TrmH family [Clostridium sp. M62/1]
 gi|291077166|gb|EFE14530.1| RNA methyltransferase, TrmH family [Clostridium sp. M62/1]
          Length = 278

 Score =  133 bits (335), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 49/267 (18%), Positives = 110/267 (41%), Gaps = 15/267 (5%)

Query: 26  NHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDA 85
           ++   K++ +  +K++   +     + G    S     P  ++ +   T++ L +   +A
Sbjct: 6   SNSQVKQVSAIAKKAKARRESGLFIVEGEKMFSEL---PKERLHRTYVTESFLRQQGEEA 62

Query: 86  -NLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLS-----------PTLDAVRNSQ 133
             L      +TV  + +  +   +     LAL                        +   
Sbjct: 63  DRLLAGCRYETVTGEVMKAMADTQTPQGILALCRQFSYELSDILGERKEGDEHTQEKAPA 122

Query: 134 LLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRIS 193
            L++L+ + DP N+G ILR+       G+I     +   +  + +S  G++  +P++ + 
Sbjct: 123 QLVILETLQDPGNLGTILRAGEGAGITGVIMNSTTADIYNPKVIRSTMGSVYRVPFVYVE 182

Query: 194 NLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAH 253
           +L DA++++   G +        +K  +Q+        ++G E  GL  +T E A +   
Sbjct: 183 DLADAVRRVKQAGVRLYAAHLKGEKNYDQQDYTGSTGFLIGNEANGLSDETAELADAYIK 242

Query: 254 LHMPGIIKALNVSNAAAVALYITQNHF 280
           + M G +++LN + AA++ +Y T    
Sbjct: 243 IPMLGKVESLNAAVAASILMYETARQR 269


>gi|186685767|ref|YP_001868963.1| tRNA/rRNA methyltransferase (SpoU) [Nostoc punctiforme PCC 73102]
 gi|186468219|gb|ACC84020.1| tRNA/rRNA methyltransferase (SpoU) [Nostoc punctiforme PCC 73102]
          Length = 258

 Score =  133 bits (335), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 45/258 (17%), Positives = 95/258 (36%), Gaps = 7/258 (2%)

Query: 26  NHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNAL--ARLDW 83
            +   K+++  +  ++   + +   L G H +  A       +  +  T +        W
Sbjct: 6   QNSLVKQIRKLH-STKERHKQQLFLLEGTHLLEEACAVNY-PLETVCCTSDWQAAHSSLW 63

Query: 84  DANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDHVND 143
           +         + V  + ++ I         +A          L     + L++ L+ V D
Sbjct: 64  EKASSKSDRTEIVSEEVLNAIATTVQPDGVVATAKRTDSQTQL---PFTGLVLALETVQD 120

Query: 144 PHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMH 203
           P N+G I+R+A A    G+  +      +S  + ++++G    +      NL   +Q+  
Sbjct: 121 PGNLGTIIRTAAAVGASGLWVSGDSVDLDSPKVLRASAGQWFRLAMSVTENLKATVQQSQ 180

Query: 204 SWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKAL 263
             G Q +     +              ++LG EG GL       A     + +   +++L
Sbjct: 181 QAGMQVVATLPSATLTYWDVDWRKPSLILLGNEGAGLSADLAAIADKQVRIPLSPGVESL 240

Query: 264 NVSNAAAVALYITQNHFA 281
           NV+ AAA+ LY  +   +
Sbjct: 241 NVAIAAALMLYEARRQMS 258


>gi|149007272|ref|ZP_01830930.1| pyridoxine biosynthesis protein [Streptococcus pneumoniae
           SP18-BS74]
 gi|307126973|ref|YP_003879004.1| RNA methyltransferase, TrmH family, group 3 [Streptococcus
           pneumoniae 670-6B]
 gi|147761076|gb|EDK68044.1| pyridoxine biosynthesis protein [Streptococcus pneumoniae
           SP18-BS74]
 gi|306484035|gb|ADM90904.1| RNA methyltransferase, TrmH family, group 3 [Streptococcus
           pneumoniae 670-6B]
          Length = 242

 Score =  133 bits (335), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 74/240 (30%), Positives = 120/240 (50%), Gaps = 9/240 (3%)

Query: 48  NLFLYGVHTVSAAL-NNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVG 106
           N  +YGVH V+ AL  N   K++     +        +        +     +++ ++  
Sbjct: 4   NDIVYGVHAVTEALLANTGNKLYLQEDLRGKNVEKVKELATEKKVSISWTSKKSLSEMT- 62

Query: 107 KEAVHQGLALETAPLLSPTLDA------VRNSQLLMVLDHVNDPHNIGAILRSAVAFSCD 160
           + AVHQG  L  +      LD          + LL++LD + DPHN+G+ILR+A A +  
Sbjct: 63  EGAVHQGFVLRVSEFAYSELDYILAKTRQEENPLLLILDGLTDPHNLGSILRTADATNVS 122

Query: 161 GIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPL 220
           G+I  K  +   + V+AK+A+GA+EH+P  R++NL   L K+   GF T G   +     
Sbjct: 123 GVIIPKHRAVGVTPVVAKTATGAIEHVPIARVTNLNQTLYKLKDEGFWTFGTDMNGTPCH 182

Query: 221 EQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
           +   K  KIALI+G EGKG+    ++    M  + M G +++LN S AAA+ +Y    + 
Sbjct: 183 KWNTK-GKIALIIGNEGKGISSNIKKQVDEMITIPMNGHVQSLNASVAAAILMYEVFRNR 241


>gi|157147848|ref|YP_001455167.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Citrobacter koseri
           ATCC BAA-895]
 gi|157085053|gb|ABV14731.1| hypothetical protein CKO_03652 [Citrobacter koseri ATCC BAA-895]
          Length = 243

 Score =  133 bits (335), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 69/243 (28%), Positives = 113/243 (46%), Gaps = 10/243 (4%)

Query: 48  NLFLYGVHTVSAALNNPSRK---IFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKI 104
           +  +YG+H V A L     +   +F L   ++        A       ++    Q +D+ 
Sbjct: 2   SEMIYGIHAVQALLERAPERFQDVFILKGREDKRLLPLIHALEAQGVVIQLANRQYLDEK 61

Query: 105 VGKEAVHQGLALETAPLLSP------TLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFS 158
             + AVHQG+     P           L A  ++  L++LD V DPHN+GA LRSA A  
Sbjct: 62  S-EGAVHQGIIARVKPGRQYQENDLPDLIAKFDNPFLLILDGVTDPHNLGACLRSADAAG 120

Query: 159 CDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKK 218
              +I  K  S   +A   K A GA E +P IR++NL   ++ +       +G + ++  
Sbjct: 121 VHAVIVPKDRSAQLNATAKKVACGAAESVPLIRVTNLARTMRLLQEENIWIVGTAGEADH 180

Query: 219 PLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQN 278
            L Q     ++AL++GAEG+G+R  T+E    +  + M G + +LNVS A  + L+    
Sbjct: 181 TLFQSKMTGRMALVMGAEGEGMRRLTREHCDELISIPMAGSVSSLNVSVATGICLFEAVR 240

Query: 279 HFA 281
             +
Sbjct: 241 QRS 243


>gi|315274658|ref|ZP_07869498.1| RNA methyltransferase, TrmH family, group 3 [Listeria marthii FSL
           S4-120]
 gi|313615715|gb|EFR89003.1| RNA methyltransferase, TrmH family, group 3 [Listeria marthii FSL
           S4-120]
          Length = 251

 Score =  133 bits (335), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 63/248 (25%), Positives = 116/248 (46%), Gaps = 13/248 (5%)

Query: 43  TSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALA---RLDWDANLPHPFPVKTVPPQ 99
             + E  ++ G + V   L +  R I ++   + +     +            V+ VP Q
Sbjct: 2   EQENEQEWIGGRNPVLEVLRSD-RDIHKIYVQEGSQKGVLKQVLALAKERKIQVQFVPKQ 60

Query: 100 TIDKIVGKEAVHQGLALETAPLLSPTLDA-------VRNSQLLMVLDHVNDPHNIGAILR 152
            I+K+V     HQG+A + A      LD               ++LD + DPHN+G+I+R
Sbjct: 61  KIEKVVS--GAHQGVAAQVAAYQYAELDDLFAAAEAKDEMPFFIILDELEDPHNLGSIMR 118

Query: 153 SAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGL 212
           +A +    GII  KR S   +  +AK+++GA+E++P +R++N+   ++++   G    G 
Sbjct: 119 TADSVGAHGIIIPKRRSVGLTQTVAKASTGAMEYVPVVRVTNMVRTMEELQKRGLWIFGT 178

Query: 213 SSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVA 272
            +           +  +A+++G+EG G+    +E    + HL M G + +LN S AA++ 
Sbjct: 179 DAKGSSDYRTMDVDMPLAIVIGSEGFGMSRLVREKCDFLVHLPMRGKVTSLNASVAASLL 238

Query: 273 LYITQNHF 280
           LY      
Sbjct: 239 LYEVYRKR 246


>gi|295098333|emb|CBK87423.1| 23S rRNA Gm-2251 2'-O-methyltransferase [Enterobacter cloacae
           subsp. cloacae NCTC 9394]
          Length = 243

 Score =  133 bits (335), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 61/241 (25%), Positives = 103/241 (42%), Gaps = 8/241 (3%)

Query: 48  NLFLYGVHTVSAALNNPSRKIFQLLATKNALARLD---WDANLPHPFPVKTVPPQTIDKI 104
           +  +YG+H V A L     +  ++   K    +       A       ++    Q +D+ 
Sbjct: 2   SEMIYGIHAVQALLERAPERFQEVFILKGREDKRLMPLIHALEAQGVVIQLANRQYLDEK 61

Query: 105 VGKEAVHQGLALETAPLLSPTLDAVR-----NSQLLMVLDHVNDPHNIGAILRSAVAFSC 159
                    +A           D         +   ++LD V DPHN+GA LRSA A   
Sbjct: 62  SEGAVHQGIIARVKPGRQYQENDLPDLIAGLENPFFLILDGVTDPHNLGACLRSADAAGV 121

Query: 160 DGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKP 219
             +I  K  S   +A   K A GA E++P IR++NL   ++ +       +G + ++   
Sbjct: 122 HAVIVPKDRSAQLNATAKKVACGAAENVPLIRVTNLARTMRLLQEENIWIVGTAGEADHT 181

Query: 220 LEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNH 279
           L Q     ++AL++GAEG+G+R  T+E    +  + M G + +LNVS A  + L+     
Sbjct: 182 LYQSKMTGRMALVMGAEGEGMRRLTREHCDELISIPMAGSVSSLNVSVATGICLFEAVRQ 241

Query: 280 F 280
            
Sbjct: 242 R 242


>gi|325661898|ref|ZP_08150519.1| RNA methyltransferase [Lachnospiraceae bacterium 4_1_37FAA]
 gi|325471876|gb|EGC75093.1| RNA methyltransferase [Lachnospiraceae bacterium 4_1_37FAA]
          Length = 251

 Score =  133 bits (335), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 57/239 (23%), Positives = 106/239 (44%), Gaps = 11/239 (4%)

Query: 51  LYGVHTVSAALNNPS--RKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKE 108
           + G + V  A  +     K+F L   ++   R        H   +  V  + +D++  + 
Sbjct: 14  IEGRNAVLEAFRSGKPVDKLFVLDGCQDGPVRTIVREAKKHDTILNFVSKERLDQLS-ET 72

Query: 109 AVHQGLALETAPLLSPTLDAV-------RNSQLLMVLDHVNDPHNIGAILRSAVAFSCDG 161
             HQG+    A      ++ +             ++LD++ DPHN+GAI+R+A      G
Sbjct: 73  GKHQGVIAHAAAYEYSEIEDMFALAEKRGEDPFFILLDNIEDPHNLGAIIRTANLAGAHG 132

Query: 162 IITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLE 221
           +I  KR +   +A +AK+++GAL + P  +++NL   ++++ + G   +      +    
Sbjct: 133 VIIPKRRAVGLTATVAKTSAGALNYTPVAKVTNLAKTMEELKARGLWFVCADMGGESMYR 192

Query: 222 QEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
                  I L++G EG+G+    +E    +A + M G I +LN S AA V  Y      
Sbjct: 193 MN-LTGPIGLVIGNEGEGVSRLVKEKCDFVASIPMKGDIDSLNASVAAGVLAYEIVRQR 250


>gi|70734080|ref|YP_257720.1| RNA methyltransferase [Pseudomonas fluorescens Pf-5]
 gi|68348379|gb|AAY95985.1| RNA methyltransferase, TrmH family, group 3 [Pseudomonas
           fluorescens Pf-5]
          Length = 254

 Score =  133 bits (335), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 73/240 (30%), Positives = 116/240 (48%), Gaps = 12/240 (5%)

Query: 51  LYGVHTVSAALNNPSRKIFQLLATKNA---LARLDWDANLPHPFPVKTVPPQTIDKIVGK 107
           +YGVH V A L +  +++ Q+   +       ++  D    +   V     + +D  V  
Sbjct: 7   IYGVHAVEALLRHHPKRVKQIWLAEGRSDPRVQVLVDLAAQNRVSVGQAERREMDAWV-- 64

Query: 108 EAVHQGLALETAPLLSP-------TLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCD 160
           E VHQG+  E +P            LD    + LL+VLD V DPHN+GA LR+A A    
Sbjct: 65  EGVHQGVVAEVSPSQVWGEAMLDELLDRTEGAPLLLVLDGVTDPHNLGACLRTADAAGAL 124

Query: 161 GIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPL 220
            ++  K  S + +  + K A GA E IP + ++NL   L+K+   G   +G + ++++ L
Sbjct: 125 AVLVPKDKSATLTPTVRKVACGAAEVIPLVAVTNLARTLEKLQQRGLWIVGTAGEAEQEL 184

Query: 221 EQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
             +       +I+GAEGKG+R  T+E    +  L M G + +LNVS A  V L+      
Sbjct: 185 YDQDLTGPTIIIMGAEGKGMRRLTREHCDYLVRLPMAGSVSSLNVSVATGVCLFEAMRQR 244


>gi|303228816|ref|ZP_07315630.1| RNA methyltransferase, TrmH family [Veillonella atypica
           ACS-134-V-Col7a]
 gi|302516528|gb|EFL58456.1| RNA methyltransferase, TrmH family [Veillonella atypica
           ACS-134-V-Col7a]
          Length = 264

 Score =  133 bits (335), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 58/273 (21%), Positives = 107/273 (39%), Gaps = 10/273 (3%)

Query: 8   KSEKIFSLKDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRK 67
           +S KI  ++        ++++  K + S  Q+ ++  +     + G+  V+         
Sbjct: 2   ESPKIDYIQ-------SKDNKTIKHIISLQQR-KYRQKFGEYTVEGIRAVTDIGK--KDF 51

Query: 68  IFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLD 127
           +  +L  ++  + L+             V    I   +      QG+       ++    
Sbjct: 52  LRSILIRESKRSELEPLVQKGFTVSSVYVVQDPIFDKIEHSVNGQGILGIAKKCVNDLHS 111

Query: 128 AVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHI 187
            +    L + LD V DP N+G I+R+AVA    GI   K      +    +S   AL +I
Sbjct: 112 LIVEDGLYVALDGVQDPGNLGTIIRTAVAAGAKGIFLLKGTVDPYNEKCVRSTMSALCNI 171

Query: 188 PYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQET 247
           P      L++    +     +T   S ++ KP        +  +ILG EG G+  +  E 
Sbjct: 172 PIFEDVTLSEFYDFIKDNTIKTYVTSLENAKPYHTISYPKRTMIILGNEGNGVSREIIEM 231

Query: 248 ATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
                 + M G I++LNVS AAA+ +Y  +   
Sbjct: 232 CDQAITIPMYGDIESLNVSIAAALCMYKVREQI 264


>gi|144900864|emb|CAM77728.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Magnetospirillum
           gryphiswaldense MSR-1]
          Length = 314

 Score =  133 bits (335), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 102/269 (37%), Positives = 153/269 (56%), Gaps = 16/269 (5%)

Query: 26  NHRDYKKMQSFNQKSRHTSQ------PENLFLYGVHTVSAALNNPSRKIFQLLATKNALA 79
           NHR+ +   +  +      +         L+LYG H V AAL N +RKI +++ T  AL 
Sbjct: 35  NHRESRHKSAPRRDPAKGGERPAKLPSNQLWLYGAHAVLAALANKARKIRRIVLTVEALR 94

Query: 80  RLDWDANLPHPFPV----KTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLD------AV 129
                             +T   Q +D+++   AVHQG+A+    L SP ++        
Sbjct: 95  SHAASIQRARALRPLPGEETTERQELDRLLPPGAVHQGIAVLAEHLESPGIEDIGRLAQN 154

Query: 130 RNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPY 189
           R+  ++MVLD V DPHN+GAILRSA AF    ++ T R+SP E+  LAKSASGALE +P 
Sbjct: 155 RDHAVVMVLDQVTDPHNVGAILRSAAAFGALAVVVTDRHSPEETGTLAKSASGALEVMPL 214

Query: 190 IRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETAT 249
           +R++N+  AL+++   GF T GL+ ++ + L Q   + KIAL++GAEG+GLR  T+E   
Sbjct: 215 VRVTNMVRALEQLKEAGFWTAGLAGEATQTLAQAKLSGKIALVMGAEGEGLRRLTREHCD 274

Query: 250 SMAHLHMPGIIKALNVSNAAAVALYITQN 278
            +  L M  ++++LNVSNAAA++LY    
Sbjct: 275 HLVKLPMSDLVESLNVSNAAAISLYELAR 303


>gi|17545948|ref|NP_519350.1| tRNA/rRNA methyltransferase [Ralstonia solanacearum GMI1000]
 gi|52783318|sp|Q8Y016|RLMB_RALSO RecName: Full=23S rRNA (guanosine-2'-O-)-methyltransferase RlmB;
           AltName: Full=23S rRNA Gm2251 2'-O-methyltransferase
 gi|17428243|emb|CAD14931.1| probable 23s rrna (guanosine-2'-o-)-methyltransferase rlmb (23srrna
           gm2251 2'-o-methyltransferase) protein [Ralstonia
           solanacearum GMI1000]
          Length = 249

 Score =  133 bits (335), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 76/239 (31%), Positives = 118/239 (49%), Gaps = 7/239 (2%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLATKNALARLDWD---ANLPHPFPVKTVPPQTIDKIVG 106
            L G H V+A L + +R I ++    N   R   D   A       +     + +  I G
Sbjct: 6   LLIGFHAVTARLRHDARSIDEIYFEANRRDRRMQDFLKAAEAAGVRMIPADNERLRGIAG 65

Query: 107 KEAVHQGLALETAP----LLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGI 162
            +     +A   A      L   LD +    LL+VLD V DPHN+GA LR A A     +
Sbjct: 66  TDRHQGVVAKAEALSLALNLDELLDGIEGPPLLLVLDGVTDPHNLGACLRVADAAGAHAV 125

Query: 163 ITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQ 222
           I  K  S   +  +AK ASGA E +PYI ++NL   L+++   G   IG + ++++ L +
Sbjct: 126 IAPKDRSVGINTTVAKVASGAAETVPYITVTNLARTLRELQQRGVWVIGTADEAEQDLYR 185

Query: 223 EIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHFA 281
                 IAL++GAEG+G+R  T+ET  ++  + M G +++LNVS A+ V L+      +
Sbjct: 186 ADFKGPIALVMGAEGEGMRRLTRETCDTLVSIPMAGSVESLNVSVASGVCLFEAVRQRS 244


>gi|238019168|ref|ZP_04599594.1| hypothetical protein VEIDISOL_01031 [Veillonella dispar ATCC 17748]
 gi|237863867|gb|EEP65157.1| hypothetical protein VEIDISOL_01031 [Veillonella dispar ATCC 17748]
          Length = 243

 Score =  133 bits (335), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 57/238 (23%), Positives = 110/238 (46%), Gaps = 8/238 (3%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLATKNALARLDWD--ANLPHPFPVKTVPPQTIDKIVGK 107
           ++ G + V  AL +       +++       L             V+  P + ++K    
Sbjct: 4   YIVGRNAVKEALKSGRSIQRIMVSEDKVKTGLADIVGLAKSQGIEVRPTPIKQMNKY-DL 62

Query: 108 EAVHQGLALETAPLLSPTL-----DAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGI 162
           E  HQG+    + +    L     +   +  LL++ D V DPHN+GAI+R+A       +
Sbjct: 63  EVPHQGVIALVSAVQFKELGEVLQETNHDVPLLILTDGVEDPHNMGAIIRTAECVGATAV 122

Query: 163 ITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQ 222
           +  KR++   +A +AK+++GA+E IP +++ N+   ++++   GF  +G   +  + L +
Sbjct: 123 LIPKRHNAPINATVAKTSAGAIEQIPLVQVGNVAQTIKQLQKQGFWVMGAHMEGDRTLYE 182

Query: 223 EIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
                   +++G EGKG+    +E    +  + M G + +LN S AAAV +Y      
Sbjct: 183 ADMTIPTVIVIGNEGKGISRVVKEACDFLVTIPMYGNLNSLNASVAAAVLMYEAVRQR 240


>gi|166031081|ref|ZP_02233910.1| hypothetical protein DORFOR_00763 [Dorea formicigenerans ATCC
           27755]
 gi|166028928|gb|EDR47685.1| hypothetical protein DORFOR_00763 [Dorea formicigenerans ATCC
           27755]
          Length = 252

 Score =  133 bits (334), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 59/248 (23%), Positives = 107/248 (43%), Gaps = 10/248 (4%)

Query: 42  HTSQPENL-FLYGVHTVSAALNNPS--RKIFQLLATKNALARLDWDANLPHPFPVKTVPP 98
           H  +  N   + G + V  A  +     K+F L   ++   R        H   V+ V  
Sbjct: 4   HKDKHGNENMIEGRNAVLEAFRSGKPVDKLFVLDGCQDGPVRTIVREAKKHDTLVQFVDK 63

Query: 99  QTIDKIVGKEAVHQGLALETAPLLSPTLDA------VRNSQLLMVLDHVNDPHNIGAILR 152
           + + ++         +A   A   +   D             L++LD + DPHN+GAI+R
Sbjct: 64  ERLTQLSQTGRHQGVIAYTAAYEYAQVEDMLALAKERGEDPFLILLDDIEDPHNLGAIIR 123

Query: 153 SAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGL 212
           +A      G+I  KR +   +A +AK+++GA+ + P  +++NLT  ++++   G   +  
Sbjct: 124 TANLAGAHGVIIPKRRAVGLTATVAKTSAGAINYTPVAKVTNLTKTMKELKEKGLWFVCA 183

Query: 213 SSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVA 272
                + + +      I L++G EG+G+    +ET   +A + M G I +LN S A  V 
Sbjct: 184 -DMGGESMYKLNLTGPIGLVIGNEGEGVSRLVKETCDFVASIPMKGDIDSLNASVATGVL 242

Query: 273 LYITQNHF 280
            Y      
Sbjct: 243 AYEIVRQR 250


>gi|327472394|gb|EGF17825.1| 23S rRNA (guanosine-2'-O-)-methyltransferase RlmB [Streptococcus
           sanguinis SK408]
          Length = 242

 Score =  133 bits (334), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 72/242 (29%), Positives = 118/242 (48%), Gaps = 9/242 (3%)

Query: 46  PENLFLYGVHTVSAALNNP-SRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKI 104
            +N  +YGVH V+ AL      K++     +        D        +   P +T+ ++
Sbjct: 2   EKNDIVYGVHAVTEALAANTGNKLYIQDDLRGKKVDKIKDLAAEKKVSISWTPKKTLQEM 61

Query: 105 VGKEAVHQGLALETAPLLSPTLD------AVRNSQLLMVLDHVNDPHNIGAILRSAVAFS 158
               AVHQG  L  A       +         ++ LL++LD + DPHN+G+ILR+A A +
Sbjct: 62  TD-GAVHQGFVLRVAEFAYTDFEALLKKAEQEDNPLLLILDGLTDPHNLGSILRTADATN 120

Query: 159 CDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKK 218
             G+I  K  +   + V+AK+++GA+EHIP  R++NL+  L K+   GF   G       
Sbjct: 121 VAGVIIPKHRAVGVTPVVAKTSTGAVEHIPIARVTNLSQTLDKLKEAGFWIFGTDMQGTP 180

Query: 219 PLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQN 278
             +      K+ALI+G EGKG+    ++    M  + M G +++LN S AAA+ +Y    
Sbjct: 181 SHKWNT-TGKLALIIGNEGKGISSNIKKQVDEMISIPMNGHVQSLNASVAAAILMYEVFR 239

Query: 279 HF 280
           + 
Sbjct: 240 NR 241


>gi|47094582|ref|ZP_00232234.1| RNA methyltransferase, TrmH family, group 3 [Listeria monocytogenes
           str. 4b H7858]
 gi|254853492|ref|ZP_05242840.1| RNA methyltransferase [Listeria monocytogenes FSL R2-503]
 gi|300764634|ref|ZP_07074626.1| hypothetical protein LMHG_11120 [Listeria monocytogenes FSL N1-017]
 gi|47017042|gb|EAL07923.1| RNA methyltransferase, TrmH family, group 3 [Listeria monocytogenes
           str. 4b H7858]
 gi|258606864|gb|EEW19472.1| RNA methyltransferase [Listeria monocytogenes FSL R2-503]
 gi|300514741|gb|EFK41796.1| hypothetical protein LMHG_11120 [Listeria monocytogenes FSL N1-017]
          Length = 251

 Score =  133 bits (334), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 64/248 (25%), Positives = 117/248 (47%), Gaps = 13/248 (5%)

Query: 43  TSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWD---ANLPHPFPVKTVPPQ 99
             + E  ++ G + V   L +  R I ++   + +   +              V+ VP Q
Sbjct: 2   EQENEQEWIGGRNPVLEVLRSD-RDIHKIYVQEGSQKGVLKQVLTLAKERKIQVQFVPKQ 60

Query: 100 TIDKIVGKEAVHQGLALETAPLLSPTLDA-------VRNSQLLMVLDHVNDPHNIGAILR 152
            I+K+VG    HQG+A + A      LD               ++LD + DPHN+G+I+R
Sbjct: 61  KIEKVVG--GAHQGVAAQVAAYQYAELDDLFAAAEAKDEMPFFIILDELEDPHNLGSIMR 118

Query: 153 SAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGL 212
           +A +    GII  KR S   +  +AK+++GA+E++P +R++N+   ++++   G    G 
Sbjct: 119 TADSVGAHGIIIPKRRSVGLTQTVAKASTGAMEYVPVVRVTNMVRTMEELQKRGLWIFGT 178

Query: 213 SSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVA 272
            +           +  +A+++G+EG G+    +E    + HL M G + +LN S AA++ 
Sbjct: 179 DAKGSSDYRTMDVDMPLAIVIGSEGFGMSRLVREKCDFLVHLPMRGKVTSLNASVAASLL 238

Query: 273 LYITQNHF 280
           LY      
Sbjct: 239 LYEVYRKR 246


>gi|317121670|ref|YP_004101673.1| tRNA/rRNA methyltransferase (SpoU) [Thermaerobacter marianensis DSM
           12885]
 gi|315591650|gb|ADU50946.1| tRNA/rRNA methyltransferase (SpoU) [Thermaerobacter marianensis DSM
           12885]
          Length = 273

 Score =  133 bits (334), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 48/265 (18%), Positives = 90/265 (33%), Gaps = 10/265 (3%)

Query: 24  RRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPS---RKIFQLLATKNALAR 80
              +   K+++   ++ RH  Q     + G   V  AL       + I+           
Sbjct: 5   SPQNPRIKRLRKLQER-RHRRQLGATLVEGRRFVEEALAAGRPVRQAIYTAAFAAAPAGA 63

Query: 81  LDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLL------SPTLDAVRNSQL 134
               A       +  V  + ++ +   E     +A                  A     L
Sbjct: 64  ALLRALAAAGTELAEVTDRLLEAVAMTETPQGIVAEVAVDEPAPVGPAWWRQVAEGRLPL 123

Query: 135 LMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISN 194
            ++ D V DP N+G ++R+A      G +              ++++GA   +P  R  +
Sbjct: 124 ALLPDGVQDPGNLGTLVRAAAGLGAAGAVLVPGTVDPFHPRAVRASAGACLRLPMARADS 183

Query: 195 LTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHL 254
              A +   + G       +++  P           L++G EG G+ P+ Q  AT    +
Sbjct: 184 AAGAAESARAAGLAVWVAEAEAATPCWAVDWRRPCLLVVGNEGAGVSPEVQRYATGRVAI 243

Query: 255 HMPGIIKALNVSNAAAVALYITQNH 279
            + G I +LNV+ A  + LY     
Sbjct: 244 PLAGGIGSLNVAMAGCILLYEAARQ 268


>gi|320173666|gb|EFW48856.1| 23S rRNA guanosine-2'-O--methyltransferase [Shigella dysenteriae
           CDC 74-1112]
          Length = 243

 Score =  133 bits (334), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 61/242 (25%), Positives = 103/242 (42%), Gaps = 8/242 (3%)

Query: 48  NLFLYGVHTVSAALNNPSRKIFQLLATKNALARLD---WDANLPHPFPVKTVPPQTIDKI 104
           +  +YG+H V A L     +  ++   K    +       A       ++    Q +D+ 
Sbjct: 2   SEMIYGIHAVQALLERAPERFQEVFILKGREDKRLLPLIHALEAQGVVIQLANRQYLDEK 61

Query: 105 VGKEAVHQGLALETAPLLSPTLDAVR-----NSQLLMVLDHVNDPHNIGAILRSAVAFSC 159
                    +A           D        +   L++LD V DPHN+GA LRSA A   
Sbjct: 62  SDGAVHQGIIARVKPGRQYQENDLPDLIASLDQPFLLILDGVTDPHNLGACLRSADAAGV 121

Query: 160 DGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKP 219
             +I  K  S   +A   K A GA E +P IR++NL   ++ +       +G + ++   
Sbjct: 122 HAVIVPKDRSAQLNATAKKVACGAAESVPLIRVTNLVRTMRMLQEENIWIVGTAGEADHT 181

Query: 220 LEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNH 279
           L Q     ++AL++GAEG+G+R  T+     +  + M G + +LNVS A  + L+     
Sbjct: 182 LYQSKMTGRLALVMGAEGEGMRRLTRVHCDELISIPMAGSVSSLNVSVATGICLFEAVRQ 241

Query: 280 FA 281
            +
Sbjct: 242 RS 243


>gi|325685815|gb|EGD27887.1| TrmH family RNA methyltransferase [Lactobacillus delbrueckii subsp.
           lactis DSM 20072]
          Length = 254

 Score =  133 bits (334), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 53/256 (20%), Positives = 97/256 (37%), Gaps = 5/256 (1%)

Query: 21  AKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALAR 80
            +   N+   K +    QK ++  +     + G H V  AL   S K  ++LAT+ AL+R
Sbjct: 3   ERTSVNNPQIKAIGKLQQK-KYREESGYYLIEGFHLVEEALKA-SVKYREILATEAALSR 60

Query: 81  LDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDH 140
           L           +  +       +   +                   +     LL   D 
Sbjct: 61  LAQLGLAYDEGKLIKISQSVASHLSSTKNSQDIFMTVKINQSEHFFFSYGKWVLL---DD 117

Query: 141 VNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQ 200
           + DP N+G I+R+A A   DG+I + +     +  + +S  G+  H+  I+         
Sbjct: 118 LADPGNVGTIIRTADAAGFDGVILSNKTVDLYNPKVQRSMQGSQFHLNLIKADLPDAIAS 177

Query: 201 KMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGII 260
              +       L   + K L       ++ALI+G E  G+ P+    A    ++ + G  
Sbjct: 178 LKAADIPVYASLLDPAAKQLGDFAPVAQVALIIGNEAHGVSPEIAALADEKLYIPIKGRA 237

Query: 261 KALNVSNAAAVALYIT 276
           ++LN + AA + +Y  
Sbjct: 238 ESLNAAVAAGIMIYHF 253


>gi|313893275|ref|ZP_07826850.1| RNA methyltransferase, TrmH family, group 3 [Veillonella sp. oral
           taxon 158 str. F0412]
 gi|313442171|gb|EFR60588.1| RNA methyltransferase, TrmH family, group 3 [Veillonella sp. oral
           taxon 158 str. F0412]
          Length = 243

 Score =  133 bits (334), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 57/238 (23%), Positives = 109/238 (45%), Gaps = 8/238 (3%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLATKNALARLDWD--ANLPHPFPVKTVPPQTIDKIVGK 107
           ++ G + V  AL +       +++       L             V+  P + ++K    
Sbjct: 4   YIVGRNAVKEALRSGRSIQRIMVSEDKVKTGLADIVGLAKSQGIEVRPTPIKQMNKY-DL 62

Query: 108 EAVHQGLALETAPLLSPTL-----DAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGI 162
           E  HQG+    + +    L     +      LL++ D V DPHN+GAI+R+A       +
Sbjct: 63  EVPHQGVIALVSAVQFKELGEVLQETNHEVPLLILTDGVEDPHNMGAIIRTAECVGATAV 122

Query: 163 ITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQ 222
           +  KR++   +A +AK+++GA+E IP +++ N+   ++++   GF  +G   +  + L +
Sbjct: 123 LIPKRHNAPINATVAKTSAGAIEQIPLVQVGNVAQTIKQLQKQGFWVMGAHMEGDRTLYE 182

Query: 223 EIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
                   +++G EGKG+    +E    +  + M G + +LN S AAAV +Y      
Sbjct: 183 ADMTIPTVIVIGNEGKGISRVVKEACDFLVTIPMYGNLNSLNASVAAAVLMYEAVRQR 240


>gi|237718363|ref|ZP_04548844.1| tRNA/rRNA methyltransferase [Bacteroides sp. 2_2_4]
 gi|229452296|gb|EEO58087.1| tRNA/rRNA methyltransferase [Bacteroides sp. 2_2_4]
          Length = 247

 Score =  133 bits (334), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 61/245 (24%), Positives = 103/245 (42%), Gaps = 13/245 (5%)

Query: 47  ENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHP---FPVKTVPPQTIDK 103
           ++  ++GV  V  AL      I ++L  K+  + L  +          PV+ VP + I++
Sbjct: 4   KSEMIFGVRAVIEALQAGKE-IDKILVKKDIQSDLSKELFAALKGTLIPVQRVPVERINR 62

Query: 104 IVGKEAVHQGLALETAPLLSP-------TLDAVRNSQLLMVLDHVNDPHNIGAILRSAVA 156
           I      HQG+    + +           L     +   ++LD V D  N GAI R+   
Sbjct: 63  IT--RKNHQGVIAFISSVTYQKAEDLVPFLFEQGKNPFFVMLDGVTDVRNFGAIARTCEC 120

Query: 157 FSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDS 216
            + D +I   R S S +A   K+++GAL  +P  R  NL   LQ +   GF+ +  +   
Sbjct: 121 AAVDAVIIPVRGSVSVNADAVKTSAGALHTLPVCREQNLRSTLQYLKDSGFRIVAATEKG 180

Query: 217 KKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYIT 276
                +      + +I+GAE  G+  +          + M G I++LNVS AA + +Y  
Sbjct: 181 DYDYTKADYTGPLCIIMGAEDTGVSYENLALCDEWVKIPMLGTIESLNVSVAAGILIYEA 240

Query: 277 QNHFA 281
                
Sbjct: 241 VKQRN 245


>gi|251799664|ref|YP_003014395.1| RNA methyltransferase, TrmH family, group 3 [Paenibacillus sp.
           JDR-2]
 gi|247547290|gb|ACT04309.1| RNA methyltransferase, TrmH family, group 3 [Paenibacillus sp.
           JDR-2]
          Length = 251

 Score =  133 bits (334), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 63/244 (25%), Positives = 110/244 (45%), Gaps = 10/244 (4%)

Query: 46  PENLFLYGVHTVSAALNNPSRKIFQLLATKNALARL---DWDANLPHPFPVKTVPPQTID 102
            +   + G H V  AL +  R I ++   + A   L          H   V+ V  + +D
Sbjct: 6   NQEEMIAGKHPVMEALRSG-RDINKIWIAEGAQKSLTQPIVAEAKQHGVIVQFVDKRKLD 64

Query: 103 KIVGKEAVHQGLALETAPLLSPTLD------AVRNSQLLMVLDHVNDPHNIGAILRSAVA 156
            +V        +A   A   +   D       +  +  L++LD + DPHN+G+ILR+A  
Sbjct: 65  TMVEGVQHQGVVAQAAAFAYAEIEDLLARARELNETPFLLILDEIEDPHNLGSILRTAEC 124

Query: 157 FSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDS 216
               G+I  KR S   +A + K+++GA EH+P  R++NL   + ++   G    G    +
Sbjct: 125 TGVHGVIIPKRRSVGLTATVLKTSAGAAEHVPVARVTNLAQTIDRLKEEGVWVAGTDVSA 184

Query: 217 KKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYIT 276
            + + +   +  +A+++G EGKG+    +E    +  L M G + +LN S AA V +Y  
Sbjct: 185 PQDVYKTKFDLPLAIVIGNEGKGMGRLIKEKCDFLVKLPMHGRLNSLNASVAAGVLMYEV 244

Query: 277 QNHF 280
               
Sbjct: 245 VRQR 248


>gi|22124552|ref|NP_667975.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Yersinia pestis KIM
           10]
 gi|45440391|ref|NP_991930.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Yersinia pestis
           biovar Microtus str. 91001]
 gi|51594785|ref|YP_068976.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Yersinia
           pseudotuberculosis IP 32953]
 gi|108809893|ref|YP_653809.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Yersinia pestis
           Antiqua]
 gi|108813450|ref|YP_649217.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Yersinia pestis
           Nepal516]
 gi|145600840|ref|YP_001164916.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Yersinia pestis
           Pestoides F]
 gi|150260575|ref|ZP_01917303.1| putative methylase [Yersinia pestis CA88-4125]
 gi|153949503|ref|YP_001402598.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Yersinia
           pseudotuberculosis IP 31758]
 gi|162419936|ref|YP_001605270.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Yersinia pestis
           Angola]
 gi|165926787|ref|ZP_02222619.1| RNA methyltransferase, TrmH family, group 3 [Yersinia pestis biovar
           Orientalis str. F1991016]
 gi|165936560|ref|ZP_02225128.1| RNA methyltransferase, TrmH family, group 3 [Yersinia pestis biovar
           Orientalis str. IP275]
 gi|166011869|ref|ZP_02232767.1| RNA methyltransferase, TrmH family, group 3 [Yersinia pestis biovar
           Antiqua str. E1979001]
 gi|166213970|ref|ZP_02240005.1| RNA methyltransferase, TrmH family, group 3 [Yersinia pestis biovar
           Antiqua str. B42003004]
 gi|167400679|ref|ZP_02306188.1| RNA methyltransferase, TrmH family, group 3 [Yersinia pestis biovar
           Antiqua str. UG05-0454]
 gi|167419264|ref|ZP_02311017.1| RNA methyltransferase, TrmH family, group 3 [Yersinia pestis biovar
           Orientalis str. MG05-1020]
 gi|167423260|ref|ZP_02315013.1| RNA methyltransferase, TrmH family, group 3 [Yersinia pestis biovar
           Mediaevalis str. K1973002]
 gi|167467834|ref|ZP_02332538.1| RNA methyltransferase, TrmH family, group 3 [Yersinia pestis FV-1]
 gi|170026005|ref|YP_001722510.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Yersinia
           pseudotuberculosis YPIII]
 gi|186893793|ref|YP_001870905.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Yersinia
           pseudotuberculosis PB1/+]
 gi|218927584|ref|YP_002345459.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Yersinia pestis CO92]
 gi|229836642|ref|ZP_04456808.1| 23S rRNA (Gm2251)-methyltransferase [Yersinia pestis Pestoides A]
 gi|229840254|ref|ZP_04460413.1| 23S rRNA (Gm2251)-methyltransferase [Yersinia pestis biovar
           Orientalis str. PEXU2]
 gi|229842332|ref|ZP_04462487.1| 23S rRNA (Gm2251)-methyltransferase [Yersinia pestis biovar
           Orientalis str. India 195]
 gi|229903929|ref|ZP_04519042.1| 23S rRNA (Gm2251)-methyltransferase [Yersinia pestis Nepal516]
 gi|270489084|ref|ZP_06206158.1| RNA methyltransferase, TrmH family, group 3 [Yersinia pestis KIM
           D27]
 gi|294502489|ref|YP_003566551.1| putative methylase [Yersinia pestis Z176003]
 gi|52783320|sp|Q8ZIV4|RLMB_YERPE RecName: Full=23S rRNA (guanosine-2'-O-)-methyltransferase RlmB;
           AltName: Full=23S rRNA Gm2251 2'-O-methyltransferase
 gi|21957351|gb|AAM84226.1|AE013666_6 hypothetical protein y0638 [Yersinia pestis KIM 10]
 gi|45435247|gb|AAS60807.1| putative methylase [Yersinia pestis biovar Microtus str. 91001]
 gi|51588067|emb|CAH19673.1| putative methylase [Yersinia pseudotuberculosis IP 32953]
 gi|108777098|gb|ABG19617.1| methylase [Yersinia pestis Nepal516]
 gi|108781806|gb|ABG15864.1| putative methylase [Yersinia pestis Antiqua]
 gi|115346195|emb|CAL19063.1| putative methylase [Yersinia pestis CO92]
 gi|145212536|gb|ABP41943.1| methylase [Yersinia pestis Pestoides F]
 gi|149289983|gb|EDM40060.1| putative methylase [Yersinia pestis CA88-4125]
 gi|152960998|gb|ABS48459.1| RNA methyltransferase, TrmH family, group 3 [Yersinia
           pseudotuberculosis IP 31758]
 gi|162352751|gb|ABX86699.1| RNA methyltransferase, TrmH family, group 3 [Yersinia pestis
           Angola]
 gi|165915676|gb|EDR34285.1| RNA methyltransferase, TrmH family, group 3 [Yersinia pestis biovar
           Orientalis str. IP275]
 gi|165921410|gb|EDR38634.1| RNA methyltransferase, TrmH family, group 3 [Yersinia pestis biovar
           Orientalis str. F1991016]
 gi|165989228|gb|EDR41529.1| RNA methyltransferase, TrmH family, group 3 [Yersinia pestis biovar
           Antiqua str. E1979001]
 gi|166204765|gb|EDR49245.1| RNA methyltransferase, TrmH family, group 3 [Yersinia pestis biovar
           Antiqua str. B42003004]
 gi|166963258|gb|EDR59279.1| RNA methyltransferase, TrmH family, group 3 [Yersinia pestis biovar
           Orientalis str. MG05-1020]
 gi|167050047|gb|EDR61455.1| RNA methyltransferase, TrmH family, group 3 [Yersinia pestis biovar
           Antiqua str. UG05-0454]
 gi|167057430|gb|EDR67176.1| RNA methyltransferase, TrmH family, group 3 [Yersinia pestis biovar
           Mediaevalis str. K1973002]
 gi|169752539|gb|ACA70057.1| RNA methyltransferase, TrmH family, group 3 [Yersinia
           pseudotuberculosis YPIII]
 gi|186696819|gb|ACC87448.1| RNA methyltransferase, TrmH family, group 3 [Yersinia
           pseudotuberculosis PB1/+]
 gi|229679699|gb|EEO75802.1| 23S rRNA (Gm2251)-methyltransferase [Yersinia pestis Nepal516]
 gi|229690642|gb|EEO82696.1| 23S rRNA (Gm2251)-methyltransferase [Yersinia pestis biovar
           Orientalis str. India 195]
 gi|229696620|gb|EEO86667.1| 23S rRNA (Gm2251)-methyltransferase [Yersinia pestis biovar
           Orientalis str. PEXU2]
 gi|229706326|gb|EEO92334.1| 23S rRNA (Gm2251)-methyltransferase [Yersinia pestis Pestoides A]
 gi|262360520|gb|ACY57241.1| putative methylase [Yersinia pestis D106004]
 gi|262364467|gb|ACY61024.1| putative methylase [Yersinia pestis D182038]
 gi|270337588|gb|EFA48365.1| RNA methyltransferase, TrmH family, group 3 [Yersinia pestis KIM
           D27]
 gi|294352948|gb|ADE63289.1| putative methylase [Yersinia pestis Z176003]
 gi|320013752|gb|ADV97323.1| tRNA guanosine-2'-O-methyltransferase [Yersinia pestis biovar
           Medievalis str. Harbin 35]
          Length = 246

 Score =  133 bits (334), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 65/241 (26%), Positives = 105/241 (43%), Gaps = 8/241 (3%)

Query: 48  NLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANL---PHPFPVKTVPPQTIDKI 104
           +  +YG+H V A L    ++  ++   K    R               ++    Q +D  
Sbjct: 2   SEIIYGIHAVKALLERDPQRFLEVFILKGRDDRRLQPLIAELEAAGLVIQVASRQWLDSQ 61

Query: 105 VGKEAVHQGLALETAPLLSPTLDAVR-----NSQLLMVLDHVNDPHNIGAILRSAVAFSC 159
           V        +A           D         +  L+VLD V DPHN+GA LRSA A   
Sbjct: 62  VEGGVHQGIVARVREGRQYQENDLPALLESVETPFLLVLDGVTDPHNLGACLRSADAAGV 121

Query: 160 DGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKP 219
             +I  +  S   +A+  K ASGA E++P I+++NL   L+ +       +G + ++   
Sbjct: 122 HAVIVPRDRSAQLNAIAKKVASGAAENVPLIKVTNLARTLRVLQEHNVWIVGTAGEADHT 181

Query: 220 LEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNH 279
           L Q      +AL++GAEG+G+R  T+E    +  + M G + +LNVS A  V L+     
Sbjct: 182 LYQSKMTGPMALVMGAEGEGMRRLTREHCDELISIPMAGSVSSLNVSVATGVCLFEVVRQ 241

Query: 280 F 280
            
Sbjct: 242 R 242


>gi|299821035|ref|ZP_07052923.1| RNA methyltransferase [Listeria grayi DSM 20601]
 gi|299816700|gb|EFI83936.1| RNA methyltransferase [Listeria grayi DSM 20601]
          Length = 249

 Score =  133 bits (334), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 67/245 (27%), Positives = 116/245 (47%), Gaps = 11/245 (4%)

Query: 45  QPENLFLYGVHTVSAALNNPS--RKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTID 102
           + E  ++ G + V  AL +    +KI+   A++  + +            ++ VP Q ID
Sbjct: 2   ENEQEWIGGRNPVLEALRSERDIQKIYIAEASQKGVMKQVIALAKERKLQIQFVPKQKID 61

Query: 103 KIVGKEAVHQGLALETAPLLSPTLD-------AVRNSQLLMVLDHVNDPHNIGAILRSAV 155
           K+V  E  HQG+A + +      LD               ++LD + DPHN+G+I+R+A 
Sbjct: 62  KVV--EGAHQGVAAQISAYQYAELDELFERASTRNEQPFFILLDELEDPHNLGSIMRTAD 119

Query: 156 AFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSD 215
           A    GII   R S   +  +AK+++GA+EHIP +R++NL   +  +   G    G  + 
Sbjct: 120 AVGAHGIIIPNRRSVGLTQTVAKASTGAIEHIPVVRVTNLNKTIDVLKDRGLWIFGTDAK 179

Query: 216 SKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYI 275
                     +  + +++G+EG G+    +E    + HL M G + +LN S AA++ LY 
Sbjct: 180 GSSDYRTMDVDMPLGIVIGSEGAGMSRLVREKCDFLVHLPMKGKVTSLNASVAASILLYE 239

Query: 276 TQNHF 280
                
Sbjct: 240 VYRKR 244


>gi|226950562|ref|YP_002805653.1| RNA methyltransferase, TrmH family [Clostridium botulinum A2 str.
           Kyoto]
 gi|226840837|gb|ACO83503.1| RNA methyltransferase, TrmH family [Clostridium botulinum A2 str.
           Kyoto]
          Length = 259

 Score =  133 bits (334), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 55/262 (20%), Positives = 108/262 (41%), Gaps = 9/262 (3%)

Query: 24  RRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDW 83
            ++++  K+++   +K ++ +Q ++  + G      AL + S  + ++   + +L +L+ 
Sbjct: 4   SKDNQLIKEVRKLREK-KYRTQNKSFIIEGFRFFEEALKSNS-SVNKVFIEEKSLNKLEE 61

Query: 84  ---DANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDH 140
                N+ +      V    +  I G     QG+           LD      +L+  D 
Sbjct: 62  LYKKYNINNDIETYVVNYFVLKSI-GNTENPQGIVSVINYFKKEKLDLQNGFYILV--DK 118

Query: 141 VNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQ 200
           V DP N+G I+R+A A    GIITTK      +    +S  G++ +IP I   NL     
Sbjct: 119 VQDPGNMGTIIRTAHAAGALGIITTKGTVDIYNEKTLRSTMGSIFYIPIIEDENLEVVKS 178

Query: 201 KMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGII 260
                    +     +    +  +K D + + +G EG G+    +  +     + MPG  
Sbjct: 179 LRKKGFKLLVSSLDTNSNFYDVNMK-DNMIIAVGNEGNGISEVLKTLSDIKVKIPMPGAA 237

Query: 261 KALNVSNAAAVALYITQNHFAK 282
           ++LNV+ A ++  +       K
Sbjct: 238 ESLNVAVACSIMTFERIRQINK 259


>gi|146305679|ref|YP_001186144.1| RNA methyltransferase [Pseudomonas mendocina ymp]
 gi|145573880|gb|ABP83412.1| 23S rRNA Gm-2251 2'-O-methyltransferase [Pseudomonas mendocina ymp]
          Length = 250

 Score =  133 bits (334), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 78/240 (32%), Positives = 117/240 (48%), Gaps = 12/240 (5%)

Query: 51  LYGVHTVSAALNNPSRKIFQLLATKNALARLDW---DANLPHPFPVKTVPPQTIDKIVGK 107
           +YGVH V A L +  +++ QL   ++  A       +    H  PV     Q +D+    
Sbjct: 7   VYGVHAVEALLRHHPKRVKQLWLAESRQAPRIQPMLELAAQHRVPVGHKERQELDEWA-- 64

Query: 108 EAVHQGLALETAPLLSP-------TLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCD 160
           E VHQG+  E +P            L+      LL+VLD V DPHN+GA LR+A A    
Sbjct: 65  EGVHQGVVAEVSPSQVWGENMLDELLERSEGVPLLLVLDGVTDPHNLGACLRTADAAGAQ 124

Query: 161 GIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPL 220
            +I  K  S + +A + K A GA E IP + ++NL   L+K+   G   +G + ++++ L
Sbjct: 125 AVIVPKDKSATLNATVRKVACGAAEVIPLVAVTNLARTLEKLQKKGLWVVGTAGEAEQEL 184

Query: 221 EQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
            Q        L++GAEGKG+R  T+E    +  L M G + +LNVS A  V L+      
Sbjct: 185 YQLDMTGPTVLVMGAEGKGMRRLTREHCDYLVKLPMGGSVSSLNVSVATGVCLFEAVRQR 244


>gi|218134245|ref|ZP_03463049.1| hypothetical protein BACPEC_02137 [Bacteroides pectinophilus ATCC
           43243]
 gi|217991620|gb|EEC57626.1| hypothetical protein BACPEC_02137 [Bacteroides pectinophilus ATCC
           43243]
          Length = 248

 Score =  133 bits (334), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 56/238 (23%), Positives = 103/238 (43%), Gaps = 9/238 (3%)

Query: 51  LYGVHTVSAALNNPS--RKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKE 108
           + G + V+ AL +     K+F L   ++   R        H   +  V  + +D +    
Sbjct: 10  IEGRNAVTEALRSGRPVDKLFVLDGCQDGPVRTIIREAKKHDTIINFVSKERLDSMSETG 69

Query: 109 AVHQGLALETAPLLSPTLDA------VRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGI 162
                +A   A   +   D             + +LD + DPHN+GAI+R+A      G+
Sbjct: 70  KHQGVIAYAAAYEYAEVQDILDAAGEKGEPPFIFILDGIEDPHNLGAIIRTANLAGAHGV 129

Query: 163 ITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQ 222
           I  KR +   +A +AK+++GA+ + P  +++N+   ++++   G   +   +   + +  
Sbjct: 130 IIPKRRAVGLTATVAKTSAGAINYTPVAKVTNIAQTIEELKKEGMWFVCA-AMDGEVMYN 188

Query: 223 EIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
                 I L++GAEG+G+    +E     A + M G I +LN S AA V  Y      
Sbjct: 189 LDLKGPIGLVIGAEGEGVSRLVREKCDFTASIPMKGNIDSLNASVAAGVLAYEIVRQR 246


>gi|163816511|ref|ZP_02207875.1| hypothetical protein COPEUT_02700 [Coprococcus eutactus ATCC 27759]
 gi|158448211|gb|EDP25206.1| hypothetical protein COPEUT_02700 [Coprococcus eutactus ATCC 27759]
          Length = 264

 Score =  133 bits (334), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 49/248 (19%), Positives = 103/248 (41%), Gaps = 11/248 (4%)

Query: 42  HTSQPENLFLYGVHTVSAALNNPSR--KIFQLLATKNALARLDWDANLPHPFPVKTVPPQ 99
           + +  E   + G + V  A  +     K++ L   ++ +              +  +   
Sbjct: 16  NENAEEAFVIEGRNAVLEAFRSGKTIDKLYVLDGCRDGVVNSIVREAKKQDTVINYLSKD 75

Query: 100 TIDKIVGKEAVHQGLALETAPLLSPTLDAV-------RNSQLLMVLDHVNDPHNIGAILR 152
            ++++  +   HQG+    A      ++ +              +LD + DPHN+GAI+R
Sbjct: 76  KLNQMS-QAGKHQGVIAHAAAYKYAEIEDMFALAESRGEDPFFFILDEIEDPHNLGAIIR 134

Query: 153 SAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGL 212
           +A      G+I  KR +   +A + K+++GA+ + P  +++N++  ++++   G      
Sbjct: 135 TANLCGAHGVIIPKRRAVGITATVVKASAGAINYTPVAKVTNISKTIEELKERGMWFACA 194

Query: 213 SSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVA 272
             D +   +       + L++G EG G+    +E    +  + M G I +LN S AA V 
Sbjct: 195 DMDGELMYKCN-LTGSLGLVIGNEGNGVSRLVKEKCDYVVSVPMKGDIDSLNASVAAGVL 253

Query: 273 LYITQNHF 280
            Y      
Sbjct: 254 AYEVVRQR 261


>gi|289168211|ref|YP_003446480.1| tRNA (guanosine-2'-O-)-methyltransferase [Streptococcus mitis B6]
 gi|288907778|emb|CBJ22618.1| tRNA (guanosine-2'-O-)-methyltransferase [Streptococcus mitis B6]
          Length = 242

 Score =  133 bits (334), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 74/240 (30%), Positives = 121/240 (50%), Gaps = 9/240 (3%)

Query: 48  NLFLYGVHTVSAAL-NNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVG 106
           N  +YGVH V+ AL  N   K++     +        +        +     +++ ++  
Sbjct: 4   NDIVYGVHAVTEALLANTGNKLYLQEDLRGKNVEKVKELATEKKVSISWTSKKSLSEMT- 62

Query: 107 KEAVHQGLALETAPLLSPTLDA------VRNSQLLMVLDHVNDPHNIGAILRSAVAFSCD 160
           + AVHQG  L  +      LD          + LL++LD + DPHN+G+ILR+A A +  
Sbjct: 63  EGAVHQGFVLRVSEFAYSELDHILEKTHQEENPLLLILDGLTDPHNLGSILRTADATNVS 122

Query: 161 GIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPL 220
           G+I  K  +   + V+AK+A+GA+EH+P  R++NL+  L K+   GF T G   +     
Sbjct: 123 GVIIPKHRAVGVTPVVAKTATGAIEHVPIARVTNLSQTLDKLKDEGFWTFGTDMNGTPCH 182

Query: 221 EQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
           +   K  KIALI+G EGKG+    ++    M  + M G +++LN S AAA+ +Y    + 
Sbjct: 183 KWNTK-GKIALIIGNEGKGISSNIKKQVDEMITIPMNGHVQSLNASVAAAILMYEVFRNR 241


>gi|160882253|ref|ZP_02063256.1| hypothetical protein BACOVA_00199 [Bacteroides ovatus ATCC 8483]
 gi|260173823|ref|ZP_05760235.1| tRNA/rRNA methyltransferase [Bacteroides sp. D2]
 gi|299146570|ref|ZP_07039638.1| RNA methyltransferase, TrmH family, group 3 [Bacteroides sp.
           3_1_23]
 gi|315922086|ref|ZP_07918326.1| conserved hypothetical protein [Bacteroides sp. D2]
 gi|156112342|gb|EDO14087.1| hypothetical protein BACOVA_00199 [Bacteroides ovatus ATCC 8483]
 gi|298517061|gb|EFI40942.1| RNA methyltransferase, TrmH family, group 3 [Bacteroides sp.
           3_1_23]
 gi|313695961|gb|EFS32796.1| conserved hypothetical protein [Bacteroides sp. D2]
          Length = 247

 Score =  133 bits (334), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 61/245 (24%), Positives = 103/245 (42%), Gaps = 13/245 (5%)

Query: 47  ENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHP---FPVKTVPPQTIDK 103
           ++  ++GV  V  AL      I ++L  K+  + L  +          PV+ VP + I++
Sbjct: 4   KSEMIFGVRAVIEALQAGKE-IDKILVKKDIQSDLSKELFAALKGTLIPVQRVPVERINR 62

Query: 104 IVGKEAVHQGLALETAPLLSP-------TLDAVRNSQLLMVLDHVNDPHNIGAILRSAVA 156
           I      HQG+    + +           L     +   ++LD V D  N GAI R+   
Sbjct: 63  IT--RKNHQGVIAFISSVTYQKAEDLVPFLFEQGKNPFFVMLDGVTDVRNFGAIARTCEC 120

Query: 157 FSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDS 216
            + D +I   R S S +A   K+++GAL  +P  R  NL   LQ +   GF+ +  +   
Sbjct: 121 AAVDAVIIPVRGSASVNADAVKTSAGALHTLPVCREQNLRSTLQYLKDSGFRIVAATEKG 180

Query: 217 KKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYIT 276
                +      + +I+GAE  G+  +          + M G I++LNVS AA + +Y  
Sbjct: 181 DYDYTKADYTGPLCIIMGAEDTGVSYENLALCDEWVKIPMLGTIESLNVSVAAGILIYEA 240

Query: 277 QNHFA 281
                
Sbjct: 241 VKQRN 245


>gi|152976947|ref|YP_001376464.1| tRNA/rRNA methyltransferase (SpoU) [Bacillus cereus subsp.
           cytotoxis NVH 391-98]
 gi|152025699|gb|ABS23469.1| tRNA/rRNA methyltransferase (SpoU) [Bacillus cytotoxicus NVH
           391-98]
          Length = 254

 Score =  133 bits (334), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 50/277 (18%), Positives = 103/277 (37%), Gaps = 29/277 (10%)

Query: 1   MNLISKKKSEKIFSLKDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAA 60
           M  I   K+ ++   K                        +   +    F+ G H V  A
Sbjct: 1   MKNIDSVKNPRVKQWKKLQTK-------------------KERDKKGLFFVEGFHLVEEA 41

Query: 61  LNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAP 120
           L      + +L+ +       DW  +      +  VP   +  +   E      A+    
Sbjct: 42  LKAD--IVTELIVSDQTDLPKDWIVS---DVEMYIVPEPIVKVLRETETTQGVFAVCEKQ 96

Query: 121 LLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSA 180
                L   +     ++LD + DP N+G I+R+A A     ++  +    + ++ + +S 
Sbjct: 97  EKEVELSNGK----FLLLDGLQDPGNLGTIIRTADAAGVHAVVLGEGCVDAYNSKVLRST 152

Query: 181 SGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGL 240
            G++ H+P ++ +   + + K+ +      G + ++  P  +       ALI+G EG G+
Sbjct: 153 QGSIFHLPVVKGNLE-EWIDKLKTHNVPVYGTALENGVPYGEITPTGSFALIVGNEGNGV 211

Query: 241 RPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQ 277
                       ++ + G  ++LNV+ AA +  Y  Q
Sbjct: 212 HQDILAKCDQNLYIPIYGGAESLNVAVAAGILTYYLQ 248


>gi|258513621|ref|YP_003189843.1| RNA methyltransferase, TrmH family, group 3 [Desulfotomaculum
           acetoxidans DSM 771]
 gi|257777326|gb|ACV61220.1| RNA methyltransferase, TrmH family, group 3 [Desulfotomaculum
           acetoxidans DSM 771]
          Length = 246

 Score =  133 bits (334), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 72/245 (29%), Positives = 122/245 (49%), Gaps = 10/245 (4%)

Query: 45  QPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWD---ANLPHPFPVKTVPPQTI 101
           +  +  + G + V  AL +  R I ++L  K  L+    +       +  PV+ V    +
Sbjct: 2   KNLSDVIVGRNPVKEALKS-QRPINKVLVAKGKLSGSLAEICSLARQNGIPVQEVDRTAL 60

Query: 102 DKIVGKEAVHQGLALETAPLLSPTLDAV-----RNSQLLMVLDHVNDPHNIGAILRSAVA 156
           +KI   EAVHQG+A   A      L+ +          +++LD + DPHN+GAI+R+A A
Sbjct: 61  EKISA-EAVHQGVAAYAAAKEYVELEDILARAGEQEPFIIMLDEITDPHNLGAIIRTADA 119

Query: 157 FSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDS 216
               G++ T+R S   + V+AKS++GA+E++P  R++NL  +++ +   G    G   + 
Sbjct: 120 AGVHGVVVTRRRSALLTPVVAKSSAGAVEYVPVARVTNLVQSIKILQENGIWVAGADMEG 179

Query: 217 KKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYIT 276
            K   +   +  IA+++G EGKGL    +E    +  L M G I +LN S A A+  Y  
Sbjct: 180 DKVYWEAPLSGPIAIVIGGEGKGLGRLVKEKCDFLVRLPMQGKISSLNASVATALLAYEV 239

Query: 277 QNHFA 281
               +
Sbjct: 240 VRQRS 244


>gi|306825520|ref|ZP_07458860.1| RNA methyltransferase [Streptococcus sp. oral taxon 071 str.
           73H25AP]
 gi|304432458|gb|EFM35434.1| RNA methyltransferase [Streptococcus sp. oral taxon 071 str.
           73H25AP]
          Length = 242

 Score =  133 bits (334), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 74/240 (30%), Positives = 121/240 (50%), Gaps = 9/240 (3%)

Query: 48  NLFLYGVHTVSAAL-NNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVG 106
           N  +YGVH V+ AL  N   K++     +        +        +     +++ ++  
Sbjct: 4   NDIVYGVHAVTEALLANTGNKLYLQEDLRGKNVEKVKELAAEKKVSISWTSKKSLSEMT- 62

Query: 107 KEAVHQGLALETAPLLSPTLDA------VRNSQLLMVLDHVNDPHNIGAILRSAVAFSCD 160
           + AVHQG  L  +      LD          + LL++LD + DPHN+G+ILR+A A +  
Sbjct: 63  EGAVHQGFVLRVSEFAYSKLDHILAKTRQEENPLLLILDGLTDPHNLGSILRTADATNVS 122

Query: 161 GIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPL 220
           G+I  K  +   + V+AK+A+GA+EH+P  R++NL+  L K+   GF T G   +     
Sbjct: 123 GVIIPKHRAVGVTPVVAKTATGAIEHVPIARVTNLSQTLDKLKDEGFWTFGTDMNGTPCH 182

Query: 221 EQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
           +   K  KIALI+G EGKG+    ++    M  + M G +++LN S AAA+ +Y    + 
Sbjct: 183 KWNTK-GKIALIIGNEGKGISSNIKKQVDEMITIPMNGHVQSLNASVAAAILMYEVFRNR 241


>gi|326402255|ref|YP_004282336.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Acidiphilium
           multivorum AIU301]
 gi|325049116|dbj|BAJ79454.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Acidiphilium
           multivorum AIU301]
          Length = 276

 Score =  133 bits (334), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 104/275 (37%), Positives = 153/275 (55%), Gaps = 2/275 (0%)

Query: 6   KKKSEKIFSLKDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPS 65
            K+     +     +   R  H   +      +  R  S    L+LYG+H+V AAL NP+
Sbjct: 2   DKRDSHGKAGNGGRHKLPRGPHPHRRSQGDAPRDRRPASSAGGLWLYGLHSVEAALANPA 61

Query: 66  RKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPT 125
           R++ +L+ T+   A L      P P   + +    +D+++G+  VHQG+AL+  PL+ P+
Sbjct: 62  RRLRRLVVTEEGEAALAGRLPHPWPIQPERIERDRLDQMLGRGIVHQGVALQADPLVPPS 121

Query: 126 L-DAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGAL 184
           L DA++    ++VLD + DP N+GAILRSA AF    +I  +R +P E   LAK+ASGAL
Sbjct: 122 LNDALKRPGPVLVLDQITDPRNVGAILRSAQAFGAAMVIAQERNAPEEGGALAKAASGAL 181

Query: 185 EHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKP-LEQEIKNDKIALILGAEGKGLRPK 243
           E IP +R  N+  AL  + + G   +GL +          I N + AL+LGAEG+GLR  
Sbjct: 182 ERIPLLRTVNIARALIALKAAGLWVMGLDAAGLSHLSRDAIGNRRAALVLGAEGEGLRRL 241

Query: 244 TQETATSMAHLHMPGIIKALNVSNAAAVALYITQN 278
           T+ET   +  L MPG +++LNVS AAAVALY    
Sbjct: 242 TRETCDELVSLPMPGGMESLNVSAAAAVALYEIIR 276


>gi|322517494|ref|ZP_08070367.1| TrmH family RNA methyltransferase [Streptococcus vestibularis ATCC
           49124]
 gi|322123976|gb|EFX95535.1| TrmH family RNA methyltransferase [Streptococcus vestibularis ATCC
           49124]
          Length = 245

 Score =  133 bits (334), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 56/274 (20%), Positives = 108/274 (39%), Gaps = 31/274 (11%)

Query: 1   MNLISKKKSEKIFSLKDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAA 60
           M +I  K++  I + +                      + +H        L G H    A
Sbjct: 1   MEIIQSKQNASIKTARKL-------------------LQRKHRKTS--YLLEGWHLFEEA 39

Query: 61  LNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAP 120
                  I Q+   +    R+       +   VK V P+ + ++   +   QG+  E A 
Sbjct: 40  -KASGADILQIFVLEEMADRV------ANMSKVKLVSPEVLKELCETQ-TPQGIVAEVAK 91

Query: 121 LLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSA 180
                 +++    LL+  + V DP N+G ++R+A A   DG+  + + +   +    +S 
Sbjct: 92  QSQALPESLSGKYLLL--EDVQDPGNVGTMIRTADAAGYDGVFLSDKSADIYNQKTLRSM 149

Query: 181 SGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGL 240
            G+  H+P  R   L                  S+     +    +   AL++G EG+G+
Sbjct: 150 QGSHFHLPIYRGPILEMVETCKKHDLTVLATTLSEVSVDYKAVKTDGNFALVMGNEGQGI 209

Query: 241 RPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
             +  E+A  + H++MPG  ++LNV+ AA + ++
Sbjct: 210 SKEMAESADQLVHINMPGQAESLNVAVAAGIIMF 243


>gi|315649722|ref|ZP_07902806.1| RNA methyltransferase, TrmH family, group 3 [Paenibacillus vortex
           V453]
 gi|315274910|gb|EFU38286.1| RNA methyltransferase, TrmH family, group 3 [Paenibacillus vortex
           V453]
          Length = 250

 Score =  133 bits (334), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 65/246 (26%), Positives = 119/246 (48%), Gaps = 13/246 (5%)

Query: 46  PENLFLYGVHTVSAALNNPSRKIFQLLATKNALARL---DWDANLPHPFPVKTVPPQTID 102
            E   + G H+V+ AL +  R I ++   +NA   L              ++ V  + +D
Sbjct: 3   QEEEVVAGKHSVTEALKSG-RTINKIWIAENAQKHLTLPIIAEAKKLGIVIQHVDKRKLD 61

Query: 103 KIVGKEAVHQGLALETAPLLSPTLDA-------VRNSQLLMVLDHVNDPHNIGAILRSAV 155
           ++V     HQG+  + AP     ++              L++LD + DPHN+G+ILR+A 
Sbjct: 62  QMV-PGVQHQGVVAQAAPYAYVEVEDLLKVAEEKGEPPFLLLLDEIEDPHNLGSILRTAD 120

Query: 156 AFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSD 215
                G++  KR S   +A ++K+++GA+E++P  R++NL   + ++   G   +G   D
Sbjct: 121 CTGAHGVVLPKRRSAQVTATVSKTSAGAVEYVPVARVTNLGQTIDQLKEMGVWVVGTVVD 180

Query: 216 SKKP-LEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
           + +   + E+ +  +A+++G E KG+    +E    +  L M G I +LN S AA V +Y
Sbjct: 181 AVQELYDTEVFDGPVAIVIGNESKGMGRLIREKCDVLVKLPMAGKINSLNASVAAGVVMY 240

Query: 275 ITQNHF 280
                 
Sbjct: 241 EVLRRR 246


>gi|291563819|emb|CBL42635.1| rRNA methylases [butyrate-producing bacterium SS3/4]
          Length = 260

 Score =  133 bits (334), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 51/255 (20%), Positives = 100/255 (39%), Gaps = 4/255 (1%)

Query: 27  HRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDAN 86
           +   K +    +K+R  ++     + G   V  A   P  ++  +  ++      +  A 
Sbjct: 7   NDQVKAVIELKKKARARNEQGLFVVEG---VRMAAELPKDQVKSIYVSETFAKNPENAAI 63

Query: 87  LPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPT-LDAVRNSQLLMVLDHVNDPH 145
           L      + V       +   +     LAL          L        LMVL+++ DP 
Sbjct: 64  LAEYPGYELVSDSVFAVMSDTQTPQGVLALVRQFSYGMDELLKSDRPAHLMVLENLQDPG 123

Query: 146 NIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSW 205
           N+G ILR+       G+I ++      +  + +S  G++  +P+    +L   +  + + 
Sbjct: 124 NLGTILRAGEGAGITGLIMSRDTVDIYNPKVIRSTMGSVFRVPFFYTDDLEQTVLDLKAR 183

Query: 206 GFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNV 265
           G +        K   EQE      A ++G EG GL  K  + A +   + M G +++LN 
Sbjct: 184 GIRVFAAHLAGKNNYEQEDYTGNTAFLIGNEGNGLTEKLSDMADTWVKIPMEGKVESLNA 243

Query: 266 SNAAAVALYITQNHF 280
           + AA++ ++ T    
Sbjct: 244 AIAASILMFETARQR 258


>gi|282898547|ref|ZP_06306535.1| tRNA/rRNA methyltransferase (SpoU) [Cylindrospermopsis raciborskii
           CS-505]
 gi|281196415|gb|EFA71324.1| tRNA/rRNA methyltransferase (SpoU) [Cylindrospermopsis raciborskii
           CS-505]
          Length = 263

 Score =  133 bits (334), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 45/256 (17%), Positives = 102/256 (39%), Gaps = 8/256 (3%)

Query: 26  NHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAA--LNNPSRKIFQLLATKNALARLDW 83
            +   K+++  +  ++   + +   L G H ++ A  +N P   +   +  +N+ + L  
Sbjct: 6   QNPLVKQIRKLH-SAKERHKQQLFVLEGTHLITEACSVNYPLETVCCTMDWQNSHSELWQ 64

Query: 84  DANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDHVND 143
           +         + V  + +  +    A         A +       +  + L + L+ + D
Sbjct: 65  NVCNA-CHRTEIVSQEVLAAM----ATTVQPDGVVAMVKRCEDHPIPMTGLALALETIQD 119

Query: 144 PHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMH 203
           P N+G I+R+A A    G+  +      +   + ++++G    +      NL D +Q   
Sbjct: 120 PGNLGTIIRTAAAVDASGLWLSNDSVDLDHPKVLRASAGQWFRLKKQVSHNLKDTVQDCQ 179

Query: 204 SWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKAL 263
             G Q +     ++    Q   +    ++LG EG GL  +    A     + +   +++L
Sbjct: 180 RGGMQVVATLPTAELTYWQVDWSLPSLILLGNEGAGLSDELATMANIQVKIPLSPQVESL 239

Query: 264 NVSNAAAVALYITQNH 279
           NV+ +A++ LY  Q  
Sbjct: 240 NVAISASLILYEAQRQ 255


>gi|160893354|ref|ZP_02074141.1| hypothetical protein CLOL250_00904 [Clostridium sp. L2-50]
 gi|156865046|gb|EDO58477.1| hypothetical protein CLOL250_00904 [Clostridium sp. L2-50]
          Length = 251

 Score =  133 bits (334), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 51/248 (20%), Positives = 99/248 (39%), Gaps = 11/248 (4%)

Query: 42  HTSQPENLFLYGVHTVSAALNNPSR--KIFQLLATKNALARLDWDANLPHPFPVKTVPPQ 99
             ++ E   + G + V  A  +     K++      +                +  V  +
Sbjct: 2   EENRNEKFEIEGRNAVMEAFRSGKTVDKLYLQDGCHDGSINSIVREAKKQETIINYVSKE 61

Query: 100 TIDKIVGKEAVHQGLALETAPLLSPTLDAV-------RNSQLLMVLDHVNDPHNIGAILR 152
            ++++      HQG+    A      +D +            + +LD + DPHN+GAI+R
Sbjct: 62  KLNQMSS-TGKHQGVIAHVAAYEYSAIDEIFAKAEEKGQPPFIFILDEIEDPHNLGAIVR 120

Query: 153 SAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGL 212
           +A      G+I  KR +   +A + K+++GA+ + P ++++NL   + ++   G      
Sbjct: 121 TANLCGAHGVIIPKRRAVGITATVVKASAGAIAYTPVVKVTNLAKTIDELKKRGMWFACA 180

Query: 213 SSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVA 272
             D +           + L++G EG G+    +E    +  + M G I +LN S AA V 
Sbjct: 181 DMDGELMYRCN-LTGPMGLVIGNEGTGVSRLVKEKCDYVVSIPMSGDIDSLNASVAAGVL 239

Query: 273 LYITQNHF 280
            Y      
Sbjct: 240 GYEVVRQR 247


>gi|237821018|ref|ZP_04596863.1| RNA methyltransferase, TrmH family, group 3 [Streptococcus
           pneumoniae CCRI 1974M2]
          Length = 251

 Score =  133 bits (334), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 74/240 (30%), Positives = 121/240 (50%), Gaps = 9/240 (3%)

Query: 48  NLFLYGVHTVSAAL-NNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVG 106
           N  +YGVH V+ AL  N   K++     +        +        +     +++ ++  
Sbjct: 4   NDIVYGVHAVTEALLANTGNKLYLQEDLRGKNVEKVKELATEKKVSISWTSKKSLSEMT- 62

Query: 107 KEAVHQGLALETAPLLSPTLDA------VRNSQLLMVLDHVNDPHNIGAILRSAVAFSCD 160
           + AVHQG  L  +      LD          + LL++LD + DPHN+G+ILR+A A +  
Sbjct: 63  EGAVHQGFVLRVSEFAYSELDYILAKTRQEENPLLLILDGLTDPHNLGSILRTADATNVS 122

Query: 161 GIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPL 220
           G+I  K  +   + V+AK+A+GA+EH+P  R++NL+  L K+   GF T G   +     
Sbjct: 123 GVIIPKHRTVGVTPVVAKTATGAIEHVPIARVTNLSQTLDKLKDEGFWTFGTDMNGTPCH 182

Query: 221 EQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
           +   K  KIALI+G EGKG+    ++    M  + M G +++LN S AAA+ +Y    + 
Sbjct: 183 KWNTK-GKIALIIGNEGKGISSNIKKQVDEMITIPMNGHVQSLNASVAAAILMYEVFRNR 241


>gi|182684414|ref|YP_001836161.1| spoU rRNA methylase family protein [Streptococcus pneumoniae
           CGSP14]
 gi|182629748|gb|ACB90696.1| spoU rRNA methylase family protein [Streptococcus pneumoniae
           CGSP14]
          Length = 253

 Score =  133 bits (334), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 74/240 (30%), Positives = 121/240 (50%), Gaps = 9/240 (3%)

Query: 48  NLFLYGVHTVSAAL-NNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVG 106
           N  +YGVH V+ AL  N   K++     +        +        +     +++ ++  
Sbjct: 15  NDIVYGVHAVTEALLANTGNKLYLQEDLRGKNVEKVKELATEKKVSISWTSKKSLSEMT- 73

Query: 107 KEAVHQGLALETAPLLSPTLDA------VRNSQLLMVLDHVNDPHNIGAILRSAVAFSCD 160
           + AVHQG  L  +      LD          + LL++LD + DPHN+G+ILR+A A +  
Sbjct: 74  EGAVHQGFVLRVSEFAYSELDYILAKTRQEENPLLLILDGLTDPHNLGSILRTADATNVS 133

Query: 161 GIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPL 220
           G+I  K  +   + V+AK+A+GA+EH+P  R++NL+  L K+   GF T G   +     
Sbjct: 134 GVIIPKHRTVGVTPVVAKTATGAIEHVPIARVTNLSQTLDKLKDEGFWTFGTDMNGTPCH 193

Query: 221 EQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
           +   K  KIALI+G EGKG+    ++    M  + M G +++LN S AAA+ +Y    + 
Sbjct: 194 KWNTK-GKIALIIGNEGKGISSNIKKQVDEMITIPMNGHVQSLNASVAAAILMYEVFRNR 252


>gi|167745546|ref|ZP_02417673.1| hypothetical protein ANACAC_00237 [Anaerostipes caccae DSM 14662]
 gi|167655267|gb|EDR99396.1| hypothetical protein ANACAC_00237 [Anaerostipes caccae DSM 14662]
          Length = 257

 Score =  133 bits (334), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 40/254 (15%), Positives = 98/254 (38%), Gaps = 7/254 (2%)

Query: 26  NHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDA 85
            ++  +++    + SR   +       G+         P  +  ++  + + L     + 
Sbjct: 6   QNKQIRQVIKLKKSSRERKRTGLFVAEGLRIFREI---PEEQRAKVFVSSDFLKLHGEEL 62

Query: 86  NLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDHVNDPH 145
                 P + V P+   +I   E     L+L      + +    R+   +++L+++ DP 
Sbjct: 63  ---KGIPFEEVSPKVFREISDTETPQGILSLVKMKQSTLSEILKRSGSSILLLENLQDPG 119

Query: 146 NIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSW 205
           N+G ++R+       GII ++      +  + +S  G++  +P+    +L + ++ +   
Sbjct: 120 NLGTLIRTGEGAGVSGIIMSRDTVDIYNPKVIRSTMGSIFRVPFTYTEDLAETVEYLRQQ 179

Query: 206 GFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNV 265
                    +       E  +   A ++G EG GL  +    A     + M G +++LN 
Sbjct: 180 SVHVYAAHLNGTDYT-DESYDKISAFLIGNEGNGLTDRIAALADKRIRIPMEGRVESLNA 238

Query: 266 SNAAAVALYITQNH 279
           + A  + +Y  +  
Sbjct: 239 AMAGGLLMYEARRQ 252


>gi|149002852|ref|ZP_01827778.1| spoU rRNA methylase family protein [Streptococcus pneumoniae
           SP14-BS69]
 gi|168493358|ref|ZP_02717501.1| RNA methyltransferase, TrmH family, group 3 [Streptococcus
           pneumoniae CDC3059-06]
 gi|194397072|ref|YP_002038090.1| TrmH family RNA methyltransferase [Streptococcus pneumoniae G54]
 gi|225859218|ref|YP_002740728.1| RNA methyltransferase, TrmH family, group 3 [Streptococcus
           pneumoniae 70585]
 gi|237651107|ref|ZP_04525359.1| RNA methyltransferase, TrmH family, group 3 [Streptococcus
           pneumoniae CCRI 1974]
 gi|303254383|ref|ZP_07340490.1| RNA methyltransferase, TrmH family protein [Streptococcus
           pneumoniae BS455]
 gi|303259053|ref|ZP_07345032.1| spoU rRNA methylase family protein [Streptococcus pneumoniae
           SP-BS293]
 gi|303261733|ref|ZP_07347680.1| spoU rRNA methylase family protein [Streptococcus pneumoniae
           SP14-BS292]
 gi|303264406|ref|ZP_07350326.1| spoU rRNA methylase family protein [Streptococcus pneumoniae BS397]
 gi|303267526|ref|ZP_07353374.1| spoU rRNA methylase family protein [Streptococcus pneumoniae BS457]
 gi|303269332|ref|ZP_07355105.1| spoU rRNA methylase family protein [Streptococcus pneumoniae BS458]
 gi|147759146|gb|EDK66140.1| spoU rRNA methylase family protein [Streptococcus pneumoniae
           SP14-BS69]
 gi|183576562|gb|EDT97090.1| RNA methyltransferase, TrmH family, group 3 [Streptococcus
           pneumoniae CDC3059-06]
 gi|194356739|gb|ACF55187.1| RNA methyltransferase, TrmH family [Streptococcus pneumoniae G54]
 gi|225722127|gb|ACO17981.1| RNA methyltransferase, TrmH family, group 3 [Streptococcus
           pneumoniae 70585]
 gi|301802185|emb|CBW34931.1| SpoU rRNA methylase family protein [Streptococcus pneumoniae
           INV200]
 gi|302598630|gb|EFL65669.1| RNA methyltransferase, TrmH family protein [Streptococcus
           pneumoniae BS455]
 gi|302637313|gb|EFL67801.1| spoU rRNA methylase family protein [Streptococcus pneumoniae
           SP14-BS292]
 gi|302639996|gb|EFL70452.1| spoU rRNA methylase family protein [Streptococcus pneumoniae
           SP-BS293]
 gi|302641162|gb|EFL71536.1| spoU rRNA methylase family protein [Streptococcus pneumoniae BS458]
 gi|302642927|gb|EFL73226.1| spoU rRNA methylase family protein [Streptococcus pneumoniae BS457]
 gi|302646218|gb|EFL76445.1| spoU rRNA methylase family protein [Streptococcus pneumoniae BS397]
          Length = 242

 Score =  133 bits (334), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 74/240 (30%), Positives = 121/240 (50%), Gaps = 9/240 (3%)

Query: 48  NLFLYGVHTVSAAL-NNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVG 106
           N  +YGVH V+ AL  N   K++     +        +        +     +++ ++  
Sbjct: 4   NDIVYGVHAVTEALLANTGNKLYLQEDLRGKNVEKVKELATEKKVSISWTSKKSLSEMT- 62

Query: 107 KEAVHQGLALETAPLLSPTLDA------VRNSQLLMVLDHVNDPHNIGAILRSAVAFSCD 160
           + AVHQG  L  +      LD          + LL++LD + DPHN+G+ILR+A A +  
Sbjct: 63  EGAVHQGFVLRVSEFAYSELDYILAKTRQEENPLLLILDGLTDPHNLGSILRTADATNVS 122

Query: 161 GIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPL 220
           G+I  K  +   + V+AK+A+GA+EH+P  R++NL+  L K+   GF T G   +     
Sbjct: 123 GVIIPKHRTVGVTPVVAKTATGAIEHVPIARVTNLSQTLDKLKDEGFWTFGTDMNGTPCH 182

Query: 221 EQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
           +   K  KIALI+G EGKG+    ++    M  + M G +++LN S AAA+ +Y    + 
Sbjct: 183 KWNTK-GKIALIIGNEGKGISSNIKKQVDEMITIPMNGHVQSLNASVAAAILMYEVFRNR 241


>gi|315640649|ref|ZP_07895754.1| TrmH family RNA methyltransferase [Enterococcus italicus DSM 15952]
 gi|315483588|gb|EFU74079.1| TrmH family RNA methyltransferase [Enterococcus italicus DSM 15952]
          Length = 251

 Score =  133 bits (334), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 51/276 (18%), Positives = 102/276 (36%), Gaps = 26/276 (9%)

Query: 1   MNLISKKKSEKIFSLKDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAA 60
           M  +   K+  +  LK  H                   + +     +   L G H V  A
Sbjct: 1   ME-MQSTKNTYVKELKKLH-------------------RKKGRQDQQRYLLEGFHLVEEA 40

Query: 61  LNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAP 120
           +N+ +  +  L++ + A     W         V  V  + +  I  +      +A+   P
Sbjct: 41  VNSQAEVVDILISPRGAKEWAAWIEEQA--LDVTYVSEEVMAAISEQPTPQGIMAVVALP 98

Query: 121 LLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSA 180
                +  +R     ++LD+V DP N+G ++R+A A    G+   +  +   +    +S 
Sbjct: 99  R----VKEMRVKGKWLLLDNVQDPGNVGTMIRTADAAGFTGVFLGEGTADIYNLKTLRSM 154

Query: 181 SGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGL 240
            G+  HI     +                    ++     +   K D++ALI+G EG+G+
Sbjct: 155 QGSHFHIEIQNGTIQDICQVFKEVGIPVYGSELNEQAVAYDTVEKTDQVALIMGNEGQGV 214

Query: 241 RPKTQETATSMAHLHMPGIIKALNVSNAAAVALYIT 276
             +      +  ++ + G  ++LNV  AA + +Y  
Sbjct: 215 AKEILAQTDANLYIPIYGKAESLNVGIAAGILMYHF 250


>gi|312127730|ref|YP_003992604.1| tRNA/rRNA methyltransferase (SpoU) [Caldicellulosiruptor
           hydrothermalis 108]
 gi|311777749|gb|ADQ07235.1| tRNA/rRNA methyltransferase (SpoU) [Caldicellulosiruptor
           hydrothermalis 108]
          Length = 270

 Score =  133 bits (334), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 51/284 (17%), Positives = 117/284 (41%), Gaps = 26/284 (9%)

Query: 2   NLISKKKSEKIFSLKDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAAL 61
             IS +++E I  LK  H                     ++  +  +    G+  V  A+
Sbjct: 7   EFISSRENECIKRLKKLHDK-------------------KYREEFRSFITEGLKLVREAI 47

Query: 62  NNPSRKIFQLLATKNALARLDWD----ANLPHPFPVKTV--PPQTIDKIVGKEAVHQGLA 115
           +     I  ++ +++A  R          L     ++ V   P  + + +   +  QG+ 
Sbjct: 48  DYQIECINLVIFSQHAKDRYQEFYWECKRLLEDGKIERVIEVPDKLFEYITTTSTPQGIL 107

Query: 116 LETAPLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAV 175
            E   +    ++ ++N + ++V + + DP N+G ++R A AF  D ++TTK      +  
Sbjct: 108 AECNFVDKG-INFIKNLRRVVVANKLQDPGNLGTLIRCADAFGFDAVVTTKGTVDIYNPK 166

Query: 176 LAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGA 235
             ++  G+L H+  +R +     ++ +    F     +      + + + + +  +++G 
Sbjct: 167 TIRATMGSLFHLQIMREAEEGKLIKILKDNSFAVYVATPYGDIEISKIVPDKRFCVVIGN 226

Query: 236 EGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNH 279
           E +G+     + AT    + M G  ++LN + AA++ LY  +  
Sbjct: 227 ESEGVSDSFAKVATRKIKIPMAGKAESLNAAVAASIVLYELRKR 270


>gi|167768153|ref|ZP_02440206.1| hypothetical protein CLOSS21_02709 [Clostridium sp. SS2/1]
 gi|167709677|gb|EDS20256.1| hypothetical protein CLOSS21_02709 [Clostridium sp. SS2/1]
 gi|291560179|emb|CBL38979.1| rRNA methylases [butyrate-producing bacterium SSC/2]
          Length = 257

 Score =  133 bits (334), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 47/255 (18%), Positives = 104/255 (40%), Gaps = 7/255 (2%)

Query: 26  NHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDA 85
            ++  K++    + +R   + E   + G+   +     P   ++++ A+++     +   
Sbjct: 6   QNKQIKQIIKLKKSARERRKQELFLVEGIRMFTEI---PEEYLYKVYASEDF---YNEHR 59

Query: 86  NLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDHVNDPH 145
            +     V+ V PQ + +I         LAL      S      +   L +VL+++ DP 
Sbjct: 60  VIFEHMDVELVSPQVMKEISDTMTPQGVLALVKMMKYSLEDLLEQEKPLFLVLENLQDPG 119

Query: 146 NIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSW 205
           N+G ILR+      +G+I +       +  + +S  G++  +P++ + +L +  + M   
Sbjct: 120 NLGTILRTGEGAGINGVIMSHDTVDIYNPKVTRSTMGSIFRVPFVYVDDLLEVAETMKQK 179

Query: 206 GFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNV 265
              T     +      +E      A  +G EG GL  K  +       + M G +++LN 
Sbjct: 180 NIITYAAHLNGTDYT-KEDYQKGTAFFIGNEGNGLTDKLTDKVQKKIKIPMCGKVESLNA 238

Query: 266 SNAAAVALYITQNHF 280
           + A+ + +Y  +   
Sbjct: 239 AMASGLLVYEARRQR 253


>gi|293365120|ref|ZP_06611837.1| RNA methyltransferase [Streptococcus oralis ATCC 35037]
 gi|307702175|ref|ZP_07639135.1| spoU rRNA Methylase family protein [Streptococcus oralis ATCC
           35037]
 gi|291316570|gb|EFE57006.1| RNA methyltransferase [Streptococcus oralis ATCC 35037]
 gi|307624188|gb|EFO03165.1| spoU rRNA Methylase family protein [Streptococcus oralis ATCC
           35037]
          Length = 242

 Score =  133 bits (333), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 74/240 (30%), Positives = 122/240 (50%), Gaps = 9/240 (3%)

Query: 48  NLFLYGVHTVSAAL-NNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVG 106
           N  +YGVH V+ AL  N   K++     +        +        +     +++ ++  
Sbjct: 4   NDIVYGVHAVTEALLANTGNKLYLQEDLRGKNVEKVKELATEKKVSISWTSKKSLSEMT- 62

Query: 107 KEAVHQGLALETAPLLSPTLDA------VRNSQLLMVLDHVNDPHNIGAILRSAVAFSCD 160
           + AVHQG  L  +      LD          + LL++LD + DPHN+G+ILR+A A +  
Sbjct: 63  EGAVHQGFVLRVSEFAYSELDHILAKTRQEENPLLLILDGLTDPHNLGSILRTADATNVS 122

Query: 161 GIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPL 220
           G+I  K  +   + V+AK+A+GA+EH+P  R++NL+  L K+ + GF T G   +     
Sbjct: 123 GVIIPKHRAVGVTPVVAKTATGAIEHVPIARVTNLSQTLDKLKAEGFWTFGTDMNGTPCH 182

Query: 221 EQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
           +   K  KIALI+G EGKG+    ++    M  + M G +++LN S AAA+ +Y    + 
Sbjct: 183 KWNTK-GKIALIIGNEGKGISSNIKKQVDEMITIPMNGHVQSLNASVAAAILMYEVFRNR 241


>gi|257465576|ref|ZP_05629947.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Actinobacillus minor
           202]
 gi|257451236|gb|EEV25279.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Actinobacillus minor
           202]
          Length = 246

 Score =  133 bits (333), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 66/238 (27%), Positives = 106/238 (44%), Gaps = 9/238 (3%)

Query: 51  LYGVHTVSAALNNPSRKIFQLLATKNA-LARLDWDANLPH--PFPVKTVPPQTIDKIVGK 107
           +YG+H V A L+N   ++ ++   K     RL    N        ++ V  QT+D     
Sbjct: 5   IYGIHAVKAFLDNAPERLIEVFVLKGREDKRLIPLLNELQRLGIAIQQVNRQTLDNKSQG 64

Query: 108 EAVHQGLALETAPLLSPTLDAV-----RNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGI 162
           E     +A           D       ++  LL++LD V DPHN+GA LR+A A   D +
Sbjct: 65  EVHQGIIAKVVPQKELNEHDLDRILASKSQPLLLILDGVTDPHNLGACLRTADATGVDAV 124

Query: 163 ITTKRYSPSESAVLAKSASGALEHIPYIRISN-LTDALQKMHSWGFQTIGLSSDSKKPLE 221
           I  K  S   ++   K A GA E +P IR++N      +         +G + ++   + 
Sbjct: 125 IVPKDKSAQLTSTARKVACGAAETVPLIRVTNLARTMRELQEQHNVWIVGTAGEATSSIY 184

Query: 222 QEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNH 279
           +      IAL++GAEG G+R  T+E    +  + M G + +LNVS A  + L+     
Sbjct: 185 EAKLTGAIALVMGAEGDGMRRLTREHCDQLISIPMAGSVSSLNVSVATGICLFEIVRQ 242


>gi|261409539|ref|YP_003245780.1| TrmH family RNA methyltransferase [Paenibacillus sp. Y412MC10]
 gi|261286002|gb|ACX67973.1| RNA methyltransferase, TrmH family, group 3 [Paenibacillus sp.
           Y412MC10]
          Length = 256

 Score =  133 bits (333), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 67/246 (27%), Positives = 119/246 (48%), Gaps = 13/246 (5%)

Query: 46  PENLFLYGVHTVSAALNNPSRKIFQLLATKNALARL---DWDANLPHPFPVKTVPPQTID 102
            E   + G H+V+ AL +  R I ++   +NA   L              ++ V  + +D
Sbjct: 9   QEEEVVAGKHSVTEALKSG-RTINKIWIAENAQKHLTLPIIAEAKKLGIVIQHVDKRKLD 67

Query: 103 KIVGKEAVHQGLALETAPLLSPTLDA-------VRNSQLLMVLDHVNDPHNIGAILRSAV 155
           ++V     HQG+  + AP     +D              L++LD + DPHN+G+ILR+A 
Sbjct: 68  QMV-PGVQHQGVVAQAAPYAYVEVDDLLKAAEEKGEPPFLLLLDEIEDPHNLGSILRTAD 126

Query: 156 AFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSD 215
                G+I  KR S   +A ++K+++GA+E++P  R++NL   + ++   G   +G   D
Sbjct: 127 CTGAHGVILPKRRSAQITATVSKTSAGAVEYVPVARVTNLGQTIDQLKEMGVWVVGTVVD 186

Query: 216 SKKP-LEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
           + +   + E+ +  +A+++G E KG+    +E    +  L M G I +LN S AA V +Y
Sbjct: 187 AVQELYDTEVFDGPVAIVIGNENKGMGRLIREKCDVLVKLPMAGKINSLNASVAAGVVMY 246

Query: 275 ITQNHF 280
                 
Sbjct: 247 EVLRRR 252


>gi|16799350|ref|NP_469618.1| hypothetical protein lin0273 [Listeria innocua Clip11262]
 gi|16802287|ref|NP_463772.1| hypothetical protein lmo0241 [Listeria monocytogenes EGD-e]
 gi|47097641|ref|ZP_00235161.1| RNA methyltransferase, TrmH family, group 3 [Listeria monocytogenes
           str. 1/2a F6854]
 gi|226222870|ref|YP_002756977.1| Conserved hypothetical proteins like to B. subtilis YacO protein
           [Listeria monocytogenes Clip81459]
 gi|254825715|ref|ZP_05230716.1| RNA methyltransferase [Listeria monocytogenes FSL J1-194]
 gi|254828701|ref|ZP_05233388.1| RNA methyltransferase [Listeria monocytogenes FSL N3-165]
 gi|254831934|ref|ZP_05236589.1| hypothetical protein Lmon1_11295 [Listeria monocytogenes 10403S]
 gi|254900578|ref|ZP_05260502.1| hypothetical protein LmonJ_12209 [Listeria monocytogenes J0161]
 gi|254913471|ref|ZP_05263483.1| conserved hypothetical protein [Listeria monocytogenes J2818]
 gi|254932460|ref|ZP_05265819.1| RNA methyltransferase [Listeria monocytogenes HPB2262]
 gi|254937948|ref|ZP_05269645.1| RNA methyltransferase [Listeria monocytogenes F6900]
 gi|254991759|ref|ZP_05273949.1| hypothetical protein LmonocytoFSL_00582 [Listeria monocytogenes FSL
           J2-064]
 gi|255022535|ref|ZP_05294521.1| hypothetical protein LmonocyFSL_01634 [Listeria monocytogenes FSL
           J1-208]
 gi|255027363|ref|ZP_05299349.1| hypothetical protein LmonocytFSL_15268 [Listeria monocytogenes FSL
           J2-003]
 gi|255520315|ref|ZP_05387552.1| hypothetical protein LmonocFSL_03647 [Listeria monocytogenes FSL
           J1-175]
 gi|284800536|ref|YP_003412401.1| hypothetical protein LM5578_0283 [Listeria monocytogenes 08-5578]
 gi|284993722|ref|YP_003415490.1| hypothetical protein LM5923_0282 [Listeria monocytogenes 08-5923]
 gi|290892618|ref|ZP_06555611.1| RNA methyltransferase [Listeria monocytogenes FSL J2-071]
 gi|16409606|emb|CAD00768.1| lmo0241 [Listeria monocytogenes EGD-e]
 gi|16412702|emb|CAC95506.1| lin0273 [Listeria innocua Clip11262]
 gi|47013985|gb|EAL04998.1| RNA methyltransferase, TrmH family, group 3 [Listeria monocytogenes
           str. 1/2a F6854]
 gi|225875332|emb|CAS04029.1| Conserved hypothetical proteins like to B. subtilis YacO protein
           [Listeria monocytogenes serotype 4b str. CLIP 80459]
 gi|258601106|gb|EEW14431.1| RNA methyltransferase [Listeria monocytogenes FSL N3-165]
 gi|258610557|gb|EEW23165.1| RNA methyltransferase [Listeria monocytogenes F6900]
 gi|284056098|gb|ADB67039.1| hypothetical protein LM5578_0283 [Listeria monocytogenes 08-5578]
 gi|284059189|gb|ADB70128.1| hypothetical protein LM5923_0282 [Listeria monocytogenes 08-5923]
 gi|290557927|gb|EFD91448.1| RNA methyltransferase [Listeria monocytogenes FSL J2-071]
 gi|293584016|gb|EFF96048.1| RNA methyltransferase [Listeria monocytogenes HPB2262]
 gi|293591479|gb|EFF99813.1| conserved hypothetical protein [Listeria monocytogenes J2818]
 gi|293594959|gb|EFG02720.1| RNA methyltransferase [Listeria monocytogenes FSL J1-194]
 gi|328476082|gb|EGF46791.1| RNA methyltransferase, TrmH family [Listeria monocytogenes 220]
 gi|332310652|gb|EGJ23747.1| RNA methyltransferase, TrmH family [Listeria monocytogenes str.
           Scott A]
          Length = 251

 Score =  133 bits (333), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 63/248 (25%), Positives = 116/248 (46%), Gaps = 13/248 (5%)

Query: 43  TSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWD---ANLPHPFPVKTVPPQ 99
             + E  ++ G + V   L +  R I ++   + +   +              V+ VP Q
Sbjct: 2   EQENEQEWIGGRNPVLEVLRSD-RDIHKIYVQEGSQKGVLKQVLTLAKERKIQVQFVPKQ 60

Query: 100 TIDKIVGKEAVHQGLALETAPLLSPTLDA-------VRNSQLLMVLDHVNDPHNIGAILR 152
            I+K+V     HQG+A + A      LD               ++LD + DPHN+G+I+R
Sbjct: 61  KIEKVVS--GAHQGVAAQVAAYQYAELDDLFAAAEAKDEMPFFIILDELEDPHNLGSIMR 118

Query: 153 SAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGL 212
           +A +    GII  KR S   +  +AK+++GA+E++P +R++N+   ++++   G    G 
Sbjct: 119 TADSVGAHGIIIPKRRSVGLTQTVAKASTGAMEYVPVVRVTNMVRTMEELQKRGLWIFGT 178

Query: 213 SSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVA 272
            +           +  +A+++G+EG G+    +E    + HL M G + +LN S AA++ 
Sbjct: 179 DAKGSSDYRTMDVDMPLAIVIGSEGFGMSRLVREKCDFLVHLPMRGKVTSLNASVAASLL 238

Query: 273 LYITQNHF 280
           LY      
Sbjct: 239 LYEVYRKR 246


>gi|37528393|ref|NP_931738.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Photorhabdus
           luminescens subsp. laumondii TTO1]
 gi|52783299|sp|Q7MYU6|RLMB_PHOLL RecName: Full=23S rRNA (guanosine-2'-O-)-methyltransferase RlmB;
           AltName: Full=23S rRNA Gm2251 2'-O-methyltransferase
 gi|36787831|emb|CAE16946.1| unnamed protein product [Photorhabdus luminescens subsp. laumondii
           TTO1]
          Length = 244

 Score =  133 bits (333), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 71/243 (29%), Positives = 113/243 (46%), Gaps = 10/243 (4%)

Query: 48  NLFLYGVHTVSAALNNPSRKIFQLLATKNA-LARLDWDANLPHPF--PVKTVPPQTIDKI 104
           +  +YG+H V A L    ++  ++   K     RL    +        ++    Q +D  
Sbjct: 2   SEIIYGIHAVKALLERDPQRFIEVYVLKGREDRRLTPLIHALESIGMTIQLANRQWLDNQ 61

Query: 105 VGKEAVHQGLALETAPLLSP------TLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFS 158
             + AVHQG+  +  P           L A   +  L+VLD V DPHN+GA LRSA A  
Sbjct: 62  T-EGAVHQGIIAKVKPGRQYQENDLPDLLAQVETPFLLVLDGVTDPHNLGACLRSADAAG 120

Query: 159 CDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKK 218
              +I  +  S   +A   K A GA E +P IR++NL   L+ +  +    +G + ++  
Sbjct: 121 VHAVIIPRDRSAQLNATAKKVACGAAESVPLIRVTNLARTLRLLQEYNIWVVGTAGEADH 180

Query: 219 PLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQN 278
            L Q      +AL++GAEG+G+R  T+E    +  + M G + +LNVS A  V L+    
Sbjct: 181 TLYQSKLTGPMALVMGAEGEGMRRLTREHCDELISIPMVGSVSSLNVSVATGVCLFEAVR 240

Query: 279 HFA 281
             +
Sbjct: 241 QRS 243


>gi|319651786|ref|ZP_08005912.1| 23S rRNA methyltransferase [Bacillus sp. 2_A_57_CT2]
 gi|317396605|gb|EFV77317.1| 23S rRNA methyltransferase [Bacillus sp. 2_A_57_CT2]
          Length = 250

 Score =  133 bits (333), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 57/278 (20%), Positives = 107/278 (38%), Gaps = 29/278 (10%)

Query: 1   MNLISKKKSEKIFSLKDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAA 60
           +  I   K+ KI   K                        +   + E   + G H V  A
Sbjct: 2   LKHIQSAKNPKIKEWKKLLTK-------------------KERDKTETFLVEGFHLVEEA 42

Query: 61  LNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAP 120
           L      I +++ ++N      WD       PV  V  + I ++   E      A     
Sbjct: 43  LKANQ--IAEIIISENKDMPPGWDY---GDIPVTMVTEEIIGQLADTETPQGIFA--VCS 95

Query: 121 LLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSA 180
               + +      LL+  D V DP N+G ++R+A A   D +I  +    + +  + +SA
Sbjct: 96  QEPSSEEVKGKRFLLI--DAVQDPGNLGTMIRTADAAGIDAVIVGEGSVDAYNPKVLRSA 153

Query: 181 SGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGL 240
            G+  H+P +R +      +   S          ++++  + E  +D  AL++G EG G+
Sbjct: 154 QGSHFHLPVLRGNLSDWIGRLKESKVPVYGTALENAREYTKYES-SDSFALLVGNEGNGV 212

Query: 241 RPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQN 278
             +      +  ++ + G  ++LNV+ AA + LY  + 
Sbjct: 213 NKELLANTAANLYIPIFGKSESLNVAVAAGILLYHLRK 250


>gi|238923439|ref|YP_002936955.1| RNA methyltransferase, TrmH family, group 3 [Eubacterium rectale
           ATCC 33656]
 gi|238875114|gb|ACR74821.1| RNA methyltransferase, TrmH family, group 3 [Eubacterium rectale
           ATCC 33656]
          Length = 263

 Score =  133 bits (333), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 41/256 (16%), Positives = 93/256 (36%), Gaps = 4/256 (1%)

Query: 26  NHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDA 85
           +++  K +Q+   K++   +     + G      A   P   +  +  +++      +  
Sbjct: 6   SNKSIKNVQALLSKAKERKKQGVFVVEGPKMSFEA---PYDWVSAVYMSESFFNDDRFKE 62

Query: 86  NLPHPF-PVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDHVNDP 144
                    + V       +   +     LA+   P          +   L+VL+ + DP
Sbjct: 63  EKKRFLDKTEIVSDSVFKSMSDTQTPQGVLAIVKMPHYEIDELFKGDKTELLVLESIQDP 122

Query: 145 HNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHS 204
            N+G ++R+       GII  +      +    +S  G+L  +P+    +L + ++   S
Sbjct: 123 GNLGTMVRTGEGAGVSGIIMNRTTVDIFNPKTVRSTMGSLYRVPFYITDDLPETIEYAKS 182

Query: 205 WGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALN 264
            G          K   ++         ++G EG GL  +  + A +   + M G +++LN
Sbjct: 183 KGVSLYAAHLKGKCSYDRPDYTGACGFMIGNEGNGLSDEIADMADTYIRIPMEGAVESLN 242

Query: 265 VSNAAAVALYITQNHF 280
            + +A + +Y      
Sbjct: 243 AAISATLLMYECNRQR 258


>gi|152999247|ref|YP_001364928.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Shewanella baltica
           OS185]
 gi|160873860|ref|YP_001553176.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Shewanella baltica
           OS195]
 gi|304411189|ref|ZP_07392804.1| RNA methyltransferase, TrmH family, group 3 [Shewanella baltica
           OS183]
 gi|307306484|ref|ZP_07586227.1| RNA methyltransferase, TrmH family, group 3 [Shewanella baltica
           BA175]
 gi|151363865|gb|ABS06865.1| RNA methyltransferase, TrmH family, group 3 [Shewanella baltica
           OS185]
 gi|160859382|gb|ABX47916.1| RNA methyltransferase, TrmH family, group 3 [Shewanella baltica
           OS195]
 gi|304350382|gb|EFM14785.1| RNA methyltransferase, TrmH family, group 3 [Shewanella baltica
           OS183]
 gi|306910775|gb|EFN41203.1| RNA methyltransferase, TrmH family, group 3 [Shewanella baltica
           BA175]
 gi|315266087|gb|ADT92940.1| RNA methyltransferase, TrmH family, group 3 [Shewanella baltica
           OS678]
          Length = 246

 Score =  133 bits (333), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 63/244 (25%), Positives = 110/244 (45%), Gaps = 10/244 (4%)

Query: 46  PENLFLYGVHTVSAALNNPSRKIFQLLATKNALAR---LDWDANLPHPFPVKTVPPQTID 102
            +   ++G+H V A L +   +I +L   +        +  +        ++    + +D
Sbjct: 2   KKQDIIFGIHAVEALLKHSPERIIELWLLQGRDDERLTVLANQAKAFGTTIQVASRKALD 61

Query: 103 KIVGKEAVHQGLALET------APLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVA 156
               + + HQG+                 L A      L++LD V DPHN+GA LR+A A
Sbjct: 62  DKA-ESSQHQGIVARVKAAKVLNEQDLDVLLANTEQPFLLILDGVTDPHNLGACLRNADA 120

Query: 157 FSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDS 216
               GII  K  S   +A ++K A GA E +P  +++NL   ++ +   G   +G + ++
Sbjct: 121 AGVQGIIVPKDNSVGLTATVSKVACGAAETVPLFQVTNLARTMRHLQDKGVWIVGTAGEA 180

Query: 217 KKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYIT 276
              L Q      +A+ +GAE KGLR  ++E+  S+  + M G + +LNVS A  + L+  
Sbjct: 181 DCELYQADLKGPLAIAMGAEDKGLRRLSRESCDSLISIPMAGSVSSLNVSVATGICLFEA 240

Query: 277 QNHF 280
               
Sbjct: 241 VRQR 244


>gi|148259103|ref|YP_001233230.1| RNA methyltransferase [Acidiphilium cryptum JF-5]
 gi|146400784|gb|ABQ29311.1| RNA methyltransferase, TrmH family, group 3 [Acidiphilium cryptum
           JF-5]
          Length = 276

 Score =  133 bits (333), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 104/275 (37%), Positives = 153/275 (55%), Gaps = 2/275 (0%)

Query: 6   KKKSEKIFSLKDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPS 65
            K+     +     +   R  H   +      +  R  S    L+LYG+H+V AAL NP+
Sbjct: 2   DKRDSHGKAGNGGRHKLPRGPHPHRRPQGDAPRDRRPASSAGGLWLYGLHSVEAALANPA 61

Query: 66  RKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPT 125
           R++ +L+ T+   A L      P P   + +    +D+++G+  VHQG+AL+  PL+ P+
Sbjct: 62  RRLRRLVVTEEGEAALAGRLPHPWPIQPERIERDRLDQMLGRGIVHQGVALQADPLVPPS 121

Query: 126 L-DAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGAL 184
           L DA++    ++VLD + DP N+GAILRSA AF    +I  +R +P E   LAK+ASGAL
Sbjct: 122 LNDALKRPGPVLVLDQITDPRNVGAILRSAQAFGAAMVIAQERNAPEEGGALAKAASGAL 181

Query: 185 EHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKP-LEQEIKNDKIALILGAEGKGLRPK 243
           E IP +R  N+  AL  + + G   +GL +          I N + AL+LGAEG+GLR  
Sbjct: 182 ERIPLLRTVNIARALIALKAAGLWVMGLDAAGLSHLSRDAIGNRRAALVLGAEGEGLRRL 241

Query: 244 TQETATSMAHLHMPGIIKALNVSNAAAVALYITQN 278
           T+ET   +  L MPG +++LNVS AAAVALY    
Sbjct: 242 TRETCDELVSLPMPGGMESLNVSAAAAVALYEIIR 276


>gi|330960080|gb|EGH60340.1| TrmH family RNA methyltransferase [Pseudomonas syringae pv.
           maculicola str. ES4326]
          Length = 250

 Score =  133 bits (333), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 72/239 (30%), Positives = 112/239 (46%), Gaps = 8/239 (3%)

Query: 51  LYGVHTVSAALNNPSRKIFQLLATKNA-LARLDWDANLPHPFPVKTVPPQTIDKIVGKEA 109
           +YGVH V A L +  +++  +   +     R+     L     V     +  +     E 
Sbjct: 7   IYGVHAVEALLRHHPKRVKHIWLAEGRNDPRVQTLVALASENRVTIGQAERREMDAWVEG 66

Query: 110 VHQGLALETAPLLSP-------TLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGI 162
           VHQG+  + +P            LD      LL+VLD V DPHN+GA LR+A A     +
Sbjct: 67  VHQGVVADVSPSQVWGEAMLEELLDRSEGPPLLLVLDGVTDPHNLGACLRTADAAGALAV 126

Query: 163 ITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQ 222
           I  K  S + +  + K A GA E IP + ++NL   L+K+   G   +G + +++  L Q
Sbjct: 127 IVPKDKSATLTPAVRKVACGAAEVIPLVAVTNLARTLEKLQQRGLWVVGTAGEAEVELYQ 186

Query: 223 EIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHFA 281
           +       +I+GAEGKG+R  T+E    +  L M G + +LNVS A  V L+      +
Sbjct: 187 QDLTGPTIIIMGAEGKGMRRLTREHCDYLVRLPMAGSVSSLNVSVATGVCLFEALRQRS 245


>gi|330873777|gb|EGH07926.1| RNA methyltransferase [Pseudomonas syringae pv. morsprunorum str.
           M302280PT]
 gi|330965990|gb|EGH66250.1| RNA methyltransferase [Pseudomonas syringae pv. actinidiae str.
           M302091]
          Length = 253

 Score =  133 bits (333), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 72/239 (30%), Positives = 112/239 (46%), Gaps = 8/239 (3%)

Query: 51  LYGVHTVSAALNNPSRKIFQLLATKNA-LARLDWDANLPHPFPVKTVPPQTIDKIVGKEA 109
           +YGVH V A L +  +++  +   +     R+     L     V     +  +     E 
Sbjct: 7   IYGVHAVEALLRHHPKRVKHIWLAEGRNDPRVQTLVALASENRVTIGQAERREMDAWVEG 66

Query: 110 VHQGLALETAPLLSP-------TLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGI 162
           VHQG+  + +P            LD      LL+VLD V DPHN+GA LR+A A     +
Sbjct: 67  VHQGVVADVSPSQVWGEAMLDELLDRSEGPPLLLVLDGVTDPHNLGACLRTADAAGALAV 126

Query: 163 ITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQ 222
           I  K  S + +  + K A GA E IP + ++NL   L+K+   G   +G + +++  L Q
Sbjct: 127 IVPKDKSATLTPAVRKVACGAAEVIPLVAVTNLARTLEKLQQRGLWVVGTAGEAEVELYQ 186

Query: 223 EIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHFA 281
           +       +I+GAEGKG+R  T+E    +  L M G + +LNVS A  V L+      +
Sbjct: 187 QDLTGPTIIIMGAEGKGMRRLTREHCDYLVRLPMAGSVSSLNVSVATGVCLFEALRQRS 245


>gi|330501633|ref|YP_004378502.1| RNA methyltransferase [Pseudomonas mendocina NK-01]
 gi|328915919|gb|AEB56750.1| RNA methyltransferase [Pseudomonas mendocina NK-01]
          Length = 250

 Score =  133 bits (333), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 77/240 (32%), Positives = 116/240 (48%), Gaps = 12/240 (5%)

Query: 51  LYGVHTVSAALNNPSRKIFQLLATKNALARLDW---DANLPHPFPVKTVPPQTIDKIVGK 107
           +YGVH V A L +  +++ QL   ++  A       +    +  PV     Q +D+    
Sbjct: 7   VYGVHAVEALLRHHPKRVKQLWLAESRQAPRIQPMLELAAQNRVPVGHKERQELDEWA-- 64

Query: 108 EAVHQGLALETAPLLSP-------TLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCD 160
           E VHQG+  E +P            L+      LL+VLD V DPHN+GA LR+A A    
Sbjct: 65  EGVHQGVVAEVSPSQVWGENMLDELLERSEGVPLLLVLDGVTDPHNLGACLRTADAAGAQ 124

Query: 161 GIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPL 220
            +I  K  S + +A + K A GA E IP + ++NL   L+K+   G   +G + + ++ L
Sbjct: 125 AVIVPKDKSATLNATVRKVACGAAEVIPLVAVTNLARTLEKLQKKGLWVVGTAGEVEQEL 184

Query: 221 EQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
            Q        L++GAEGKG+R  T+E    +  L M G + +LNVS A  V L+      
Sbjct: 185 YQLDMTGPTVLVMGAEGKGMRRLTREHCDYLVKLPMGGSVSSLNVSVATGVCLFEAVRQR 244


>gi|291528003|emb|CBK93589.1| rRNA methylase, putative, group 3 [Eubacterium rectale M104/1]
          Length = 255

 Score =  133 bits (333), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 53/241 (21%), Positives = 101/241 (41%), Gaps = 9/241 (3%)

Query: 50  FLYGVHTVSAALNNPSR--KIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIV-- 105
           ++ G + V  A  +     K+F L   ++   +        H   +  V  + +D++   
Sbjct: 13  YIEGRNAVLEAFRSGKTIDKLFVLDGCQDGPIKSITREARKHDAIINYVAKERLDQMSET 72

Query: 106 ----GKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDG 161
               G  AV           +    +       +++LD + DPHN+GAI+R+A      G
Sbjct: 73  GKHQGVIAVSAAYEYAEVSDILENAERKGEPPFIIILDGIEDPHNLGAIIRTANQAGAHG 132

Query: 162 IITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLE 221
           II  KR +   +  +AK+++GA+ + P  +++N+++ ++++   G   +         + 
Sbjct: 133 IIIPKRRAVGLTPTVAKTSAGAINYTPVAKVTNISNTIKELKEKGMWFVCA-DMGGTTMY 191

Query: 222 QEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHFA 281
                  I L++G EG G+    +E     A + M G I +LN S A  V  Y       
Sbjct: 192 DLNLTGPIGLVIGNEGDGVSKLVKENCDMTASIPMVGDIDSLNASVATGVFAYEIVRQRL 251

Query: 282 K 282
           K
Sbjct: 252 K 252


>gi|213967932|ref|ZP_03396078.1| RNA methyltransferase, TrmH family, group 3 [Pseudomonas syringae
           pv. tomato T1]
 gi|301383751|ref|ZP_07232169.1| RNA methyltransferase [Pseudomonas syringae pv. tomato Max13]
 gi|302059274|ref|ZP_07250815.1| RNA methyltransferase [Pseudomonas syringae pv. tomato K40]
 gi|302132342|ref|ZP_07258332.1| RNA methyltransferase [Pseudomonas syringae pv. tomato NCPPB 1108]
 gi|213927275|gb|EEB60824.1| RNA methyltransferase, TrmH family, group 3 [Pseudomonas syringae
           pv. tomato T1]
          Length = 253

 Score =  133 bits (333), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 72/239 (30%), Positives = 112/239 (46%), Gaps = 8/239 (3%)

Query: 51  LYGVHTVSAALNNPSRKIFQLLATKNA-LARLDWDANLPHPFPVKTVPPQTIDKIVGKEA 109
           +YGVH V A L +  +++  +   +     R+     L     V     +  +     E 
Sbjct: 7   IYGVHAVEALLRHHPKRVKHIWLAEGRNDPRVQTLVALASENRVTIGQAERREMDAWVEG 66

Query: 110 VHQGLALETAPLLSP-------TLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGI 162
           VHQG+  + +P            LD      LL+VLD V DPHN+GA LR+A A     +
Sbjct: 67  VHQGVVADVSPSQVWGEAMLDELLDRSEGPPLLLVLDGVTDPHNLGACLRTADAAGALAV 126

Query: 163 ITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQ 222
           I  K  S + +  + K A GA E IP + ++NL   L+K+   G   +G + +++  L Q
Sbjct: 127 IVPKDKSATLTPAVRKVACGAAEVIPLVAVTNLARTLEKLQQRGLWVVGTAGEAEVELYQ 186

Query: 223 EIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHFA 281
           +       +I+GAEGKG+R  T+E    +  L M G + +LNVS A  V L+      +
Sbjct: 187 QDLTGPTIIIMGAEGKGMRRLTREHCDYLVRLPMAGSVSSLNVSVATGVCLFEALRQRS 245


>gi|28872048|ref|NP_794667.1| TrmH family RNA methyltransferase [Pseudomonas syringae pv. tomato
           str. DC3000]
 gi|52783312|sp|Q87VK2|RLMB_PSESM RecName: Full=23S rRNA (guanosine-2'-O-)-methyltransferase RlmB;
           AltName: Full=23S rRNA Gm2251 2'-O-methyltransferase
 gi|28855301|gb|AAO58362.1| RNA methyltransferase, TrmH family, group 3 [Pseudomonas syringae
           pv. tomato str. DC3000]
 gi|331014619|gb|EGH94675.1| RNA methyltransferase, TrmH family, group 3 [Pseudomonas syringae
           pv. lachrymans str. M302278PT]
          Length = 250

 Score =  133 bits (333), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 72/239 (30%), Positives = 112/239 (46%), Gaps = 8/239 (3%)

Query: 51  LYGVHTVSAALNNPSRKIFQLLATKNA-LARLDWDANLPHPFPVKTVPPQTIDKIVGKEA 109
           +YGVH V A L +  +++  +   +     R+     L     V     +  +     E 
Sbjct: 7   IYGVHAVEALLRHHPKRVKHIWLAEGRNDPRVQTLVALASENRVTIGQAERREMDAWVEG 66

Query: 110 VHQGLALETAPLLSP-------TLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGI 162
           VHQG+  + +P            LD      LL+VLD V DPHN+GA LR+A A     +
Sbjct: 67  VHQGVVADVSPSQVWGEAMLDELLDRSEGPPLLLVLDGVTDPHNLGACLRTADAAGALAV 126

Query: 163 ITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQ 222
           I  K  S + +  + K A GA E IP + ++NL   L+K+   G   +G + +++  L Q
Sbjct: 127 IVPKDKSATLTPAVRKVACGAAEVIPLVAVTNLARTLEKLQQRGLWVVGTAGEAEVELYQ 186

Query: 223 EIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHFA 281
           +       +I+GAEGKG+R  T+E    +  L M G + +LNVS A  V L+      +
Sbjct: 187 QDLTGPTIIIMGAEGKGMRRLTREHCDYLVRLPMAGSVSSLNVSVATGVCLFEALRQRS 245


>gi|238021416|ref|ZP_04601842.1| hypothetical protein GCWU000324_01316 [Kingella oralis ATCC 51147]
 gi|237868396|gb|EEP69402.1| hypothetical protein GCWU000324_01316 [Kingella oralis ATCC 51147]
          Length = 250

 Score =  133 bits (333), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 68/243 (27%), Positives = 114/243 (46%), Gaps = 9/243 (3%)

Query: 46  PENLFLYGVHTVSAALNNPSRKIFQLLATKN---ALARLDWDANLPHPFPVKTVPPQTID 102
                +YG H V+A L    + I +L   +N   A  R   +        V       ++
Sbjct: 2   SNQRLIYGFHAVNARLWQNPKSIVELYVLENKNDARTREVLEKAAAEKVRVHFADMNRLN 61

Query: 103 KIVGKEAVHQGLALET-----APLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAF 157
            I  K A HQG+            L   L+ +R    L+VLD + DPHN+GA LR+A A 
Sbjct: 62  TIA-KGARHQGVVGFIDASKNHVHLEDVLENLREPAFLLVLDGITDPHNLGACLRTADAM 120

Query: 158 SCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSK 217
               +I  K  S   +A ++K A GA E +PYI ++NL   L+++  +G   +G   D +
Sbjct: 121 GVHAVIAPKDKSAGLNATVSKVACGAAETVPYITVTNLARTLRELKEYGIWVVGTDMDGE 180

Query: 218 KPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQ 277
             L      + +A ++G EG G+R  T+E   ++  + M G ++++N+S +A + +  T+
Sbjct: 181 ADLFHYDIPENVAWVMGNEGDGMRRLTREHCDALVSIPMFGTVESMNISVSAGMVMAETR 240

Query: 278 NHF 280
              
Sbjct: 241 RQR 243


>gi|332283859|ref|YP_004415770.1| tRNA/rRNA methyltransferase [Pusillimonas sp. T7-7]
 gi|330427812|gb|AEC19146.1| tRNA/rRNA methyltransferase [Pusillimonas sp. T7-7]
          Length = 249

 Score =  133 bits (333), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 66/242 (27%), Positives = 113/242 (46%), Gaps = 10/242 (4%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLA---TKNALARLDWDANLPHPFPVKTVPPQTIDKIVG 106
            L G H V A L +    I +L      ++   +   +        V+ VP + +D +  
Sbjct: 6   VLAGFHAVVARLRHAPDSIKELYVEASRRDKRMQTFIEQAQAANIRVRPVPAERLDGLAR 65

Query: 107 KEAVHQGLALETAPLLSPT-------LDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSC 159
                  +AL  A  ++         L+      LL++LD V DPHN+GA LR+A A   
Sbjct: 66  GTRHQGVVALAEAREIAADVDEVLDLLEDKSEPALLLILDSVTDPHNLGACLRTADAAGV 125

Query: 160 DGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKP 219
             +I  +  +   ++ + + A GA E +PYI ++NL   ++++ S     +G    +   
Sbjct: 126 HAVIAPRDKAVGLNSTVQRVACGAAETVPYIMVTNLARTMRQLKSRDVWLVGTDDQATGS 185

Query: 220 LEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNH 279
           L Q      +A ++GAEG+G+R  T+ET   +  + M G +++LNVS A+AV LY +   
Sbjct: 186 LHQVDARRPMAWVMGAEGEGMRRLTRETCDELVTIPMLGSVESLNVSVASAVCLYESVRQ 245

Query: 280 FA 281
             
Sbjct: 246 RT 247


>gi|328944843|gb|EGG39003.1| RNA methyltransferase [Streptococcus sanguinis SK1087]
          Length = 242

 Score =  133 bits (333), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 71/242 (29%), Positives = 118/242 (48%), Gaps = 9/242 (3%)

Query: 46  PENLFLYGVHTVSAALNNP-SRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKI 104
            +N  +YGVH V+ AL      K++     +        D        +   P +T+ ++
Sbjct: 2   EKNDIVYGVHAVTEALAANTGNKLYIQDDLRGKKVDKIKDLAAEKKVSISWTPKKTLQEM 61

Query: 105 VGKEAVHQGLALETAPLLSPTLD------AVRNSQLLMVLDHVNDPHNIGAILRSAVAFS 158
               AVHQG  L  A       +         ++ LL++LD + DPHN+G+ILR+A A +
Sbjct: 62  TD-GAVHQGFVLRVAEFAYTDFEVLLKKAEQEDNPLLLILDGLTDPHNLGSILRTADATN 120

Query: 159 CDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKK 218
             G+I  K  +   + V+AK+++GA+EHIP  R++NL+  L K+   GF   G       
Sbjct: 121 VAGVIIPKHRAVGVTPVVAKTSTGAIEHIPIARVTNLSQTLGKLKEAGFWIFGTDMQGTP 180

Query: 219 PLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQN 278
             +      K+AL++G EGKG+    ++    M  + M G +++LN S AAA+ +Y    
Sbjct: 181 SHKWNTA-GKLALVIGNEGKGISSNIKKQVDEMISIPMNGHVQSLNASVAAAILMYEVFR 239

Query: 279 HF 280
           + 
Sbjct: 240 NR 241


>gi|331266684|ref|YP_004326314.1| TrmH family RNA methyltransferase group 3 [Streptococcus oralis
           Uo5]
 gi|326683356|emb|CBZ00974.1| TrmH family RNA methyltransferase group 3 [Streptococcus oralis
           Uo5]
          Length = 260

 Score =  133 bits (333), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 74/240 (30%), Positives = 121/240 (50%), Gaps = 9/240 (3%)

Query: 48  NLFLYGVHTVSAAL-NNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVG 106
           N  +YGVH V+ AL  N   K++     +        +        +     +++ ++  
Sbjct: 4   NDIVYGVHAVTEALLANTGNKLYLQEDLRGKNVEKVKELATEKKVSISWTSKKSLSEMT- 62

Query: 107 KEAVHQGLALETAPLLSPTLDA------VRNSQLLMVLDHVNDPHNIGAILRSAVAFSCD 160
           + AVHQG  L  +      LD          + LL++LD + DPHN+G+ILR+A A +  
Sbjct: 63  EGAVHQGFVLRVSEFAYSELDHILAKTRQEENPLLLILDGLTDPHNLGSILRTADATNVS 122

Query: 161 GIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPL 220
           G+I  K  +   + V+AK+A+GA+EH+P  R++NL+  L K+   GF T G   +     
Sbjct: 123 GVIIPKHRAVGVTPVVAKTATGAIEHVPIARVTNLSQTLDKLKDEGFWTFGTDMNGTPCH 182

Query: 221 EQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
           +   K  KIALI+G EGKG+    ++    M  + M G +++LN S AAA+ +Y    + 
Sbjct: 183 KWNTK-GKIALIIGNEGKGISSNIKKQVDEMITIPMNGHVQSLNASVAAAILMYEVFRNR 241


>gi|307608839|emb|CBW98231.1| hypothetical protein LPW_00911 [Legionella pneumophila 130b]
          Length = 249

 Score =  133 bits (333), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 76/242 (31%), Positives = 123/242 (50%), Gaps = 9/242 (3%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLATKNALA-RLDWDANLPHP--FPVKTVPPQTIDKIVG 106
           ++YG+H VSA L NP R I +L   ++ +  RL            P++ +  Q +++   
Sbjct: 5   YVYGLHAVSALLANPHRMIKKLFVNQDRIDKRLHEFLIKAENAHVPIEKLSAQKMNQQFS 64

Query: 107 KEAVHQGLALETAPLLSPT------LDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCD 160
           +      +AL +A            L+  +   L+++LD + DPHN+GA LRSA A   D
Sbjct: 65  EFTHQGVVALASALPEYGESDLVTLLERSKKPVLILILDGITDPHNLGACLRSADATGVD 124

Query: 161 GIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPL 220
            ++  K  S S + V++K A GA E IP +R++NL  A+  +   G    G + +++  L
Sbjct: 125 FVVIPKDKSASITPVVSKVACGAAESIPLVRVTNLARAMDILKQQGVWIFGAAGEAEHLL 184

Query: 221 EQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
                +  IAL++GAEG GLR  T+E    +  L M G +++LNVS A  V+LY      
Sbjct: 185 YAMDCSGNIALVMGAEGTGLRRLTREHCDGLFSLPMMGSVESLNVSVATGVSLYEVIRQR 244

Query: 281 AK 282
            +
Sbjct: 245 GQ 246


>gi|327468344|gb|EGF13829.1| RNA methyltransferase [Streptococcus sanguinis SK330]
          Length = 242

 Score =  133 bits (333), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 72/242 (29%), Positives = 119/242 (49%), Gaps = 9/242 (3%)

Query: 46  PENLFLYGVHTVSAALNNP-SRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKI 104
            +N  +YGVH V+ AL      K++     +        D        +   P +T+ ++
Sbjct: 2   EKNDIVYGVHAVTEALAANTGNKLYIQDDLRGKKVDKIKDLAAEKKVSISWTPKKTLQEM 61

Query: 105 VGKEAVHQGLALETAPLLSPTLD------AVRNSQLLMVLDHVNDPHNIGAILRSAVAFS 158
               AVHQG  L  A       +        +++ LL++LD + DPHN+G+ILR+A A +
Sbjct: 62  TD-GAVHQGFVLRVAEFAYTDFEVLLKKAEQKDNPLLLILDGLTDPHNLGSILRTADATN 120

Query: 159 CDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKK 218
             G+I  K  +   + V+AK+++GA+EHIP  R++NL+  L K+   GF   G       
Sbjct: 121 VAGVIIPKHRAVGVTPVVAKTSTGAIEHIPIARVTNLSQTLDKLKEAGFWIFGTDMQGTP 180

Query: 219 PLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQN 278
             +      K+ALI+G EGKG+    ++    M  + M G +++LN S AAA+ +Y    
Sbjct: 181 SHKWNTA-GKLALIIGNEGKGISSNIKKQVDEMISIPMNGHVQSLNASVAAAILMYEVFR 239

Query: 279 HF 280
           + 
Sbjct: 240 NR 241


>gi|166030706|ref|ZP_02233535.1| hypothetical protein DORFOR_00380 [Dorea formicigenerans ATCC
           27755]
 gi|166029498|gb|EDR48255.1| hypothetical protein DORFOR_00380 [Dorea formicigenerans ATCC
           27755]
          Length = 264

 Score =  133 bits (333), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 45/259 (17%), Positives = 100/259 (38%), Gaps = 5/259 (1%)

Query: 26  NHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDA 85
           ++   K++ +  +K +   +     + G+        +   +++      N   +     
Sbjct: 6   SNAKVKRLVNLKKKKKLRDEEGVFLVEGIRMFREVPKDRLVEVYASEEFWNRERKAVEQV 65

Query: 86  NLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNS----QLLMVLDHV 141
                   + +     + +       QG+            + V+       LL+VLD +
Sbjct: 66  LAGTKVQPEILADFVFEYVSD-TKTPQGILCLVRQKQYSITEIVKEKGGELPLLLVLDQI 124

Query: 142 NDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQK 201
            DP N+G I+R+A      GI+ ++      +  + +S  GA   +P+  + +L + +++
Sbjct: 125 QDPGNLGTIVRTAEGAGVTGIVMSQDCVDMYNPKVVRSTMGAAYRVPFCYVDDLAEEVKQ 184

Query: 202 MHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIK 261
           M   G  T     + K   ++E      A ++G EG GLR +  + A     + M G ++
Sbjct: 185 MKEAGICTYAAHLEGKNSYDEEDYRKASAFLIGNEGNGLRDEVADQAQVYIRIPMKGQVE 244

Query: 262 ALNVSNAAAVALYITQNHF 280
           +LN + A A+  +      
Sbjct: 245 SLNAAVATAILTFEAARQR 263


>gi|317499626|ref|ZP_07957888.1| SpoU rRNA methylase [Lachnospiraceae bacterium 5_1_63FAA]
 gi|316893101|gb|EFV15321.1| SpoU rRNA methylase [Lachnospiraceae bacterium 5_1_63FAA]
          Length = 261

 Score =  133 bits (333), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 47/255 (18%), Positives = 104/255 (40%), Gaps = 7/255 (2%)

Query: 26  NHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDA 85
            ++  K++    + +R   + E   + G+   +     P   ++++ A+++     +   
Sbjct: 10  QNKQIKQIIKLKKSARERRKQELFLVEGIRMFTEI---PEEYLYKVYASEDF---YNEHR 63

Query: 86  NLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDHVNDPH 145
            +     V+ V PQ + +I         LAL      S      +   L +VL+++ DP 
Sbjct: 64  VIFEHMDVELVSPQVMKEISDTMTPQGVLALVKMMKYSLEDLLEQEKPLFLVLENLQDPG 123

Query: 146 NIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSW 205
           N+G ILR+      +G+I +       +  + +S  G++  +P++ + +L +  + M   
Sbjct: 124 NLGTILRTGEGAGINGVIMSHDTVDIYNPKVTRSTMGSIFRVPFVYVDDLLEVAETMKQK 183

Query: 206 GFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNV 265
              T     +      +E      A  +G EG GL  K  +       + M G +++LN 
Sbjct: 184 NIITYAAHLNGTDYT-KEDYQKGTAFFIGNEGNGLTDKLTDKVQKKIKIPMCGKVESLNA 242

Query: 266 SNAAAVALYITQNHF 280
           + A+ + +Y  +   
Sbjct: 243 AMASGLLVYEARRQR 257


>gi|116871624|ref|YP_848405.1| RNA methyltransferase [Listeria welshimeri serovar 6b str.
           SLCC5334]
 gi|116740502|emb|CAK19622.1| RNA methyltransferase, TrmH family, group 3 [Listeria welshimeri
           serovar 6b str. SLCC5334]
          Length = 251

 Score =  133 bits (333), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 62/248 (25%), Positives = 116/248 (46%), Gaps = 13/248 (5%)

Query: 43  TSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWD---ANLPHPFPVKTVPPQ 99
             + E  ++ G + V   L +  R I ++   + +   +              V+ VP Q
Sbjct: 2   EQENEQEWIGGRNPVLEVLRS-ERDIHKIYVQEGSQKGVLKQVLTLAKERKIQVQFVPKQ 60

Query: 100 TIDKIVGKEAVHQGLALETAPLLSPTLDA-------VRNSQLLMVLDHVNDPHNIGAILR 152
            I+K+V     HQG+A + A      LD               ++LD + DPHN+G+I+R
Sbjct: 61  KIEKVVS--GAHQGVAAQVAAYQYAELDDLFAAAEAKDEMPFFIILDELEDPHNLGSIMR 118

Query: 153 SAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGL 212
           +A +    GII  KR +   +  +AK+++GA+E++P +R++N+   ++++   G    G 
Sbjct: 119 TADSVGAHGIIIPKRRAVGLTQTVAKASTGAMEYVPVVRVTNMVRTMEELQKRGLWIFGT 178

Query: 213 SSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVA 272
            +           +  +A+++G+EG G+    +E    + HL M G + +LN S AA++ 
Sbjct: 179 DAKGSSDYRTMDVDMPLAIVIGSEGFGMSRLVREKCDFLVHLPMRGKVTSLNASVAASLL 238

Query: 273 LYITQNHF 280
           LY      
Sbjct: 239 LYEVYRKR 246


>gi|116516815|ref|YP_816752.1| TrmH family RNA methyltransferase group 3 [Streptococcus pneumoniae
           D39]
 gi|148992659|ref|ZP_01822327.1| pyridoxine biosynthesis protein [Streptococcus pneumoniae SP9-BS68]
 gi|148997484|ref|ZP_01825089.1| pyridoxine biosynthesis protein [Streptococcus pneumoniae
           SP11-BS70]
 gi|168483931|ref|ZP_02708883.1| RNA methyltransferase, TrmH family, group 3 [Streptococcus
           pneumoniae CDC1873-00]
 gi|168489618|ref|ZP_02713817.1| RNA methyltransferase, TrmH family, group 3 [Streptococcus
           pneumoniae SP195]
 gi|168575914|ref|ZP_02721829.1| RNA methyltransferase, TrmH family, group 3 [Streptococcus
           pneumoniae MLV-016]
 gi|169833851|ref|YP_001694873.1| RNA methyltransferase [Streptococcus pneumoniae Hungary19A-6]
 gi|116077391|gb|ABJ55111.1| TrmH family RNA methyltransferase group 3 [Streptococcus pneumoniae
           D39]
 gi|147756539|gb|EDK63580.1| pyridoxine biosynthesis protein [Streptococcus pneumoniae
           SP11-BS70]
 gi|147928676|gb|EDK79690.1| pyridoxine biosynthesis protein [Streptococcus pneumoniae SP9-BS68]
 gi|168996353|gb|ACA36965.1| RNA methyltransferase, TrmH family, group 3 [Streptococcus
           pneumoniae Hungary19A-6]
 gi|172042719|gb|EDT50765.1| RNA methyltransferase, TrmH family, group 3 [Streptococcus
           pneumoniae CDC1873-00]
 gi|183571884|gb|EDT92412.1| RNA methyltransferase, TrmH family, group 3 [Streptococcus
           pneumoniae SP195]
 gi|183578281|gb|EDT98809.1| RNA methyltransferase, TrmH family, group 3 [Streptococcus
           pneumoniae MLV-016]
 gi|332073764|gb|EGI84243.1| RNA 2'-O ribose methyltransferase substrate binding family protein
           [Streptococcus pneumoniae GA17570]
 gi|332200899|gb|EGJ14971.1| RNA 2'-O ribose methyltransferase substrate binding family protein
           [Streptococcus pneumoniae GA41317]
 gi|332201895|gb|EGJ15965.1| RNA 2'-O ribose methyltransferase substrate binding family protein
           [Streptococcus pneumoniae GA47368]
          Length = 242

 Score =  133 bits (333), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 74/240 (30%), Positives = 121/240 (50%), Gaps = 9/240 (3%)

Query: 48  NLFLYGVHTVSAAL-NNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVG 106
           N  +YGVH V+ AL  N   K++     +        +        +     +++ ++  
Sbjct: 4   NDIVYGVHAVTEALLANTGNKLYLQEDLRGKNVEKVKELATEKKVSISWTSKKSLSEMT- 62

Query: 107 KEAVHQGLALETAPLLSPTLDA------VRNSQLLMVLDHVNDPHNIGAILRSAVAFSCD 160
           + AVHQG  L  +      LD          + LL++LD + DPHN+G+ILR+A A +  
Sbjct: 63  EGAVHQGFVLRVSEFAYSELDYILAKTRQEENPLLLILDGLTDPHNLGSILRTADATNVS 122

Query: 161 GIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPL 220
           G+I  K  +   + V+AK+A+GA+EH+P  R++NL+  L K+   GF T G   +     
Sbjct: 123 GVIIPKHRAVGVTPVVAKTATGAIEHVPIARVTNLSQTLDKLKDEGFWTFGTDMNGTPCH 182

Query: 221 EQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
           +   K  KIALI+G EGKG+    ++    M  + M G +++LN S AAA+ +Y    + 
Sbjct: 183 KWNTK-GKIALIIGNEGKGISSNIKKQVDEMITIPMNGHVQSLNASVAAAILMYEVFRNR 241


>gi|15903354|ref|NP_358904.1| tRNA (guanosine-2'-O-)-methyltransferase [Streptococcus pneumoniae
           R6]
 gi|307068107|ref|YP_003877073.1| hypothetical protein SPAP_1485 [Streptococcus pneumoniae AP200]
 gi|15458955|gb|AAL00115.1| tRNA (guanosine-2'-O-)-methyltransferase, TrmH family
           [Streptococcus pneumoniae R6]
 gi|306409644|gb|ADM85071.1| hypothetical protein SPAP_1485 [Streptococcus pneumoniae AP200]
          Length = 253

 Score =  133 bits (333), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 74/240 (30%), Positives = 121/240 (50%), Gaps = 9/240 (3%)

Query: 48  NLFLYGVHTVSAAL-NNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVG 106
           N  +YGVH V+ AL  N   K++     +        +        +     +++ ++  
Sbjct: 15  NDIVYGVHAVTEALLANTGNKLYLQEDLRGKNVEKVKELATEKKVSISWTSKKSLSEMT- 73

Query: 107 KEAVHQGLALETAPLLSPTLDA------VRNSQLLMVLDHVNDPHNIGAILRSAVAFSCD 160
           + AVHQG  L  +      LD          + LL++LD + DPHN+G+ILR+A A +  
Sbjct: 74  EGAVHQGFVLRVSEFAYSELDYILAKTRQEENPLLLILDGLTDPHNLGSILRTADATNVS 133

Query: 161 GIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPL 220
           G+I  K  +   + V+AK+A+GA+EH+P  R++NL+  L K+   GF T G   +     
Sbjct: 134 GVIIPKHRAVGVTPVVAKTATGAIEHVPIARVTNLSQTLDKLKDEGFWTFGTDMNGTPCH 193

Query: 221 EQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
           +   K  KIALI+G EGKG+    ++    M  + M G +++LN S AAA+ +Y    + 
Sbjct: 194 KWNTK-GKIALIIGNEGKGISSNIKKQVDEMITIPMNGHVQSLNASVAAAILMYEVFRNR 252


>gi|331007603|ref|ZP_08330749.1| 23S rRNA (guanosine-2'-O-) -methyltransferase rlmB [gamma
           proteobacterium IMCC1989]
 gi|330418581|gb|EGG93101.1| 23S rRNA (guanosine-2'-O-) -methyltransferase rlmB [gamma
           proteobacterium IMCC1989]
          Length = 251

 Score =  133 bits (333), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 70/251 (27%), Positives = 118/251 (47%), Gaps = 16/251 (6%)

Query: 45  QPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDA---NLPHPFPVKTVPPQTI 101
             ++  +YG+H V A ++   ++I  L   K    +               V+TV  + +
Sbjct: 2   NNDDDIVYGLHAVQALVDGSPQRIQTLWLLKGRNDQRLQSIRSVAEKSRITVRTVAREKL 61

Query: 102 DKIVGKEAVHQGLALETAPLLSPTLDAV-----------RNSQLLMVLDHVNDPHNIGAI 150
           D +V  E  HQG+      +     +                  ++VLD V DPHN+GA 
Sbjct: 62  DGMV--EGNHQGVIASVVNVTEVYDEDYLKSRLPKMKESGVIPFILVLDGVTDPHNLGAC 119

Query: 151 LRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTI 210
           LRSA A     +I  K  S S +  + K A GA E +P +R++NL+  L+ + S G   +
Sbjct: 120 LRSAEAAGVQFVIVPKDNSASLTPTVVKVACGAAEVLPLVRVTNLSRTLEWLQSQGVWLV 179

Query: 211 GLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAA 270
           G + ++++   Q      +A+++GAEGKGLR  T+E   S+  + M G + +LNVS A+ 
Sbjct: 180 GAAGEAEQDHYQMNLTGPLAIVMGAEGKGLRRLTRERCDSLIRIPMMGEVSSLNVSVASG 239

Query: 271 VALYITQNHFA 281
           + L+      +
Sbjct: 240 ICLFEALRQRS 250


>gi|229087115|ref|ZP_04219265.1| RNA methyltransferase, TrmH [Bacillus cereus Rock3-44]
 gi|228696183|gb|EEL49018.1| RNA methyltransferase, TrmH [Bacillus cereus Rock3-44]
          Length = 265

 Score =  133 bits (333), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 44/277 (15%), Positives = 91/277 (32%), Gaps = 29/277 (10%)

Query: 1   MNLISKKKSEKIFSLKDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAA 60
           M  I   ++ ++   K                        +   +    F+ G H V  A
Sbjct: 12  MKNIDSLQNPRVKQWKKLQTK-------------------KERDKKGLFFVEGFHLVEEA 52

Query: 61  LNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAP 120
           L         +    +                +  VP   +  +   E      A+    
Sbjct: 53  LKAGVAVELIVSDQTDLPKDWTV-----SDVEMYIVPEAIVKVLRETETTQGVFAVCEKH 107

Query: 121 LLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSA 180
                L   +     ++LD + DP N+G I+R+A A     ++  +      ++ + +S 
Sbjct: 108 EKEVDLTDGK----FLLLDGLQDPGNLGTIIRTADAAGIHAVVLGEGCVDVYNSKVLRST 163

Query: 181 SGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGL 240
            G++ H+P ++ +      +              ++     +       ALI+G EG G+
Sbjct: 164 QGSIFHLPIVKGNLEEWVDKLKEKNVPVYGTA-LENGVSYGEVTPTGSFALIVGNEGNGV 222

Query: 241 RPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQ 277
           R +         ++ + G  ++LNV+ AA +  Y  Q
Sbjct: 223 RQEILTKCDQNLYIPIYGGAESLNVAVAAGILTYYLQ 259


>gi|307704980|ref|ZP_07641867.1| spoU rRNA Methylase family protein [Streptococcus mitis SK597]
 gi|307621431|gb|EFO00481.1| spoU rRNA Methylase family protein [Streptococcus mitis SK597]
          Length = 242

 Score =  133 bits (333), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 75/240 (31%), Positives = 121/240 (50%), Gaps = 9/240 (3%)

Query: 48  NLFLYGVHTVSAAL-NNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVG 106
           N  +YGVH V+ AL  N   K++     +        +        +     +++ ++  
Sbjct: 4   NDIVYGVHAVTEALLANTGNKLYLQEDLRGKNVEKVKELATEKKVSISWTSKKSLSEMT- 62

Query: 107 KEAVHQGLALETAPLLSPTLDA------VRNSQLLMVLDHVNDPHNIGAILRSAVAFSCD 160
           + AVHQG  L  +      LD          + LL++LD + DPHN+G+ILR+A A +  
Sbjct: 63  EGAVHQGFVLRVSEFSYSELDNILAKTRQEENPLLLILDGLTDPHNLGSILRTADATNVS 122

Query: 161 GIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPL 220
           G+I  K  +   + V+AK+A+GA+EHIP  R++NL+  L K+   GF T G   +     
Sbjct: 123 GVIIPKHRAVGVTPVVAKTATGAIEHIPIARVTNLSQTLDKLKDEGFWTFGTDMNGTPCH 182

Query: 221 EQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
           +   K  KIALI+G EGKG+    ++    M  + M G +++LN S AAA+ +Y    + 
Sbjct: 183 KWNTK-GKIALIIGNEGKGISSNIKKQVDEMITIPMNGHVQSLNASVAAAILMYEVFRNR 241


>gi|160878575|ref|YP_001557543.1| tRNA/rRNA methyltransferase (SpoU) [Clostridium phytofermentans
           ISDg]
 gi|160427241|gb|ABX40804.1| tRNA/rRNA methyltransferase (SpoU) [Clostridium phytofermentans
           ISDg]
          Length = 264

 Score =  133 bits (333), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 42/258 (16%), Positives = 100/258 (38%), Gaps = 1/258 (0%)

Query: 24  RRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARL-D 82
             ++   K +    ++S+  ++ +     G        +    +I ++   ++   +   
Sbjct: 4   SSSNSQIKNLIKLQKQSKVRNELKVFVCEGKKMFEEVASQQRNQIKKVYLAESYYHQYTK 63

Query: 83  WDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDHVN 142
            +         + +  Q + +          LA+   P+ +       +S  L++L+ + 
Sbjct: 64  QNPEYLKGLDFEVLSDQVMKEASETITPQGILAIVKQPIYTLKDMTSGDSIRLLLLEDIR 123

Query: 143 DPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKM 202
           DP N+G ++R+A      GI+ +K      +  + +S  GA+  +P+    +    L ++
Sbjct: 124 DPGNLGTMVRTAEGVGMTGIVLSKDSVDMFNPKVIRSTMGAIFRVPFFYAEDFYACLNQI 183

Query: 203 HSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKA 262
            +                ++     K A+++G E  GL  K    +T    + M G +++
Sbjct: 184 KNEEIAIYAAHLQGAVWYDKVSYQGKSAILIGNEANGLSDKATSLSTQRIKIPMEGNVES 243

Query: 263 LNVSNAAAVALYITQNHF 280
           LN + AAAV +Y +    
Sbjct: 244 LNAAIAAAVLMYESYRQI 261


>gi|54296089|ref|YP_122458.1| hypothetical protein lpp0107 [Legionella pneumophila str. Paris]
 gi|53749874|emb|CAH11255.1| hypothetical protein lpp0107 [Legionella pneumophila str. Paris]
          Length = 249

 Score =  133 bits (333), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 73/242 (30%), Positives = 123/242 (50%), Gaps = 9/242 (3%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLATKNALARLDWD---ANLPHPFPVKTVPPQTIDKIVG 106
           ++YG+H VSA L NP R I +L   ++ + +   +          P++ +  Q +++   
Sbjct: 5   YVYGLHAVSALLANPHRMIKKLFVNQDRIDKRLHEFLVKAENAHVPIEKLSSQKMNQQFS 64

Query: 107 KEAVHQGLALETAPLLSPT------LDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCD 160
           +      +AL +A            L+  +   L+++LD + DPHN+GA LRSA A   D
Sbjct: 65  EFTHQGVVALASALPEYGESDLVTLLERSKKPVLILILDGITDPHNLGACLRSADATGVD 124

Query: 161 GIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPL 220
            ++  K  S + + V++K A GA E IP +R++NL  A+  +   G    G + +++  L
Sbjct: 125 FVVIPKDKSANITPVVSKVACGAAESIPLVRVTNLARAMDILKQQGVWIFGAAGEAEHLL 184

Query: 221 EQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
                +  IAL++GAEG GLR  T+E    +  L M G +++LNVS A  V+LY      
Sbjct: 185 YAMDCSGNIALVMGAEGTGLRRLTREHCDGLFSLPMMGSVESLNVSVATGVSLYEVIRQR 244

Query: 281 AK 282
            +
Sbjct: 245 GQ 246


>gi|324992441|gb|EGC24362.1| RNA methyltransferase [Streptococcus sanguinis SK405]
          Length = 242

 Score =  133 bits (333), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 72/242 (29%), Positives = 118/242 (48%), Gaps = 9/242 (3%)

Query: 46  PENLFLYGVHTVSAALNNP-SRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKI 104
            +N  +YGVH V+ AL      K++     +        D        +   P +T+ ++
Sbjct: 2   EKNDIVYGVHAVTEALAANTGNKLYIQDDLRGKKVDKIKDLAAEKKVSISWTPKKTLQEM 61

Query: 105 VGKEAVHQGLALETAPLLSPTLD------AVRNSQLLMVLDHVNDPHNIGAILRSAVAFS 158
               AVHQG  L  A       +         ++ LL++LD + DPHN+G+ILR+A A +
Sbjct: 62  TD-GAVHQGFVLRVAEFAYTDFEVLLKKAEQEDNPLLLILDGLTDPHNLGSILRTADATN 120

Query: 159 CDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKK 218
             G+I  K  +   + V+AK+++GA+EHIP  R++NL+  L K+   GF   G       
Sbjct: 121 VAGVIIPKHRAVGVTPVVAKTSTGAIEHIPIARVTNLSQTLDKLKEAGFWIFGTDMQGTP 180

Query: 219 PLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQN 278
             +      K+ALI+G EGKG+    ++    M  + M G +++LN S AAA+ +Y    
Sbjct: 181 THKWNTA-GKLALIIGNEGKGISSNIKKQVDEMISIPMNGHVQSLNASVAAAILMYEVFR 239

Query: 279 HF 280
           + 
Sbjct: 240 NR 241


>gi|251780637|ref|ZP_04823557.1| RNA methyltransferase, TrmH family [Clostridium botulinum E1 str.
           'BoNT E Beluga']
 gi|243084952|gb|EES50842.1| RNA methyltransferase, TrmH family [Clostridium botulinum E1 str.
           'BoNT E Beluga']
          Length = 262

 Score =  133 bits (333), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 50/257 (19%), Positives = 100/257 (38%), Gaps = 6/257 (2%)

Query: 24  RRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLD- 82
            + +  YK+ +    + ++ ++     + G   V  A+       + +L         + 
Sbjct: 6   SKENTIYKEAKKLKDR-KNRNKINKYVIEGFRLVDEAIRANLDIEYFILTEIGYEKLDNY 64

Query: 83  WDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDHVN 142
            D +      V  +      ++   E     +A+      +            +  D V 
Sbjct: 65  IDKDKMKKHKVFCITDTLFKELASTENPQGIIAIVKMDNKNLNF----QGDFYLFCDKVQ 120

Query: 143 DPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKM 202
           DP N+G I+R+A A   +GI+ +K      +    +S  G+L ++P     +    ++ +
Sbjct: 121 DPGNLGTIIRTAHAAGVNGIVLSKGTVDIYNEKTIRSTMGSLFYMPIYYDDDEFSLIKSL 180

Query: 203 HSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKA 262
              GF  I  S +S K   +E    KI L +G EG G+  +  + A     + MPG  ++
Sbjct: 181 KKDGFTLIVTSLESSKDFFKEDLKGKIILTVGNEGNGVSNEVLDLADRRVKIPMPGGAES 240

Query: 263 LNVSNAAAVALYITQNH 279
           LNV+ A ++ +Y     
Sbjct: 241 LNVAIATSIIIYEKVRQ 257


>gi|238019331|ref|ZP_04599757.1| hypothetical protein VEIDISOL_01195 [Veillonella dispar ATCC 17748]
 gi|237864030|gb|EEP65320.1| hypothetical protein VEIDISOL_01195 [Veillonella dispar ATCC 17748]
          Length = 264

 Score =  133 bits (333), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 62/284 (21%), Positives = 104/284 (36%), Gaps = 26/284 (9%)

Query: 1   MNLISKKKSEKIFSLKDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAA 60
           M  I  K                  +++  K++ S  Q+ ++ ++     + G+ ++   
Sbjct: 1   MEFIQSK------------------DNKTIKRIVSLGQR-KNRNKHGEYIVEGIRSIRDI 41

Query: 61  LNNPSRKIFQLLATKNALARLDWDANLP----HPFPVKTVPPQTIDKIVGKEAVHQGLAL 116
            +N    I  ++  ++     + +A L        P         DKI       QG+  
Sbjct: 42  SSNG--VIKTIVIRESKFKDNNIEALLALDSMQSIPTYIAQDPIFDKI-DNTVNGQGIIA 98

Query: 117 ETAPLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVL 176
             A              + + LD V DP N+G I+R+AVA    GI   K      +   
Sbjct: 99  IVAKPNHSIESISIEDGVYITLDGVQDPGNLGTIIRTAVAAGVKGIFLMKGTVDPFNDKT 158

Query: 177 AKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAE 236
            +S   AL  IP      L+     +      T   + +  KP      + +  LILG E
Sbjct: 159 VRSTMSALHKIPVYEDVTLSMLNDLIAESNMSTYVTALEESKPYNMVTYDKRCMLILGNE 218

Query: 237 GKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
           G G+ P+          + M G I++LNVS AAA+ +Y  Q   
Sbjct: 219 GNGVTPEVMNLCKHRIMIPMYGDIESLNVSVAAALCMYKAQEQL 262


>gi|54293055|ref|YP_125470.1| hypothetical protein lpl0092 [Legionella pneumophila str. Lens]
 gi|53752887|emb|CAH14322.1| hypothetical protein lpl0092 [Legionella pneumophila str. Lens]
          Length = 249

 Score =  133 bits (333), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 76/242 (31%), Positives = 123/242 (50%), Gaps = 9/242 (3%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLATKNALA-RLDWDANLPHP--FPVKTVPPQTIDKIVG 106
           ++YG+H VSA L NP R I +L   ++ +  RL            P++ +  Q +++   
Sbjct: 5   YVYGLHAVSALLANPHRMIKKLFVNQDRIDKRLHEFLIKAENAHVPIEKLSAQKMNQQFS 64

Query: 107 KEAVHQGLALETAPLLSPT------LDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCD 160
           +      +AL +A            L+  +   L+++LD + DPHN+GA LRSA A   D
Sbjct: 65  EFTHQGVVALASALPEYGESDLVTLLERSKKPVLILILDGITDPHNLGACLRSADATGVD 124

Query: 161 GIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPL 220
            ++  K  S S + V++K A GA E IP +R++NL  A+  +   G    G + +++  L
Sbjct: 125 FVLIPKDKSASITPVVSKVACGAAESIPLVRVTNLARAMDILKQQGVWIFGAAGEAEHLL 184

Query: 221 EQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
                +  IAL++GAEG GLR  T+E    +  L M G +++LNVS A  V+LY      
Sbjct: 185 YAMDCSGNIALVMGAEGTGLRRLTREHCDGLFSLPMMGSVESLNVSVATGVSLYEVIRQR 244

Query: 281 AK 282
            +
Sbjct: 245 GQ 246


>gi|38234534|ref|NP_940301.1| SpoU rRNA methylase family protein [Corynebacterium diphtheriae
           NCTC 13129]
 gi|38200797|emb|CAE50501.1| SpoU rRNA Methylase family protein [Corynebacterium diphtheriae]
          Length = 313

 Score =  133 bits (333), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 70/273 (25%), Positives = 131/273 (47%), Gaps = 13/273 (4%)

Query: 20  YAKLRRNHRDYKK--MQSFNQKSRHTSQPENLFLYGVHTVSAALNN--PSRKIFQLLATK 75
            A+ R  H  YKK   +    + RH  +  +  + G + V   L+   P+  ++ +  TK
Sbjct: 39  KAEDREYHAAYKKKMERKRRDQGRHVKEETSELVVGRNPVVECLHAKVPATTLYIVEGTK 98

Query: 76  N-ALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPT-------LD 127
           N                P+  VP   +D + G   +HQG+ L+  P    T       ++
Sbjct: 99  NDNRLSEAVQIAHSRGIPMIEVPRHEMDLMTG-NGMHQGIGLQIPPYKYTTVFDLIGRIN 157

Query: 128 AVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHI 187
           +     +++VLD++ DP N+GA++RS  AF   G++  +R S S +AV  ++++G    +
Sbjct: 158 STGEDGMVVVLDNITDPRNLGAVIRSVAAFGGHGVVIPERRSASVTAVAWRTSAGTAARL 217

Query: 188 PYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQET 247
           P  + +N+T A+Q+    G+Q +GL +     L+    +  + +++G+EGKG+    ++ 
Sbjct: 218 PVAKATNITRAVQEFQQNGYQVVGLDAGGDATLDNYDGSGPVVIVVGSEGKGISRLVRDN 277

Query: 248 ATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
             S+  + M G +++LN S AA V L       
Sbjct: 278 CDSLMSIPMAGWVESLNASVAAGVVLSEFARQR 310


>gi|126175841|ref|YP_001051990.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Shewanella baltica
           OS155]
 gi|125999046|gb|ABN63121.1| RNA methyltransferase, TrmH family, group 3 [Shewanella baltica
           OS155]
          Length = 246

 Score =  133 bits (333), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 63/244 (25%), Positives = 110/244 (45%), Gaps = 10/244 (4%)

Query: 46  PENLFLYGVHTVSAALNNPSRKIFQLLATKNALAR---LDWDANLPHPFPVKTVPPQTID 102
            +   ++G+H V A L +   +I +L   +        +  +        ++    + +D
Sbjct: 2   KKQDIIFGIHAVEALLKHSPERIIELWLLQGRDDERLTVLANQAKAFGTTIQVASRKALD 61

Query: 103 KIVGKEAVHQGLALET------APLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVA 156
               + + HQG+                 L A      L++LD V DPHN+GA LR+A A
Sbjct: 62  DKA-ESSQHQGIVARVKAAKVLNERDLDVLLANTEQPFLLILDGVTDPHNLGACLRNADA 120

Query: 157 FSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDS 216
               GII  K  S   +A ++K A GA E +P  +++NL   ++ +   G   +G + ++
Sbjct: 121 AGVQGIIVPKDNSVGLTATVSKVACGAAETVPLFQVTNLARTMRHLQDKGVWIVGTAGEA 180

Query: 217 KKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYIT 276
              L Q      +A+ +GAE KGLR  ++E+  S+  + M G + +LNVS A  + L+  
Sbjct: 181 DCELYQADLKGPLAIAMGAEDKGLRRLSRESCDSLISIPMAGSVSSLNVSVATGICLFEA 240

Query: 277 QNHF 280
               
Sbjct: 241 VRQR 244


>gi|215919079|ref|NP_819993.2| RNA methyltransferase [Coxiella burnetii RSA 493]
 gi|206583964|gb|AAO90507.2| 23S rRNA Gm2251 methyltransferase [Coxiella burnetii RSA 493]
          Length = 270

 Score =  133 bits (333), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 67/240 (27%), Positives = 118/240 (49%), Gaps = 12/240 (5%)

Query: 51  LYGVHTVSAALNNPSRKIFQLLATKNALARLDW---DANLPHPFPVKTVPPQTIDKIVGK 107
           +YG+H VS  L+   ++I +L   +N   +      +        V  +    ++ +  +
Sbjct: 27  IYGIHAVSGVLDAAPQRIVKLYVQENRDDQRLQSLVEKAKALGVKVILLSRTELNTLSNE 86

Query: 108 EAVHQGLALETAPLLSPT-------LDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCD 160
           +  HQG+  +   + +         L       LL++LD V DPHN+GA LRSA AF   
Sbjct: 87  K--HQGIVADCEEVENLDESALLSLLKKRETPALLLILDGVKDPHNLGACLRSANAFGVR 144

Query: 161 GIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPL 220
            +I  K  +   + V+ K A GA E  P+IR++NL+  +  +   G   +G + +++  +
Sbjct: 145 AVIAPKDRAVGVTPVVRKVACGAAEMTPFIRVTNLSRTIDWLQKEGVWIVGTAVEAETLI 204

Query: 221 EQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
           ++      IA++LG+EG GLR  T+E    +A + + G +++LNVS A  + LY  Q   
Sbjct: 205 QEIDLTGDIAIVLGSEGAGLRRLTKERCDFLAQIPLRGSVESLNVSVACGICLYEVQRQR 264


>gi|52783308|sp|Q83CW6|RLMB_COXBU RecName: Full=23S rRNA (guanosine-2'-O-)-methyltransferase RlmB;
           AltName: Full=23S rRNA Gm2251 2'-O-methyltransferase
          Length = 250

 Score =  133 bits (333), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 67/240 (27%), Positives = 118/240 (49%), Gaps = 12/240 (5%)

Query: 51  LYGVHTVSAALNNPSRKIFQLLATKNALARLDW---DANLPHPFPVKTVPPQTIDKIVGK 107
           +YG+H VS  L+   ++I +L   +N   +      +        V  +    ++ +  +
Sbjct: 7   IYGIHAVSGVLDAAPQRIVKLYVQENRDDQRLQSLVEKAKALGVKVILLSRTELNTLSNE 66

Query: 108 EAVHQGLALETAPLLSPT-------LDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCD 160
           +  HQG+  +   + +         L       LL++LD V DPHN+GA LRSA AF   
Sbjct: 67  K--HQGIVADCEEVENLDESALLSLLKKRETPALLLILDGVKDPHNLGACLRSANAFGVR 124

Query: 161 GIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPL 220
            +I  K  +   + V+ K A GA E  P+IR++NL+  +  +   G   +G + +++  +
Sbjct: 125 AVIAPKDRAVGVTPVVRKVACGAAEMTPFIRVTNLSRTIDWLQKEGVWIVGTAVEAETLI 184

Query: 221 EQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
           ++      IA++LG+EG GLR  T+E    +A + + G +++LNVS A  + LY  Q   
Sbjct: 185 QEIDLTGDIAIVLGSEGAGLRRLTKERCDFLAQIPLRGSVESLNVSVACGICLYEVQRQR 244


>gi|302185448|ref|ZP_07262121.1| RNA methyltransferase [Pseudomonas syringae pv. syringae 642]
 gi|330899904|gb|EGH31323.1| RNA methyltransferase [Pseudomonas syringae pv. japonica str.
           M301072PT]
 gi|330978939|gb|EGH77998.1| RNA methyltransferase [Pseudomonas syringae pv. aptata str. DSM
           50252]
          Length = 253

 Score =  133 bits (333), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 73/239 (30%), Positives = 113/239 (47%), Gaps = 8/239 (3%)

Query: 51  LYGVHTVSAALNNPSRKIFQLLATKNA-LARLDWDANLPHPFPVKTVPPQTIDKIVGKEA 109
           +YGVH V A L +  +++  +   +     R+     L     V     +  +     E 
Sbjct: 7   IYGVHAVEALLRHHPKRVKHIWLAEGRNDPRVQTLVALAAENRVTIGQAERREMDAWVEG 66

Query: 110 VHQGLALETAPLLSP-------TLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGI 162
           VHQG+  + +P            LD    S LL+VLD V DPHN+GA LR+A A     +
Sbjct: 67  VHQGVVADVSPSQVWGEAMLDELLDRSEGSPLLLVLDGVTDPHNLGACLRTADAAGALAV 126

Query: 163 ITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQ 222
           I  K  S + +  + K A GA E IP + ++NL   L+K+   G   +G + +++  L Q
Sbjct: 127 IVPKDKSATLTPAVRKVACGAAEVIPLVAVTNLARTLEKLQQRGLWVVGTAGEAEVELYQ 186

Query: 223 EIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHFA 281
           +       +I+GAEGKG+R  T+E    +  L M G + +LNVS A  V L+      +
Sbjct: 187 QDLTGPTIIIMGAEGKGMRRLTREHCDYLVRLPMAGSVSSLNVSVATGVCLFEALRQRS 245


>gi|66043847|ref|YP_233688.1| RNA methyltransferase TrmH, group 3 [Pseudomonas syringae pv.
           syringae B728a]
 gi|63254554|gb|AAY35650.1| RNA methyltransferase TrmH, group 3 [Pseudomonas syringae pv.
           syringae B728a]
 gi|330971568|gb|EGH71634.1| RNA methyltransferase TrmH, group 3 [Pseudomonas syringae pv.
           aceris str. M302273PT]
          Length = 251

 Score =  133 bits (333), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 73/239 (30%), Positives = 113/239 (47%), Gaps = 8/239 (3%)

Query: 51  LYGVHTVSAALNNPSRKIFQLLATKNA-LARLDWDANLPHPFPVKTVPPQTIDKIVGKEA 109
           +YGVH V A L +  +++  +   +     R+     L     V     +  +     E 
Sbjct: 7   IYGVHAVEALLRHHPKRVKHIWLAEGRNDPRVQTLVALAAENRVTIGQAERREMDAWVEG 66

Query: 110 VHQGLALETAPLLSP-------TLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGI 162
           VHQG+  + +P            LD    S LL+VLD V DPHN+GA LR+A A     +
Sbjct: 67  VHQGVVADVSPSQVWGEAMLDELLDRSEGSPLLLVLDGVTDPHNLGACLRTADAAGALAV 126

Query: 163 ITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQ 222
           I  K  S + +  + K A GA E IP + ++NL   L+K+   G   +G + +++  L Q
Sbjct: 127 IVPKDKSATLTPAVRKVACGAAEVIPLVAVTNLARTLEKLQQRGLWVVGTAGEAEVELYQ 186

Query: 223 EIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHFA 281
           +       +I+GAEGKG+R  T+E    +  L M G + +LNVS A  V L+      +
Sbjct: 187 QDLTGPTIIIMGAEGKGMRRLTREHCDYLVRLPMAGSVSSLNVSVATGVCLFEALRQRS 245


>gi|309782123|ref|ZP_07676853.1| RNA methyltransferase, TrmH family [Ralstonia sp. 5_7_47FAA]
 gi|308919189|gb|EFP64856.1| RNA methyltransferase, TrmH family [Ralstonia sp. 5_7_47FAA]
          Length = 260

 Score =  133 bits (333), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 53/257 (20%), Positives = 99/257 (38%), Gaps = 5/257 (1%)

Query: 24  RRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDW 83
            R++  +K +++ +  ++H  +     L GVH V+A L+        L+       R   
Sbjct: 6   SRDNAVFKHLKALSGSTQHRRRAGQSVLDGVHLVAAYLDAGHMPAQCLV--SERHIRHPE 63

Query: 84  DANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDHVND 143
            A +       TV     +       V  G+ L                   ++LD + D
Sbjct: 64  VAAVLDRVDPDTVILLADNLFGQLTTVVNGVDLMALVETPEGKLPQTIDADCVILDGIQD 123

Query: 144 PHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMH 203
             N+G+ILR A A     +  T   + + SA   ++A GA  H+  +          ++ 
Sbjct: 124 AGNVGSILRCAAAAGVRDVFMTPGCAFAWSAKTLRAAMGAHFHLNIVEHCTFESVHSRLQ 183

Query: 204 SWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKAL 263
                 +  SS +K+ +     N  +  + G EG G+  +     T+   +  PG +++L
Sbjct: 184 VPL---LATSSHAKQAVFDVPLNAPVGWVFGNEGAGVSEEWLSAVTTPVTIPQPGGMESL 240

Query: 264 NVSNAAAVALYITQNHF 280
           NV+ AAA+ L+      
Sbjct: 241 NVAAAAAICLFEAVRQR 257


>gi|332359265|gb|EGJ37086.1| tRNA (guanosine-2'-O-)-methyltransferase [Streptococcus sanguinis
           SK49]
          Length = 242

 Score =  133 bits (333), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 72/242 (29%), Positives = 118/242 (48%), Gaps = 9/242 (3%)

Query: 46  PENLFLYGVHTVSAALNNP-SRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKI 104
            +N  +YGVH V+ AL      K++     +        D        +   P +T+ ++
Sbjct: 2   EKNDIVYGVHAVTEALAANTGNKLYIQDDLRGKKVDKIKDLAAEKKVSISWTPKKTLQEM 61

Query: 105 VGKEAVHQGLALETAPLLSPTLD------AVRNSQLLMVLDHVNDPHNIGAILRSAVAFS 158
               AVHQG  L  A       +         ++ LL++LD + DPHN+G+ILR+A A +
Sbjct: 62  TD-GAVHQGFVLRVAEFAYTDFEALLKKAEQEDNPLLLILDGLTDPHNLGSILRTADATN 120

Query: 159 CDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKK 218
             G+I  K  +   + V+AK+++GA+EHIP  R++NL+  L K+   GF   G       
Sbjct: 121 VTGVIIPKHRAVGVTPVVAKTSTGAIEHIPIARVTNLSQTLDKLKEAGFWIFGTDMQGTP 180

Query: 219 PLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQN 278
             +      K+ALI+G EGKG+    ++    M  + M G +++LN S AAA+ +Y    
Sbjct: 181 SHKWNTA-GKLALIIGNEGKGISSNIKKQVDEMISIPMNGHVQSLNASVAAAILMYEVFR 239

Query: 279 HF 280
           + 
Sbjct: 240 NR 241


>gi|325689008|gb|EGD31016.1| tRNA (guanosine-2'-O-)-methyltransferase [Streptococcus sanguinis
           SK115]
          Length = 242

 Score =  133 bits (333), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 72/242 (29%), Positives = 118/242 (48%), Gaps = 9/242 (3%)

Query: 46  PENLFLYGVHTVSAALNNP-SRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKI 104
            +N  +YGVH V+ AL      K++     +        D        +   P +T+ ++
Sbjct: 2   EKNDIVYGVHAVTEALAANTGNKLYIQDDLRGKKVDKIKDLAAEKKVSISWTPKKTLQEM 61

Query: 105 VGKEAVHQGLALETAPLLSPTLD------AVRNSQLLMVLDHVNDPHNIGAILRSAVAFS 158
               AVHQG  L  A       +         ++ LL++LD + DPHN+G+ILR+A A +
Sbjct: 62  TD-GAVHQGFVLRVAEFAYTDFEVLLKKAEQEDNPLLLILDGLTDPHNLGSILRTADATN 120

Query: 159 CDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKK 218
             G+I  K  +   + V+AK+++GA+EHIP  R++NL+  L K+   GF   G       
Sbjct: 121 VTGVIIPKHRAVGVTPVVAKTSTGAIEHIPIARVTNLSQTLDKLKEAGFWIFGTDMQGTP 180

Query: 219 PLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQN 278
             +      K+ALI+G EGKG+    ++    M  + M G +++LN S AAA+ +Y    
Sbjct: 181 SHKWNTA-GKLALIIGNEGKGISSNIKKQVDEMISIPMNGHVQSLNASVAAAILMYEVFR 239

Query: 279 HF 280
           + 
Sbjct: 240 NR 241


>gi|160916266|ref|ZP_02078473.1| hypothetical protein EUBDOL_02293 [Eubacterium dolichum DSM 3991]
 gi|158431990|gb|EDP10279.1| hypothetical protein EUBDOL_02293 [Eubacterium dolichum DSM 3991]
          Length = 241

 Score =  133 bits (333), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 59/238 (24%), Positives = 109/238 (45%), Gaps = 8/238 (3%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEA 109
           ++YG + V  AL    +K+++++ +     +           P K    + +D +    +
Sbjct: 4   YVYGKNVVK-ALLADKKKVYEIILSDGFRDKELEQEIRKRKIPCKVNSRKKMDTMFS-GS 61

Query: 110 VHQGLALETAPLLSPTLD------AVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGII 163
            HQG+A +     + T++          + L ++LD + DPHN+GAILR+      DG+I
Sbjct: 62  NHQGIAAKIDDYKTYTIEELVAGVPKGKTPLFVMLDELEDPHNLGAILRTCDCVGVDGVI 121

Query: 164 TTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQE 223
             K      +  +AK ++GA++ +    ++NL   L+ +   GF   G   D+ +   Q 
Sbjct: 122 IGKHRGVKLTPTVAKVSTGAIDTVKVAVVTNLAQTLKGLKKEGFWVAGADFDNSQDYRQA 181

Query: 224 IKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHFA 281
             +  + L++G+EG G+ P  ++       L M G + +LN S A AV LY       
Sbjct: 182 SYDMPLVLVVGSEGFGISPLVKKNCDFFVRLPMEGSVSSLNASVACAVLLYQIYAQRN 239


>gi|148358250|ref|YP_001249457.1| tRNA/rRNA methyltransferase [Legionella pneumophila str. Corby]
 gi|296105603|ref|YP_003617303.1| tRNA/rRNA methyltransferase [Legionella pneumophila 2300/99 Alcoy]
 gi|148280023|gb|ABQ54111.1| tRNA/rRNA methyltransferase [Legionella pneumophila str. Corby]
 gi|295647504|gb|ADG23351.1| tRNA/rRNA methyltransferase [Legionella pneumophila 2300/99 Alcoy]
          Length = 249

 Score =  133 bits (333), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 73/242 (30%), Positives = 123/242 (50%), Gaps = 9/242 (3%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLATKNALARLDWD---ANLPHPFPVKTVPPQTIDKIVG 106
           ++YG+H VSA L NP R I +L   ++ + +   +          P++ +  Q +++   
Sbjct: 5   YVYGLHAVSALLANPHRMIKKLFVNQDRIDKRLHEFLVKAENAHVPIEKLSAQKMNQQFS 64

Query: 107 KEAVHQGLALETAPLLSPT------LDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCD 160
           +      +AL +A            L+  +   L+++LD + DPHN+GA LRSA A   D
Sbjct: 65  EFTHQGVVALASALPEYGESDLVTLLERSKKPVLILILDGITDPHNLGACLRSADATGVD 124

Query: 161 GIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPL 220
            ++  K  S + + V++K A GA E IP +R++NL  A+  +   G    G + +++  L
Sbjct: 125 FVVIPKDKSANITPVVSKVACGAAESIPLVRVTNLARAMDILKQQGVWIFGAAGEAEHLL 184

Query: 221 EQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
                +  IAL++GAEG GLR  T+E    +  L M G +++LNVS A  V+LY      
Sbjct: 185 YAMDCSGNIALVMGAEGTGLRRLTREHCDGLFSLPMMGSVESLNVSVATGVSLYEVIRQR 244

Query: 281 AK 282
            +
Sbjct: 245 GQ 246


>gi|312958662|ref|ZP_07773182.1| RNA methyltransferase TrmH, group 3 [Pseudomonas fluorescens WH6]
 gi|311287205|gb|EFQ65766.1| RNA methyltransferase TrmH, group 3 [Pseudomonas fluorescens WH6]
          Length = 251

 Score =  133 bits (333), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 75/240 (31%), Positives = 117/240 (48%), Gaps = 12/240 (5%)

Query: 51  LYGVHTVSAALNNPSRKIFQLLATKNA---LARLDWDANLPHPFPVKTVPPQTIDKIVGK 107
           +YGVH V A L +  +++ Q+   +       +   +    +   +     + +D  V  
Sbjct: 6   IYGVHAVEALLRHHPKRVKQVWLAEGRSEPRVQALVELATQNKVAIGQAERREMDVWV-- 63

Query: 108 EAVHQGLALETAPLLSP-------TLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCD 160
           E VHQG+  + +P            LD    + LL+VLD V DPHN+GA LRSA A    
Sbjct: 64  EGVHQGVVADVSPSQVWGEAMLDELLDRTEGAPLLLVLDGVTDPHNLGACLRSADAAGAL 123

Query: 161 GIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPL 220
            +I  K  S + + V+ K A GA E IP + ++NL   L+K+   G   +G + +++  +
Sbjct: 124 AVIVPKDKSATLTPVVRKVACGAAEVIPLVAVTNLARTLEKLQQRGLWIVGTAGEAEVSI 183

Query: 221 EQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
             +       LI+GAEGKG+R  T+E    + HL M G + +LNVS A  V L+  Q   
Sbjct: 184 YDQDLTGPTILIMGAEGKGMRRLTREHCDYLVHLPMAGSVSSLNVSVATGVCLFEAQRQR 243


>gi|153840466|ref|ZP_01993133.1| RNA methyltransferase, TrmH family, group 3 [Vibrio
           parahaemolyticus AQ3810]
 gi|149745870|gb|EDM57000.1| RNA methyltransferase, TrmH family, group 3 [Vibrio
           parahaemolyticus AQ3810]
 gi|328472293|gb|EGF43163.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Vibrio
           parahaemolyticus 10329]
          Length = 247

 Score =  133 bits (333), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 72/242 (29%), Positives = 114/242 (47%), Gaps = 10/242 (4%)

Query: 48  NLFLYGVHTVSAALNNPSRKIFQLLATKNALA-RLDWDANLPH--PFPVKTVPPQTIDKI 104
           N F+YG+H V A L     +  +    K     RL    N        ++ +  +T+D  
Sbjct: 3   NEFIYGIHAVKAVLEREPERFIEAYVLKGRQDDRLMPILNDLQVCGVSIQQMTRKTLDDK 62

Query: 105 VGKEAVHQGLALETAPLLS------PTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFS 158
               A HQG+     P           + A   + LL+VLD V DPHN+GA LR+A A  
Sbjct: 63  A-HGANHQGIIARVKPAKQLNENDIDDILAQHETPLLLVLDGVTDPHNLGACLRNADAAG 121

Query: 159 CDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKK 218
              II  K  S   +A ++K A GA E +P IR++NL   ++ +   G   +G + ++  
Sbjct: 122 VAAIIVPKDRSAPMNATVSKVACGAAEVVPLIRVTNLARTMRTLQEQGIWFVGTAGEATH 181

Query: 219 PLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQN 278
            + Q      +A+++GAEG G+R  T+ET   +  + M G + +LNVS A+ + L+    
Sbjct: 182 DIYQAKLTGPLAIVMGAEGDGMRRLTRETCDDLIKIPMAGSVSSLNVSVASGICLFEAVR 241

Query: 279 HF 280
             
Sbjct: 242 QR 243


>gi|260583736|ref|ZP_05851484.1| RNA methyltransferase, TrmH family [Granulicatella elegans ATCC
           700633]
 gi|260158362|gb|EEW93430.1| RNA methyltransferase, TrmH family [Granulicatella elegans ATCC
           700633]
          Length = 252

 Score =  133 bits (333), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 51/254 (20%), Positives = 104/254 (40%), Gaps = 8/254 (3%)

Query: 24  RRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDW 83
              +   K  Q     S+   + E   + G H V  A+ +    I +L+ +++ +   + 
Sbjct: 6   SHQNAMVKNYQKLQT-SKGRKKSEAYMIEGEHLVEEAIQSNI-SIQRLVVSEDTIQFYE- 62

Query: 84  DANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDHVND 143
                  +P   V  +  +K+      +QG+         P ++  +   LL   D V D
Sbjct: 63  --KWTKSYPTMFVSKEVFEKLS-MTQTNQGILAIVPLEKKPLVEVPQGRYLL--ADAVQD 117

Query: 144 PHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMH 203
           P N+G I+R+A A   D ++  +      +  + +S  G+  H+     + +    +   
Sbjct: 118 PGNLGTIIRTADAAGFDAVVLGEGCVDLYNDKVVRSMQGSQFHVAIYHENLMDVYGKLKE 177

Query: 204 SWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKAL 263
           +     +       K  +     D +A+++G EG G+R +  E+A  +  + M G  ++L
Sbjct: 178 NDIPIAVTALHRDAKDFKWLTGRDSVAIVVGNEGNGVRDELIESADFIIQIPMFGQAESL 237

Query: 264 NVSNAAAVALYITQ 277
           NV+ A  V +Y T+
Sbjct: 238 NVAIATGVLMYQTR 251


>gi|290579663|ref|YP_003484055.1| putative tRNA/rRNA methyltransferase [Streptococcus mutans NN2025]
 gi|254996562|dbj|BAH87163.1| putative tRNA/rRNA methyltransferase [Streptococcus mutans NN2025]
          Length = 248

 Score =  133 bits (333), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 73/243 (30%), Positives = 119/243 (48%), Gaps = 9/243 (3%)

Query: 46  PENLFLYGVHTVSAALNNP-SRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKI 104
                +YGVH V  +L      K++     +        D       P+   P +T+  +
Sbjct: 8   ENTDIVYGVHAVIESLQANTGHKLYIQNDLRGKNVDKIKDLAAEKKVPISWTPKKTLSDM 67

Query: 105 VGKEAVHQGLALETAPLLSPTLDA------VRNSQLLMVLDHVNDPHNIGAILRSAVAFS 158
             K AVHQG  L  +       +         ++ LL++LD +NDPHN G+ILR+A A +
Sbjct: 68  T-KGAVHQGFILHVSAFAYTEFEMLLKKAEREDNPLLLILDELNDPHNFGSILRTADATN 126

Query: 159 CDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKK 218
             GII  K  +   + V+AK+++GA+EHIP  R++NL  AL K+ + GF   G   +   
Sbjct: 127 VTGIIIPKHRAVGVTPVVAKTSTGAVEHIPIARVTNLGQALDKLKAAGFWIFGTDMNGTP 186

Query: 219 PLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQN 278
             +    + K+ALI+G EG+G+    ++    M  + M G +++LN S AAA+ +Y    
Sbjct: 187 STQWNT-SGKLALIIGNEGRGISHNIKKQVDEMVTIPMNGHVQSLNASVAAAILMYEVFR 245

Query: 279 HFA 281
           +  
Sbjct: 246 NRK 248


>gi|238755910|ref|ZP_04617238.1| 23S rRNA (guanosine-2'-O-)-methyltransferase rlmB [Yersinia ruckeri
           ATCC 29473]
 gi|238705869|gb|EEP98258.1| 23S rRNA (guanosine-2'-O-)-methyltransferase rlmB [Yersinia ruckeri
           ATCC 29473]
          Length = 248

 Score =  133 bits (333), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 68/242 (28%), Positives = 106/242 (43%), Gaps = 8/242 (3%)

Query: 48  NLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDW---DANLPHPFPVKTVPPQTIDKI 104
           +  +YG+H V A L    ++  ++   K    R               V+    Q +D  
Sbjct: 2   SEIIYGIHAVKALLERDPQRFLEVFILKGRDDRRLQPVVAELEATGLVVQVASRQWLDSQ 61

Query: 105 VGKEAVHQGLALETAPLLSPTLDAVR-----NSQLLMVLDHVNDPHNIGAILRSAVAFSC 159
           V        +A           D         S  L+VLD V DPHN+GA LRSA A   
Sbjct: 62  VEGGVHQGIVARVREGRQYQENDLPGLLASVESPFLLVLDGVTDPHNLGACLRSADAAGV 121

Query: 160 DGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKP 219
             +I  +  S   +A+  K ASGA E++P IR++NL   L+ +       +G + ++   
Sbjct: 122 HAVIVPRDRSAQLNAIAKKVASGAAENVPLIRVTNLARTLRVLQENNVWIVGTAGEADHT 181

Query: 220 LEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNH 279
           L Q      +AL++GAEG+G+R  T+E    +  + M G + +LNVS A  V L+     
Sbjct: 182 LYQSKMTGPMALVMGAEGEGMRRLTREHCDELISIPMAGTVSSLNVSVATGVCLFEVVRQ 241

Query: 280 FA 281
            +
Sbjct: 242 RS 243


>gi|86610253|ref|YP_479015.1| RNA methyltransferase [Synechococcus sp. JA-2-3B'a(2-13)]
 gi|86558795|gb|ABD03752.1| RNA methyltransferase, TrmH family, group 3 [Synechococcus sp.
           JA-2-3B'a(2-13)]
          Length = 378

 Score =  133 bits (333), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 69/247 (27%), Positives = 115/247 (46%), Gaps = 11/247 (4%)

Query: 45  QPENLFLYGVHTVSAALNNPSRKIFQLLATK---NALARLDWDANLPHPFPVKTVPPQTI 101
           + E   +YG  TV AAL + +      +  K   +       +        +  V P+ +
Sbjct: 102 ELEQEIIYGRQTVLAALKSQATLNRVWILPKLRYSPQFLSLLEEAKARGTVIDEVSPKRL 161

Query: 102 DKIVGKEAVHQGLALETAPLLSPTLD-------AVRNSQLLMVLDHVNDPHNIGAILRSA 154
           + +    A HQG+A +  P     L+           + +L+VLD + DPHN+GAI RS 
Sbjct: 162 NALTA-GANHQGIAAQATPYQYVALEDLVERSRQAGPNPVLVVLDGIQDPHNLGAIARSV 220

Query: 155 VAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSS 214
            AF   G++  +R +   ++ + K A+GAL  +P  R+ NL  AL+ +   GF   G +S
Sbjct: 221 EAFGMQGMVIPQRRAAGVTSTVMKVAAGALSTLPVARVVNLNRALEYLKEQGFWVYGTTS 280

Query: 215 DSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
               P+        IAL++G+EG+G+   TQ     +  + + G  ++LN S AA +ALY
Sbjct: 281 RGADPIYSADFQRPIALVVGSEGEGISLLTQRHCDQLLSIPLAGRTESLNASVAAGIALY 340

Query: 275 ITQNHFA 281
                 +
Sbjct: 341 EIHRQRS 347


>gi|319954252|ref|YP_004165519.1| tRNA/rRNA methyltransferase (spou) [Cellulophaga algicola DSM
           14237]
 gi|319422912|gb|ADV50021.1| tRNA/rRNA methyltransferase (SpoU) [Cellulophaga algicola DSM
           14237]
          Length = 269

 Score =  133 bits (333), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 54/269 (20%), Positives = 96/269 (35%), Gaps = 6/269 (2%)

Query: 17  DSHYAKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKN 76
           +S        +   K +     KSR   +  N  L G+     AL      I  +   + 
Sbjct: 2   NSTKHISSLQNTLIKNVLVLKDKSRERKKTGNFILEGIREFELALK-GFYTIETVFYAEG 60

Query: 77  ALA--RLDWDANLPHPFPVKT-VPPQTIDKIVGKEAVHQGLAL-ETAPLLSPTLDAVRNS 132
                +++         PV   V  +   KI  +E     LA+ +    +   L     +
Sbjct: 61  LFPESKIEELTATLAYQPVLISVSKEVYQKIAYRETTEGILAIAKAKTHILSELKFKNKN 120

Query: 133 QLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRI 192
            L++V +    P NIGA+LR+A A + D +I                +S        I  
Sbjct: 121 PLVLVAEAPEKPGNIGALLRTADAANLDAVII-ANPKTDLYNPNIIRSSVGCVFTNPIAT 179

Query: 193 SNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMA 252
            N T+ +  +          +  + K           A+++G E  GL  +  E AT   
Sbjct: 180 GNTTEIIAFLKENNINIFCAALTASKVYTNTSFKTPSAIVVGTEATGLSEEWLENATQNI 239

Query: 253 HLHMPGIIKALNVSNAAAVALYITQNHFA 281
            + M G I ++NVS +AA+ ++  +   +
Sbjct: 240 IIPMEGEIDSMNVSVSAAILIFEAKRQRS 268


>gi|229175269|ref|ZP_04302784.1| RNA methyltransferase, TrmH [Bacillus cereus MM3]
 gi|228608101|gb|EEK65408.1| RNA methyltransferase, TrmH [Bacillus cereus MM3]
          Length = 265

 Score =  133 bits (333), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 48/277 (17%), Positives = 100/277 (36%), Gaps = 29/277 (10%)

Query: 1   MNLISKKKSEKIFSLKDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAA 60
           M  I   ++ ++   K                        +   +    F+ G H V  A
Sbjct: 12  MKNIDSVQNPRVKQWKKLQTK-------------------KERDKKGLFFVEGFHLVEEA 52

Query: 61  LNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAP 120
           L      + +L+ +       DW  N      +  VP   +  +   E      A+    
Sbjct: 53  LKAG--VVTELIVSDQTDLPKDWTVN---DVEMYIVPEAIVKVLRETETTQGVFAVCEKH 107

Query: 121 LLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSA 180
                L   +     ++LD + DP N+G I+R+A A     ++  +    + ++ + +S 
Sbjct: 108 ESEVALADGK----FLLLDGLQDPGNLGTIIRTADAAGIHAVVLGEGCVDAYNSKVLRST 163

Query: 181 SGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGL 240
            G++ H+P ++ +      +   +          ++  P  +       ALI+G EG G+
Sbjct: 164 QGSIFHLPVVKGNLEEWVDKLKENNVPVYGTA-LENGVPYGEVTPAGSFALIVGNEGSGV 222

Query: 241 RPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQ 277
             +    +    ++ + G  ++LNV+ AA +  Y  Q
Sbjct: 223 SQEILAKSDQNLYIPIYGGAESLNVAVAAGILTYYLQ 259


>gi|229588085|ref|YP_002870204.1| 23s rRNA (guanosine-2'-o-)-methyltransferase [Pseudomonas
           fluorescens SBW25]
 gi|229359951|emb|CAY46805.1| 23s rRNA (guanosine-2'-o-)-methyltransferase [Pseudomonas
           fluorescens SBW25]
          Length = 251

 Score =  132 bits (332), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 74/240 (30%), Positives = 117/240 (48%), Gaps = 12/240 (5%)

Query: 51  LYGVHTVSAALNNPSRKIFQLLATKNA---LARLDWDANLPHPFPVKTVPPQTIDKIVGK 107
           +YGVH V A L +  +++ Q+   +       +   +    +   +     + +D  V  
Sbjct: 6   IYGVHAVEALLRHHPKRVKQVWLAEGRSEPRVQALVELATQNKVAIGQAERREMDVWV-- 63

Query: 108 EAVHQGLALETAPLLSP-------TLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCD 160
           E VHQG+  + +P            LD    + LL+VLD V DPHN+GA LRSA A    
Sbjct: 64  EGVHQGVVADVSPSQVWGEAMLDELLDRTEGAPLLLVLDGVTDPHNLGACLRSADAAGAL 123

Query: 161 GIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPL 220
            +I  K  S + + V+ K A GA E IP + ++NL   L+K+   G   +G + +++  +
Sbjct: 124 AVIVPKDKSATLTPVVRKVACGAAEVIPLVAVTNLARTLEKLQQRGLWVVGTAGEAEVSI 183

Query: 221 EQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
             +       LI+GAEGKG+R  T+E    + HL M G + +LNVS A  V L+  +   
Sbjct: 184 YDQDLTGPTILIMGAEGKGMRRLTREHCDYLVHLPMAGSVSSLNVSVATGVCLFEARRQR 243


>gi|94500543|ref|ZP_01307074.1| RNA methyltransferase, TrmH family, group 3 [Oceanobacter sp.
           RED65]
 gi|94427333|gb|EAT12312.1| RNA methyltransferase, TrmH family, group 3 [Oceanobacter sp.
           RED65]
          Length = 246

 Score =  132 bits (332), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 64/244 (26%), Positives = 114/244 (46%), Gaps = 12/244 (4%)

Query: 47  ENLFLYGVHTVSAALNNPSRKIFQLLATKNALAR---LDWDANLPHPFPVKTVPPQTIDK 103
            +  ++G+H V   L     ++ ++   K                +   ++ V    +D 
Sbjct: 2   NDEIVFGIHAVKNLLKRSPERVREIFLQKGRDDERLMDIVQLANKNSINLQAVKKTVLDD 61

Query: 104 IVGKEAVHQGLALETAPLLSPT-------LDAVRNSQLLMVLDHVNDPHNIGAILRSAVA 156
               +  HQG+     P+ S         LD++     L+VLD V DPHN+GA LR+A A
Sbjct: 62  RA--QGNHQGVIARAKPVQSKDENQLLQQLDSLDEPAFLLVLDSVTDPHNLGACLRTADA 119

Query: 157 FSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDS 216
               G+I  K  +   +A ++K A GA E +P+ +++NL   ++++   G    G + ++
Sbjct: 120 AGVHGVIAPKDKAVGLTATVSKVACGAAESVPFYQVTNLARTMKELQERGIWLYGTAGEA 179

Query: 217 KKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYIT 276
            + + +      IA+++GAEGKGLR  T+E    + ++ M G + +LNVS A  V L+  
Sbjct: 180 SESVFKTDLKGPIAIVMGAEGKGLRRLTREACDHLINIPMAGDVSSLNVSVATGVCLFEA 239

Query: 277 QNHF 280
               
Sbjct: 240 VRQR 243


>gi|29346770|ref|NP_810273.1| tRNA/rRNA methyltransferase [Bacteroides thetaiotaomicron VPI-5482]
 gi|253572226|ref|ZP_04849629.1| tRNA/rRNA methyltransferase [Bacteroides sp. 1_1_6]
 gi|298386583|ref|ZP_06996139.1| RNA methyltransferase, TrmH family, group 3 [Bacteroides sp.
           1_1_14]
 gi|29338667|gb|AAO76467.1| tRNA/rRNA methyltransferase [Bacteroides thetaiotaomicron VPI-5482]
 gi|251838001|gb|EES66089.1| tRNA/rRNA methyltransferase [Bacteroides sp. 1_1_6]
 gi|298260960|gb|EFI03828.1| RNA methyltransferase, TrmH family, group 3 [Bacteroides sp.
           1_1_14]
          Length = 247

 Score =  132 bits (332), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 59/245 (24%), Positives = 102/245 (41%), Gaps = 13/245 (5%)

Query: 47  ENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHP---FPVKTVPPQTIDK 103
           ++  ++GV  V  A+      I ++L  K+  + L  +          PV+ VP + I++
Sbjct: 4   KSEMIFGVRAVIEAIQAGKE-IDKILVKKDIQSDLSKELFAALKGLLIPVQRVPVERINR 62

Query: 104 IVGKEAVHQGLALETAPLLSP-------TLDAVRNSQLLMVLDHVNDPHNIGAILRSAVA 156
           I      HQG+    + +           L     +   ++LD + D  N GAI R+   
Sbjct: 63  IT--RKNHQGVVAFISSVTYQKTEDLVPFLFEQGKNPFFVMLDGITDVRNFGAIARTCEC 120

Query: 157 FSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDS 216
            + D +I   R S S +A   K+++GAL  +P  R  NL   LQ +   GF+ +  +   
Sbjct: 121 AAVDAVIIPARGSVSVNADAMKTSAGALHTLPVCREQNLRATLQYLKDSGFRIVAATEKG 180

Query: 217 KKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYIT 276
                +      + +I+GAE  G+             + M G I++LNVS AA + +Y  
Sbjct: 181 DYDYTKADYTGPMCIIMGAEDTGVSYDHLALCDEWVKIPMLGTIESLNVSVAAGILIYEA 240

Query: 277 QNHFA 281
                
Sbjct: 241 VKQRN 245


>gi|329925610|ref|ZP_08280451.1| RNA methyltransferase, TrmH family, group 3 [Paenibacillus sp.
           HGF5]
 gi|328939739|gb|EGG36081.1| RNA methyltransferase, TrmH family, group 3 [Paenibacillus sp.
           HGF5]
          Length = 250

 Score =  132 bits (332), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 67/246 (27%), Positives = 119/246 (48%), Gaps = 13/246 (5%)

Query: 46  PENLFLYGVHTVSAALNNPSRKIFQLLATKNALARL---DWDANLPHPFPVKTVPPQTID 102
            E   + G H+V+ AL +  R I ++   +NA   L              ++ V  + +D
Sbjct: 3   QEEEVVAGKHSVTEALKSG-RTINKIWIAENAQKHLTLPIIAEAKKLGIVIQHVDKRKLD 61

Query: 103 KIVGKEAVHQGLALETAPLLSPTLDA-------VRNSQLLMVLDHVNDPHNIGAILRSAV 155
           ++V     HQG+  + AP     +D              L++LD + DPHN+G+ILR+A 
Sbjct: 62  QMV-PGVQHQGVVAQAAPYAYVEVDDLLKAAEEKGEPPFLLLLDEIEDPHNLGSILRTAD 120

Query: 156 AFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSD 215
                G+I  KR S   +A ++K+++GA+E++P  R++NL   + ++   G   +G   D
Sbjct: 121 CTGAHGVILPKRRSAQVTATVSKTSAGAVEYVPVARVTNLGQTIDQLKEMGVWVVGTVVD 180

Query: 216 SKKP-LEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
           + +   + E+ +  +A+++G E KG+    +E    +  L M G I +LN S AA V +Y
Sbjct: 181 AVQELYDTEVFDGPVAIVIGNENKGMGRLIREKCDVLVKLPMAGKINSLNASVAAGVVMY 240

Query: 275 ITQNHF 280
                 
Sbjct: 241 EVLRRR 246


>gi|327460672|gb|EGF07007.1| RNA methyltransferase [Streptococcus sanguinis SK1]
 gi|332359937|gb|EGJ37751.1| RNA methyltransferase [Streptococcus sanguinis SK1056]
          Length = 242

 Score =  132 bits (332), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 72/242 (29%), Positives = 118/242 (48%), Gaps = 9/242 (3%)

Query: 46  PENLFLYGVHTVSAALNNP-SRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKI 104
            +N  +YGVH V+ AL      K++     +        D        +   P +T+ ++
Sbjct: 2   EKNDIVYGVHAVTEALAANTGNKLYIQDDLRGKKVDKIKDLAAEKKVSISWTPKKTLQEM 61

Query: 105 VGKEAVHQGLALETAPLLSPTLD------AVRNSQLLMVLDHVNDPHNIGAILRSAVAFS 158
               AVHQG  L  A       +         ++ LL++LD + DPHN+G+ILR+A A +
Sbjct: 62  TD-GAVHQGFVLRVAEFAYTDFEVLLKKAEQEDNPLLLILDGLTDPHNLGSILRTADATN 120

Query: 159 CDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKK 218
             G+I  K  +   + V+AK+++GA+EHIP  R++NL+  L K+   GF   G       
Sbjct: 121 VAGVIIPKHRAVGVTPVVAKTSTGAIEHIPIARVTNLSQTLDKLKEAGFWIFGTDMQGTP 180

Query: 219 PLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQN 278
             +      K+ALI+G EGKG+    ++    M  + M G +++LN S AAA+ +Y    
Sbjct: 181 SHKWNTA-GKLALIIGNEGKGISSNIKKQVDEMISIPMNGHVQSLNASVAAAILMYEVFR 239

Query: 279 HF 280
           + 
Sbjct: 240 NR 241


>gi|125718827|ref|YP_001035960.1| tRNA (guanosine-2'-O-)-methyltransferase [Streptococcus sanguinis
           SK36]
 gi|125498744|gb|ABN45410.1| tRNA (Guanosine-2'-O-)-methyltransferase, TrmH family, putative
           [Streptococcus sanguinis SK36]
 gi|327488747|gb|EGF20546.1| RNA methyltransferase [Streptococcus sanguinis SK1058]
          Length = 242

 Score =  132 bits (332), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 72/242 (29%), Positives = 117/242 (48%), Gaps = 9/242 (3%)

Query: 46  PENLFLYGVHTVSAALNNP-SRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKI 104
            +N  +YGVH V+ AL      K++              D        +   P +T+ ++
Sbjct: 2   EKNDIVYGVHAVTEALAANTGNKLYIQDDLCGKKVDKIKDLAAEKKVSISWTPKKTLQEM 61

Query: 105 VGKEAVHQGLALETAPLLSPTLD------AVRNSQLLMVLDHVNDPHNIGAILRSAVAFS 158
               AVHQG  L  A       +         ++ LL++LD + DPHN+G+ILR+A A +
Sbjct: 62  TD-GAVHQGFVLRVAEFAYTDFEVLLKKAEQEDNPLLLILDGLTDPHNLGSILRTADATN 120

Query: 159 CDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKK 218
             G+I  K  +   + V+AK+++GA+EHIP  R++NL+  L K+   GF   G       
Sbjct: 121 VAGVIIPKHRAVGVTPVVAKTSTGAIEHIPIARVTNLSQTLDKLKEAGFWIFGTDMQGTP 180

Query: 219 PLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQN 278
             +      K+ALI+G EGKG+    ++    M  + M G +++LN S AAA+ +Y    
Sbjct: 181 SHKWNTA-GKLALIIGNEGKGISSNIKKQVDEMISIPMNGHVQSLNASVAAAILMYEVFR 239

Query: 279 HF 280
           + 
Sbjct: 240 NR 241


>gi|217965671|ref|YP_002351349.1| RNA methyltransferase, TrmH family, group 3 [Listeria monocytogenes
           HCC23]
 gi|217334941|gb|ACK40735.1| RNA methyltransferase, TrmH family, group 3 [Listeria monocytogenes
           HCC23]
 gi|307569780|emb|CAR82959.1| RNA methyltransferase, TrmH family, group 3 [Listeria monocytogenes
           L99]
          Length = 251

 Score =  132 bits (332), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 63/248 (25%), Positives = 116/248 (46%), Gaps = 13/248 (5%)

Query: 43  TSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWD---ANLPHPFPVKTVPPQ 99
             + E  ++ G + V   L +  R I ++   + +   +              V+ VP Q
Sbjct: 2   EQENEQEWIGGRNPVLEVLRSD-RDIHKIYVQEGSQKGVLKQVLTLAKDRKIQVQFVPKQ 60

Query: 100 TIDKIVGKEAVHQGLALETAPLLSPTLDA-------VRNSQLLMVLDHVNDPHNIGAILR 152
            I+K+V     HQG+A + A      LD               ++LD + DPHN+G+I+R
Sbjct: 61  KIEKVVS--GAHQGVAAQVAAYQYAELDDLFAAAEAKDEMPFFIILDELEDPHNLGSIMR 118

Query: 153 SAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGL 212
           +A +    GII  KR S   +  +AK+++GA+E++P +R++N+   ++++   G    G 
Sbjct: 119 TADSVGAHGIIIPKRRSVGLTQTVAKASTGAMEYVPVVRVTNMVRTMEELQKRGLWIFGT 178

Query: 213 SSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVA 272
            +           +  +A+++G+EG G+    +E    + HL M G + +LN S AA++ 
Sbjct: 179 DAKGSSDYRTMDVDMPLAIVIGSEGFGMSRLVREKCDFLVHLPMRGKVTSLNASVAASLL 238

Query: 273 LYITQNHF 280
           LY      
Sbjct: 239 LYEVYRKR 246


>gi|319407885|emb|CBI81537.1| tRNA/rRNA methyltransferase protein, TrmH family [Bartonella
           schoenbuchensis R1]
          Length = 279

 Score =  132 bits (332), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 47/256 (18%), Positives = 94/256 (36%), Gaps = 4/256 (1%)

Query: 26  NHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDA 85
           ++   K +++ NQK ++ ++       G+  V  ALN        +L+       +  + 
Sbjct: 16  SNPIIKSLKALNQK-KNRNRDGVFMAEGLKLVIDALNLGWAIQTLILSKNKVGNTVIENI 74

Query: 86  NL---PHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDHVN 142
                     V     + ++ I  ++     + +         +       + + LD V 
Sbjct: 75  AARTVARGGFVIKASQKVMESITRRDNPQTVVGIFKQQWHPIEMIKGLTQDVYIALDRVR 134

Query: 143 DPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKM 202
           DP N+G I+R+A A    G++     +   S    ++  G++  +P  R S         
Sbjct: 135 DPGNLGTIIRTADAVGAKGVMLIGETTDPFSPETVRATMGSIFSVPLYRFSESAFLNWST 194

Query: 203 HSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKA 262
           H  G         S      ++K   I L++G E +GL     +    +  +   G   +
Sbjct: 195 HFKGIIIGTHLKTSVDYRSVDLKKGPIILLMGNEQQGLPDVLADRCDQLVRIPQNGRADS 254

Query: 263 LNVSNAAAVALYITQN 278
           LN++ A AV LY  + 
Sbjct: 255 LNLAIATAVMLYEIRR 270


>gi|315612889|ref|ZP_07887800.1| RNA methyltransferase [Streptococcus sanguinis ATCC 49296]
 gi|315314999|gb|EFU63040.1| RNA methyltransferase [Streptococcus sanguinis ATCC 49296]
          Length = 242

 Score =  132 bits (332), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 74/240 (30%), Positives = 121/240 (50%), Gaps = 9/240 (3%)

Query: 48  NLFLYGVHTVSAAL-NNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVG 106
           N  +YGVH V+ AL  N   K++     +        +        +     +++ ++  
Sbjct: 4   NDIVYGVHAVTEALLANTGNKLYLQEDLRGKNVEKVKELATEKRVSISWTSKKSLSEMT- 62

Query: 107 KEAVHQGLALETAPLLSPTLDA------VRNSQLLMVLDHVNDPHNIGAILRSAVAFSCD 160
           + AVHQG  L  +      LD          + LL++LD + DPHN+G+ILR+A A +  
Sbjct: 63  EGAVHQGFVLRVSEFAYSELDHILAKTRQEENPLLLILDGLTDPHNLGSILRTADATNVS 122

Query: 161 GIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPL 220
           G+I  K  +   + V+AK+A+GA+EH+P  R++NL+  L K+   GF T G   +     
Sbjct: 123 GVIIPKHRAVGVTPVVAKTATGAIEHVPIARVTNLSQTLDKLKDEGFWTFGTDMNGTPCH 182

Query: 221 EQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
           +   K  KIALI+G EGKG+    ++    M  + M G +++LN S AAA+ +Y    + 
Sbjct: 183 KWNTK-GKIALIIGNEGKGISSNIKKQVDEMITIPMNGHVQSLNASVAAAILMYEVFRNR 241


>gi|325126130|gb|ADY85460.1| rRNA methylase [Lactobacillus delbrueckii subsp. bulgaricus 2038]
          Length = 254

 Score =  132 bits (332), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 53/256 (20%), Positives = 99/256 (38%), Gaps = 5/256 (1%)

Query: 21  AKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALAR 80
            +   N+   K +    QK ++  +     + G H V  AL   S K  ++LAT+ AL+R
Sbjct: 3   ERTSVNNPQIKAIGKLQQK-KYREESGYYLIEGFHLVEEALKA-SVKYREILATEAALSR 60

Query: 81  LDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDH 140
           L           +  +       +   +                   +     LL   D 
Sbjct: 61  LAQLGLAYDEGKLIKISQSVASHLSSTKNSQDIFMTVKINRPKHFAFSYGKWVLL---DD 117

Query: 141 VNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQ 200
           + DP N+G I+R+A A   DG+I + +     +  + +S  G+  H+  I+         
Sbjct: 118 LADPGNVGTIIRTADAAGFDGVILSNKTVDLYNPKVQRSMQGSQFHLNLIKADLPDAIAS 177

Query: 201 KMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGII 260
              +       L   + K L   +   ++ALI+G E  G+ P+ +  A    ++ + G  
Sbjct: 178 LKAADIPVYASLLDPAAKQLGDFVPVAQVALIIGNEAHGVSPEIEALADEKLYIPIKGRA 237

Query: 261 KALNVSNAAAVALYIT 276
           ++LN + AA + +Y  
Sbjct: 238 ESLNAAVAAGIMIYHF 253


>gi|168491355|ref|ZP_02715498.1| RNA methyltransferase, TrmH family, group 3 [Streptococcus
           pneumoniae CDC0288-04]
 gi|183574511|gb|EDT95039.1| RNA methyltransferase, TrmH family, group 3 [Streptococcus
           pneumoniae CDC0288-04]
          Length = 242

 Score =  132 bits (332), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 74/240 (30%), Positives = 121/240 (50%), Gaps = 9/240 (3%)

Query: 48  NLFLYGVHTVSAAL-NNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVG 106
           N  +YGVH V+ AL  N   K++     +        +        +     +++ ++  
Sbjct: 4   NDIVYGVHAVTEALLANTGNKLYLQEDLRGKNVEKVKELATEKKVSISWTSKKSLSEMT- 62

Query: 107 KEAVHQGLALETAPLLSPTLDA------VRNSQLLMVLDHVNDPHNIGAILRSAVAFSCD 160
           + AVHQG  L  +      LD          + LL++LD + DPHN+G+ILR+A A +  
Sbjct: 63  EGAVHQGFVLRVSEFAYSELDYILAKTRQEENSLLLILDGLTDPHNLGSILRTADATNVS 122

Query: 161 GIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPL 220
           G+I  K  +   + V+AK+A+GA+EH+P  R++NL+  L K+   GF T G   +     
Sbjct: 123 GVIIPKHRAVGVTPVVAKTATGAIEHVPIARVTNLSQTLDKLKDEGFWTFGTDMNGTPCH 182

Query: 221 EQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
           +   K  KIALI+G EGKG+    ++    M  + M G +++LN S AAA+ +Y    + 
Sbjct: 183 KWNTK-GKIALIIGNEGKGISSNIKKQVDEMITIPMNGHVQSLNASVAAAILMYEVFRNR 241


>gi|15901307|ref|NP_345911.1| spoU rRNA methylase family protein [Streptococcus pneumoniae TIGR4]
 gi|111657374|ref|ZP_01408131.1| hypothetical protein SpneT_02001428 [Streptococcus pneumoniae
           TIGR4]
 gi|221232182|ref|YP_002511335.1| SpoU rRNA methylase family protein [Streptococcus pneumoniae ATCC
           700669]
 gi|225854898|ref|YP_002736410.1| RNA methyltransferase, TrmH family, group 3 [Streptococcus
           pneumoniae JJA]
 gi|14972946|gb|AAK75551.1| RNA methyltransferase, TrmH family, group 3 [Streptococcus
           pneumoniae TIGR4]
 gi|220674643|emb|CAR69212.1| SpoU rRNA methylase family protein [Streptococcus pneumoniae ATCC
           700669]
 gi|225722312|gb|ACO18165.1| RNA methyltransferase, TrmH family, group 3 [Streptococcus
           pneumoniae JJA]
          Length = 242

 Score =  132 bits (332), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 75/240 (31%), Positives = 121/240 (50%), Gaps = 9/240 (3%)

Query: 48  NLFLYGVHTVSAAL-NNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVG 106
           N  +YGVH V+ AL  N   K++     +        +        +     +++ +I  
Sbjct: 4   NDIVYGVHAVTEALLANTGNKLYLQEDLRGKNVEKVKELATEKKVSISWTSKKSLSEIT- 62

Query: 107 KEAVHQGLALETAPLLSPTLDA------VRNSQLLMVLDHVNDPHNIGAILRSAVAFSCD 160
           + AVHQG  L  +      LD          + LL++LD + DPHN+G+ILR+A A +  
Sbjct: 63  EGAVHQGFVLRVSEFAYSELDYILAKTRQEENPLLLILDGLTDPHNLGSILRTADATNVS 122

Query: 161 GIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPL 220
           G+I  K  +   + V+AK+A+GA+EH+P  R++NL+  L K+   GF T G   +     
Sbjct: 123 GVIIPKHRTVGVTPVVAKTATGAIEHVPIARVTNLSQTLDKLKDEGFWTFGTDMNGTPCH 182

Query: 221 EQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
           +   K  KIALI+G EGKG+    ++    M  + M G +++LN S AAA+ +Y    + 
Sbjct: 183 KWNTK-GKIALIIGNEGKGISSNIKKQVDEMITIPMNGHVQSLNASVAAAILMYEVFRNR 241


>gi|313203183|ref|YP_004041840.1| RNA methyltransferase, trmh family, group 3 [Paludibacter
           propionicigenes WB4]
 gi|312442499|gb|ADQ78855.1| RNA methyltransferase, TrmH family, group 3 [Paludibacter
           propionicigenes WB4]
          Length = 255

 Score =  132 bits (332), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 65/250 (26%), Positives = 112/250 (44%), Gaps = 13/250 (5%)

Query: 41  RHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHP---FPVKTVP 97
           ++  +PE   ++G+  V  A+      I ++L  ++  + L  +          PV+ VP
Sbjct: 5   KNKRRPEKDMIFGIRAVIEAIQAGKE-IDKILMRRDMTSELSRELFAALNGLQIPVQYVP 63

Query: 98  PQTIDKIVGKEAVHQGLALETAPLLSPTLDAV-------RNSQLLMVLDHVNDPHNIGAI 150
            + ++K+      HQG     +P+    ++ +            ++VLD V D  N GAI
Sbjct: 64  LEKLNKMT--VKNHQGAIAFISPVAYQRIEDIIPGIYEEGRMPFIVVLDGVTDVRNFGAI 121

Query: 151 LRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTI 210
            R+      D I+   +   S +    K+++GAL  IP  R  NL +AL+ + S G + +
Sbjct: 122 ARTCECAGVDAIVIPTKGGASITGDAIKTSAGALLSIPVCREENLGNALKFIVSSGIKLV 181

Query: 211 GLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAA 270
             S  + K   +    + IA+I+GAE +G+ P        M  + M G I +LNVS AA 
Sbjct: 182 AASEKATKNYTEAALTEPIAIIMGAEDEGVNPDHLRLCDEMVSIPMLGSIDSLNVSVAAG 241

Query: 271 VALYITQNHF 280
           V +Y      
Sbjct: 242 VLIYEAVRQR 251


>gi|303240980|ref|ZP_07327490.1| RNA methyltransferase, TrmH family, group 3 [Acetivibrio
           cellulolyticus CD2]
 gi|302591405|gb|EFL61143.1| RNA methyltransferase, TrmH family, group 3 [Acetivibrio
           cellulolyticus CD2]
          Length = 333

 Score =  132 bits (332), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 64/292 (21%), Positives = 122/292 (41%), Gaps = 17/292 (5%)

Query: 7   KKSEKIFSLKDSHYAKLRRNHRDYKKMQSFNQKSRHTSQ-------PENLFLYGVHTVSA 59
           + +E+             R  R   + + FN++                  L G ++V  
Sbjct: 43  RSNERPERSGGRPERSNERPERSSGRPERFNERPPRIENKEMEDLNEGLDKLEGRNSVLE 102

Query: 60  ALNNPS--RKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALE 117
           A+ +     KI      K    +            V+     ++DKI    + HQG+   
Sbjct: 103 AIKSDRTINKILVSKGDKEGSIKQIIALAREKGIIVQETDRVSLDKISTTHS-HQGVIAF 161

Query: 118 TAPLLSPTLDAV-------RNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSP 170
            A      +D +         +  +++LD + DPHN+G+ILR+A A    G++  KR + 
Sbjct: 162 VAVKDYVEVDDILEIAQSKGEAPFIIILDGITDPHNLGSILRTANAVGAHGVVIPKRRAI 221

Query: 171 SESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIA 230
             +A ++K+++GA+E++P  R++N+   +  +       +G     +K   +      IA
Sbjct: 222 GLTAAVSKASAGAIEYVPVARVTNIAQTIDYLKEQNLWVVGTDQSGEKSFYEIDLKGPIA 281

Query: 231 LILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHFAK 282
           L++G+EG+G+     E    + +L M G I +LN + A A+ +Y       K
Sbjct: 282 LVIGSEGEGMGKLVSEKCDFVVNLPMKGQISSLNAAVAGAIVMYEILKQRGK 333


>gi|24378679|ref|NP_720634.1| putative tRNA/rRNA methyltransferase [Streptococcus mutans UA159]
 gi|24376542|gb|AAN57940.1|AE014868_2 putative tRNA/rRNA methyltransferase [Streptococcus mutans UA159]
          Length = 248

 Score =  132 bits (332), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 74/243 (30%), Positives = 120/243 (49%), Gaps = 9/243 (3%)

Query: 46  PENLFLYGVHTVSAALNNP-SRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKI 104
                +YGVH V  +L      K++     +        D       P+   P +T+  +
Sbjct: 8   ENTDIVYGVHAVIESLQANTGHKLYIQNDLRGKNVDKIKDLAAEKKVPISWTPKKTLSDM 67

Query: 105 VGKEAVHQGLALETAPLLSPTLDA------VRNSQLLMVLDHVNDPHNIGAILRSAVAFS 158
             K AVHQG  L  +       +         ++ LL++LD +NDPHN G+ILR+A A +
Sbjct: 68  T-KGAVHQGFILHVSAFAYTEFEMLLKKAEREDNPLLLILDELNDPHNFGSILRTADATN 126

Query: 159 CDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKK 218
             GII TK  +   + V+AK+++GA+EHIP  R++NL  AL K+ + GF   G   +   
Sbjct: 127 VTGIIITKHRAVGVTPVVAKTSTGAVEHIPIARVTNLGQALDKLKAAGFWIFGTDMNGTP 186

Query: 219 PLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQN 278
             +    + K+ALI+G EG+G+    ++    M  + M G +++LN S AAA+ +Y    
Sbjct: 187 STQWNT-SGKLALIIGNEGRGISHNIKKQVDEMVTIPMNGHVQSLNASVAAAILMYEVFR 245

Query: 279 HFA 281
           +  
Sbjct: 246 NRK 248


>gi|117617585|ref|YP_855245.1| RNA methyltransferase [Aeromonas hydrophila subsp. hydrophila ATCC
           7966]
 gi|117558992|gb|ABK35940.1| RNA methyltransferase, TrmH family, group 3 [Aeromonas hydrophila
           subsp. hydrophila ATCC 7966]
          Length = 249

 Score =  132 bits (332), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 69/246 (28%), Positives = 112/246 (45%), Gaps = 14/246 (5%)

Query: 48  NLFLYGVHTVSAALNNPSRKIFQLLATKNALA-RLDWDANL--PHPFPVKTVPPQTIDKI 104
              +YG+H VSA L     +  ++ A K     RL             V++V  +T+D  
Sbjct: 3   TELIYGIHAVSALLERTPERFIEVWALKGRDDDRLQPLLAELDALGLKVQSVNRKTLDDK 62

Query: 105 VGKEAVHQGLALETAPLLS----------PTLDAVRNSQLLMVLDHVNDPHNIGAILRSA 154
             +   HQG+                     L   +    L+VLD V DPHN+GA LRSA
Sbjct: 63  A-EGNNHQGIMARVKEAPKLAEHDLASLLDKLAEQQTQPFLLVLDGVTDPHNLGACLRSA 121

Query: 155 VAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSS 214
            A     +I  +  +   + ++ K A GA E +P I+++NL  +L+++   G   +G + 
Sbjct: 122 DAAGVHAVIVPRDKATGLTPIVRKVACGAAEVVPLIQVTNLARSLRELQERGVWIVGTAG 181

Query: 215 DSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
           ++   + Q      +AL++GAEGKG+R  T+E    +  + M G + +LNVS A  V L+
Sbjct: 182 EADHDVYQAKLTGPMALVMGAEGKGMRRLTREHCDELVSIPMAGAVSSLNVSVATGVCLF 241

Query: 275 ITQNHF 280
                 
Sbjct: 242 EAVRQR 247


>gi|148655189|ref|YP_001275394.1| tRNA/rRNA methyltransferase SpoU [Roseiflexus sp. RS-1]
 gi|148567299|gb|ABQ89444.1| tRNA/rRNA methyltransferase (SpoU) [Roseiflexus sp. RS-1]
          Length = 262

 Score =  132 bits (332), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 56/262 (21%), Positives = 95/262 (36%), Gaps = 11/262 (4%)

Query: 24  RRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDW 83
              ++  K+++S         +   L L GV  V+ AL + +     L A  + L     
Sbjct: 4   SPANQHVKRIRSLASDRHERRRERMLVLEGVRLVADALESGATLTLTLYA-PDQLQLTPA 62

Query: 84  DANLPHPFPV----KTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLD 139
            A L              PQ +                   L S    A     LL+V+D
Sbjct: 63  GAALLQKLRYLPASYEATPQVVAAASDTVHPQG-----VVALASWPHVAPGKPGLLLVID 117

Query: 140 HVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDAL 199
            V DP N+G +LRSA A     ++ +       +  + +SA GA   +   +  +     
Sbjct: 118 AVQDPGNLGTLLRSAEAVGVAQVLCSVGTVDLYAPKVVRSAMGAHFRLAMEQDLSWDAIG 177

Query: 200 QKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGI 259
           +++ S          +++ P          AL++G E  GL    +  AT    + M G 
Sbjct: 178 ERLASVDHVYA-ADPEARMPYYAADWRQPSALLVGNEAHGLSDAARRLATKQIAIPMRGG 236

Query: 260 IKALNVSNAAAVALYITQNHFA 281
            ++LNV+ AA+V L+       
Sbjct: 237 TESLNVAVAASVILFEALRQRT 258


>gi|312621714|ref|YP_004023327.1| RNA methyltransferase, TrmH family, group 3 [Caldicellulosiruptor
           kronotskyensis 2002]
 gi|312202181|gb|ADQ45508.1| RNA methyltransferase, TrmH family, group 3 [Caldicellulosiruptor
           kronotskyensis 2002]
          Length = 253

 Score =  132 bits (332), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 55/242 (22%), Positives = 104/242 (42%), Gaps = 12/242 (4%)

Query: 51  LYGVHTVSAALNNPSRKIFQLLATKNALARL---DWDANLPHPFPVKTVPPQTIDKIVGK 107
           + G + V  AL + + KI ++  + +A  +      D        VK V    IDK+  +
Sbjct: 4   IEGKNPVKEALKSGA-KITEVYISTSAKDKETAKIIDLCRQSGVVVKFVDKSKIDKMA-Q 61

Query: 108 EAVHQGLALETAPLLSPTLDAV-------RNSQLLMVLDHVNDPHNIGAILRSAVAFSCD 160
               QG+           +D +            L++LD + DP N G+I+RSA      
Sbjct: 62  TKNPQGVIAIAHEFEYCDIDDILFEAKKSGEEPFLVLLDGITDPQNFGSIIRSAHLCGVH 121

Query: 161 GIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPL 220
           GI+   R S   +  + K+++GA+E++   R+ NL   ++++   G       ++  KP+
Sbjct: 122 GIVIETRNSCPVTPAVEKASAGAVEYMKIARVVNLRRTIEELKEKGIWVFAADANGSKPV 181

Query: 221 EQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
            +        +++G+EGKG+    +E A  +  +   G + + N S AA +  +      
Sbjct: 182 YECDFTIPTCVVIGSEGKGISRLVKEGADFLIKIPQKGYVNSFNASVAAGIIFFEVLKQR 241

Query: 281 AK 282
            K
Sbjct: 242 LK 243


>gi|323492117|ref|ZP_08097279.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Vibrio brasiliensis
           LMG 20546]
 gi|323313678|gb|EGA66780.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Vibrio brasiliensis
           LMG 20546]
          Length = 245

 Score =  132 bits (332), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 71/242 (29%), Positives = 117/242 (48%), Gaps = 10/242 (4%)

Query: 48  NLFLYGVHTVSAAL-NNPSRKIFQLLATKNALARLDWDANLPH--PFPVKTVPPQTIDKI 104
           N ++YG+H V A L   P R I   +       RL    N  +     ++ +  +T+D+ 
Sbjct: 3   NEYIYGIHAVKAVLSREPERFIEAFVLKGRQDDRLLPILNELNVCGVSIQQMTRKTLDEK 62

Query: 105 VGKEAVHQGLALET------APLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFS 158
               A HQG+                 + A   S LL+VLD V DPHN+GA LR+A A  
Sbjct: 63  AS-GANHQGIMARVKPAKQLNEHDLDDIIAQHESPLLLVLDGVTDPHNLGACLRNADAAG 121

Query: 159 CDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKK 218
              +I  K  S + +A ++K A GA E +P +R++NL   ++ +   G   +G + ++  
Sbjct: 122 VAAVIVPKDRSANITATVSKVACGAAEMVPLVRVTNLARTMRTLQEQGIWFVGTAGEATH 181

Query: 219 PLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQN 278
            + Q      +A+++GAEG G+R  T+ET   +  + M G + +LNVS A+ + L+    
Sbjct: 182 DIYQAKLTGPLAIVMGAEGDGMRRLTRETCDDLIKIPMAGTVSSLNVSVASGICLFEAVR 241

Query: 279 HF 280
             
Sbjct: 242 QR 243


>gi|260770911|ref|ZP_05879840.1| 23S rRNA (guanosine-2'-O-) -methyltransferase RlmB [Vibrio
           furnissii CIP 102972]
 gi|260614148|gb|EEX39338.1| 23S rRNA (guanosine-2'-O-) -methyltransferase RlmB [Vibrio
           furnissii CIP 102972]
 gi|315178957|gb|ADT85871.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Vibrio furnissii NCTC
           11218]
          Length = 246

 Score =  132 bits (332), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 69/243 (28%), Positives = 115/243 (47%), Gaps = 10/243 (4%)

Query: 48  NLFLYGVHTVSAALNNPSRKIFQLLATKNALA-RLDWDANLPH--PFPVKTVPPQTIDKI 104
           N F+YG+H V+A L     +  +    K     RL    N        ++ +  + +D  
Sbjct: 3   NEFIYGIHAVNAVLERDPARFVEAYVLKGRQDDRLLPVLNELARLGISIQEMHRKALDDK 62

Query: 105 VGKEAVHQGLALETAPLLS------PTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFS 158
             + A HQG+  +  P           + A     LL+VLD V DPHN+GA LR+A A  
Sbjct: 63  A-QGANHQGVIAKVKPAKQLNENDLDDIIAQHPQPLLLVLDGVTDPHNLGACLRNADAAG 121

Query: 159 CDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKK 218
              +I  K  S   +A ++K A GA E +P +R++NL   ++ +   G   +G + ++  
Sbjct: 122 VAAVIVPKDKSAPMTATVSKVACGAAETVPLVRVTNLARTMRALQEKGIWFVGTAGEATH 181

Query: 219 PLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQN 278
            + Q      +A+++GAEG G+R  T+ET   +  + M G + +LNVS A  + L+    
Sbjct: 182 DIYQSKLTGPLAIVMGAEGDGMRRLTRETCDDLIKIPMAGSVSSLNVSVATGICLFEAVR 241

Query: 279 HFA 281
             +
Sbjct: 242 QRS 244


>gi|227498998|ref|ZP_03929135.1| RNA methyltransferase [Acidaminococcus sp. D21]
 gi|226904447|gb|EEH90365.1| RNA methyltransferase [Acidaminococcus sp. D21]
          Length = 249

 Score =  132 bits (332), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 65/243 (26%), Positives = 108/243 (44%), Gaps = 10/243 (4%)

Query: 48  NLFLYGVHTVSAALN--NPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIV 105
           +  + G + V  AL    P +K+  L +             +     V+ V  + +D++ 
Sbjct: 2   SDIIAGRNAVREALRGTRPIQKVLVLESGHGGSFEEILSLCVKRHVAVERVNKERLDRLS 61

Query: 106 GKEAVHQGLALETAPLLSPTLD-------AVRNSQLLMVLDHVNDPHNIGAILRSAVAFS 158
                HQG+    + +    LD              L++LD + DP NIGA++RSA A  
Sbjct: 62  PDVR-HQGVVAVGSAVAFRDLDEVLEGVAQKGKVPFLLLLDELQDPQNIGALIRSANAAG 120

Query: 159 CDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKK 218
            D +I  +R S    AV+AK ++GALEH P + ++NL   ++ +   GF  +G   D K 
Sbjct: 121 VDAVIVPQRRSAPLGAVVAKISAGALEHEPVVSVTNLVRTMKDLKKRGFWIVGADMDGKD 180

Query: 219 PLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQN 278
                     + L++GAEGKG+    +E    +  + M G +++LN S A  + LY    
Sbjct: 181 LYFDADLTGPLVLVVGAEGKGVGRLVKENCDFLVRIPMLGQVQSLNASVAGGILLYEITR 240

Query: 279 HFA 281
              
Sbjct: 241 QRI 243


>gi|219666287|ref|YP_002456722.1| tRNA/rRNA methyltransferase (SpoU) [Desulfitobacterium hafniense
           DCB-2]
 gi|219536547|gb|ACL18286.1| tRNA/rRNA methyltransferase (SpoU) [Desulfitobacterium hafniense
           DCB-2]
          Length = 271

 Score =  132 bits (332), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 52/286 (18%), Positives = 99/286 (34%), Gaps = 29/286 (10%)

Query: 3   LISKKKSEKIFSLKDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALN 62
           +++  ++E++  + + H                   K +   +     + G   V   L 
Sbjct: 1   MLTSLQNEQVKYVVNLH-------------------KRKFREENGEFLIEGWRFVEEGLA 41

Query: 63  NPS--RKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAP 120
             +   K+F     KN       +A      PV  V  + + K+   E     LA+    
Sbjct: 42  RGAHLTKVFFCSECKNESWPQLAEALKVKGVPVIEVDERVLRKMSDTENPQGILAVVKQS 101

Query: 121 LLSPTLDA-------VRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSES 173
             +                 +L++LD V DP N G ILR+A+A     +  T+      +
Sbjct: 102 RWTWDDFIEIVNPAGRSAIPMLLILDGVQDPGNCGTILRTALAAGVTQVCLTEGTVDLYN 161

Query: 174 AVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALIL 233
             + +S  GA+     I      + + K+       + +       L +      +AL++
Sbjct: 162 LKVLRSTMGAIF-SLNIVTHCQPEEILKVCRSHKIPVFVGDVEGTDLYETHFAQPMALVV 220

Query: 234 GAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNH 279
           G EG G     Q        + M   +++LNV+ A  + LY  +  
Sbjct: 221 GNEGNGPSAAFQGPGVKRITIPMSHQVESLNVAMATGIILYEVRRR 266


>gi|28899580|ref|NP_799185.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Vibrio
           parahaemolyticus RIMD 2210633]
 gi|260361407|ref|ZP_05774469.1| RNA methyltransferase, TrmH family, group 3 [Vibrio
           parahaemolyticus K5030]
 gi|260876679|ref|ZP_05889034.1| RNA methyltransferase, TrmH family, group 3 [Vibrio
           parahaemolyticus AN-5034]
 gi|260896628|ref|ZP_05905124.1| RNA methyltransferase, TrmH family, group 3 [Vibrio
           parahaemolyticus Peru-466]
 gi|260900887|ref|ZP_05909282.1| RNA methyltransferase, TrmH family, group 3 [Vibrio
           parahaemolyticus AQ4037]
 gi|52783311|sp|Q87L11|RLMB_VIBPA RecName: Full=23S rRNA (guanosine-2'-O-)-methyltransferase RlmB;
           AltName: Full=23S rRNA Gm2251 2'-O-methyltransferase
 gi|28807816|dbj|BAC61069.1| RNA methyltransferase, TrmH family [Vibrio parahaemolyticus RIMD
           2210633]
 gi|308086301|gb|EFO35996.1| RNA methyltransferase, TrmH family, group 3 [Vibrio
           parahaemolyticus Peru-466]
 gi|308093965|gb|EFO43660.1| RNA methyltransferase, TrmH family, group 3 [Vibrio
           parahaemolyticus AN-5034]
 gi|308106500|gb|EFO44040.1| RNA methyltransferase, TrmH family, group 3 [Vibrio
           parahaemolyticus AQ4037]
 gi|308112895|gb|EFO50435.1| RNA methyltransferase, TrmH family, group 3 [Vibrio
           parahaemolyticus K5030]
          Length = 247

 Score =  132 bits (332), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 71/242 (29%), Positives = 113/242 (46%), Gaps = 10/242 (4%)

Query: 48  NLFLYGVHTVSAALNNPSRKIFQLLATKNALA-RLDWDANLPH--PFPVKTVPPQTIDKI 104
           N F+YG+H V A L     +  +    K     RL    N        ++ +  +T+D  
Sbjct: 3   NEFIYGIHAVKAVLEREPERFIEAYVLKGRQDDRLMPILNDLQVCGVSIQQMTRKTLDDK 62

Query: 105 VGKEAVHQGLALET------APLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFS 158
               A HQG+                 + A   + LL+VLD V DPHN+GA LR+A A  
Sbjct: 63  A-HGANHQGIIARVKVAKQLNENDIDDILAQHETPLLLVLDGVTDPHNLGACLRNADAAG 121

Query: 159 CDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKK 218
              II  K  S   +A ++K A GA E +P IR++NL   ++ +   G   +G + ++  
Sbjct: 122 VAAIIVPKDRSAPMNATVSKVACGAAEVVPLIRVTNLARTMRTLQEQGIWFVGTAGEATH 181

Query: 219 PLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQN 278
            + Q      +A+++GAEG G+R  T+ET   +  + M G + +LNVS A+ + L+    
Sbjct: 182 DIYQAKLTGPLAIVMGAEGDGMRRLTRETCDDLIKIPMAGSVSSLNVSVASGICLFEAVR 241

Query: 279 HF 280
             
Sbjct: 242 QR 243


>gi|325695531|gb|EGD37431.1| tRNA (guanosine-2'-O-)-methyltransferase [Streptococcus sanguinis
           SK150]
          Length = 242

 Score =  132 bits (332), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 72/242 (29%), Positives = 118/242 (48%), Gaps = 9/242 (3%)

Query: 46  PENLFLYGVHTVSAALNNP-SRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKI 104
            +N  +YGVH V+ AL      K++     +        D        +   P +T+ ++
Sbjct: 2   EKNDIVYGVHAVTEALAANTGNKLYIQDDLRGKKVDKIKDLAAEKKVSISWTPKKTLQEM 61

Query: 105 VGKEAVHQGLALETAPLLSPTLD------AVRNSQLLMVLDHVNDPHNIGAILRSAVAFS 158
               AVHQG  L  A       +         ++ LL++LD + DPHN+G+ILR+A A +
Sbjct: 62  TD-GAVHQGFVLRVAEFAYTDFEVLLKKAEQEDNPLLLILDGLTDPHNLGSILRTADATN 120

Query: 159 CDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKK 218
             G+I  K  +   + V+AK+++GA+EHIP  R++NL+  L K+   GF   G       
Sbjct: 121 VAGVIIPKHRAVGVTPVVAKTSTGAIEHIPIARVTNLSQTLDKLKEAGFWIFGTDMQGTP 180

Query: 219 PLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQN 278
             +      K+ALI+G EGKG+    ++    M  + M G +++LN S AAA+ +Y    
Sbjct: 181 SHKWNTA-GKLALIIGNEGKGISTNIKKQVDEMISIPMNGHVQSLNASVAAAILMYEVFR 239

Query: 279 HF 280
           + 
Sbjct: 240 NR 241


>gi|300813179|ref|ZP_07093553.1| RNA methyltransferase, TrmH family [Lactobacillus delbrueckii
           subsp. bulgaricus PB2003/044-T3-4]
 gi|300495837|gb|EFK30985.1| RNA methyltransferase, TrmH family [Lactobacillus delbrueckii
           subsp. bulgaricus PB2003/044-T3-4]
          Length = 254

 Score =  132 bits (332), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 53/256 (20%), Positives = 97/256 (37%), Gaps = 5/256 (1%)

Query: 21  AKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALAR 80
            +   N+   K +    QK ++  +     + G H V  AL   S K  ++LAT+ AL+R
Sbjct: 3   ERTSVNNPQIKAIGKLQQK-KYREESGYYLIEGFHLVEEALKA-SVKYREILATEAALSR 60

Query: 81  LDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDH 140
           L           +  +       +   +                   +     LL   D 
Sbjct: 61  LAQLGLAYDESKLIKISQSVASHLSSTKNSQDIFMTVKINQSEHFAFSYGKWVLL---DD 117

Query: 141 VNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQ 200
           + DP N+G I+R+A A   DG+I + +     +  + +S  G+  H+  I+         
Sbjct: 118 LADPGNVGTIIRTADAAGFDGVILSNKTVDLYNPKVQRSMQGSQFHLNLIKADLPDAIAS 177

Query: 201 KMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGII 260
              +       L   + K L       ++ALI+G E  G+ P+    A    ++ + G  
Sbjct: 178 LKAADIPVYASLLDPAAKQLGDFAPVAQVALIIGNEAHGVSPEIAALADEKLYIPIKGRA 237

Query: 261 KALNVSNAAAVALYIT 276
           ++LN + AA + +Y  
Sbjct: 238 ESLNAAVAAGIMIYHF 253


>gi|291542636|emb|CBL15746.1| rRNA methylases [Ruminococcus bromii L2-63]
          Length = 260

 Score =  132 bits (332), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 46/257 (17%), Positives = 102/257 (39%), Gaps = 4/257 (1%)

Query: 24  RRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDW 83
            +++ + K      + +++  +       GV     A+ + +  I    A++ A  +   
Sbjct: 6   SKDNSNIKNAVKLRKSAKYRRESGLFIAEGVRICMDAMLSKAH-IDTFFASEKASEKYAD 64

Query: 84  DANLPHPF--PVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDHV 141
           D +    +      V  +  +++   E+    L +  A   +   D ++     + LD++
Sbjct: 65  DFSNLQKYSDKTFIVSDKIFNQMCDTESPQGFLCVIKALDKTACFDKIKTGDKFLALDNL 124

Query: 142 NDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQK 201
            DP N+G ILR+A A +  GI+ +       S  + + + GA+  +P++    +      
Sbjct: 125 QDPGNLGTILRTAEALNVTGIVLSADCCDIYSPKVVRGSMGAVFRLPFVVSDTI-SGYLN 183

Query: 202 MHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIK 261
            HS       + S S   +          + +G EG GL+ +T         + M G  +
Sbjct: 184 AHSELESYAAVVSASADKITTTPFVSPCIVAVGNEGNGLKEETISACKHKITIPMEGRAE 243

Query: 262 ALNVSNAAAVALYITQN 278
           +LN + AA++ ++    
Sbjct: 244 SLNAAVAASIIMWEMMK 260


>gi|309782307|ref|ZP_07677034.1| RNA methyltransferase, TrmH family, group 3 [Ralstonia sp.
           5_7_47FAA]
 gi|308918925|gb|EFP64595.1| RNA methyltransferase, TrmH family, group 3 [Ralstonia sp.
           5_7_47FAA]
          Length = 250

 Score =  132 bits (332), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 74/239 (30%), Positives = 117/239 (48%), Gaps = 7/239 (2%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLATKNALARLDWD---ANLPHPFPVKTVPPQTIDKIVG 106
            L G H V+A L + ++ I ++    N   R   D   A       +       +  I G
Sbjct: 6   LLIGFHAVTARLRHGAKSIDEIYFEANRRDRRMQDFLKAAEAAGVRLIPADADRLRGIAG 65

Query: 107 KEAVHQGLALETAP----LLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGI 162
            +     +A   +      L   LD +  + LL+VLD V DPHN+GA LR A A     +
Sbjct: 66  TDRHQGVVAKAESLSLALNLDELLDGIEGTPLLLVLDGVTDPHNLGACLRVADAAGAHAV 125

Query: 163 ITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQ 222
           I  K  S   +  +AK ASGA E +PYI ++NL   L+++   G   IG + ++++ L Q
Sbjct: 126 IAPKDRSVGINTTVAKVASGAAETVPYITVTNLARTLRELQERGVWVIGTADEAEQDLYQ 185

Query: 223 EIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHFA 281
                  A+++GAEG+G+R  T+ET  ++  + M G +++LNVS A+ V L+      A
Sbjct: 186 ADFKGPTAIVMGAEGEGMRRLTRETCDALVSIPMAGSVESLNVSVASGVCLFEAVRQRA 244


>gi|187928166|ref|YP_001898653.1| TrmH family RNA methyltransferase [Ralstonia pickettii 12J]
 gi|187725056|gb|ACD26221.1| RNA methyltransferase, TrmH family, group 3 [Ralstonia pickettii
           12J]
          Length = 250

 Score =  132 bits (332), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 74/239 (30%), Positives = 117/239 (48%), Gaps = 7/239 (2%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLATKNALARLDWD---ANLPHPFPVKTVPPQTIDKIVG 106
            L G H V+A L + ++ I ++    N   R   D   A       +       +  I G
Sbjct: 6   LLIGFHAVTARLRHGAKSIDEIYFEANRRDRRMQDFLKAAEAAGVRLIPADADRLRGIAG 65

Query: 107 KEAVHQGLALETAP----LLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGI 162
            +     +A   +      L   LD +  + LL+VLD V DPHN+GA LR A A     +
Sbjct: 66  TDRHQGVVAKAESLSLALNLDELLDGIEGTPLLLVLDGVTDPHNLGACLRVADAAGAHAV 125

Query: 163 ITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQ 222
           I  K  S   +  +AK ASGA E +PYI ++NL   L+++   G   IG + ++++ L Q
Sbjct: 126 IAPKDRSVGINTTVAKVASGAAETVPYITVTNLARTLRELQERGVWVIGTADEAEQDLYQ 185

Query: 223 EIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHFA 281
                  A+++GAEG+G+R  T+ET  ++  + M G +++LNVS A+ V L+      A
Sbjct: 186 ADFKGPTAIVMGAEGEGMRRLTRETCDALVSIPMAGSVESLNVSVASGVCLFEAVRQRA 244


>gi|116514430|ref|YP_813336.1| rRNA methylase [Lactobacillus delbrueckii subsp. bulgaricus ATCC
           BAA-365]
 gi|116093745|gb|ABJ58898.1| rRNA methylase [Lactobacillus delbrueckii subsp. bulgaricus ATCC
           BAA-365]
          Length = 254

 Score =  132 bits (332), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 53/256 (20%), Positives = 98/256 (38%), Gaps = 5/256 (1%)

Query: 21  AKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALAR 80
            +   N+   K +    QK ++  +     + G H V  AL   S K  ++LAT+ AL+R
Sbjct: 3   ERTSVNNPQIKAIGKLQQK-KYREESGYYLIEGFHLVEEALKA-SVKYREILATEAALSR 60

Query: 81  LDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDH 140
           L           +  +       +   +                   +     LL   D 
Sbjct: 61  LAQLGLAYDEGKLIKISQSVASHLSSTKNSQDIFMTVKINRPKHFAFSYGKWVLL---DD 117

Query: 141 VNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQ 200
           + DP N+G I+R+A A   DG+I + +     +  + +S  G+  H+  I+         
Sbjct: 118 LADPGNVGTIIRTADAAGFDGVILSNKTVDLYNPKVQRSMQGSQFHLNLIKADLPDAIAS 177

Query: 201 KMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGII 260
              +       L   + K L       ++ALI+G E  G+ P+ +  A    ++ + G  
Sbjct: 178 LKAADIPVYASLLDPAAKQLGDFAPVAQVALIIGNEAHGVSPEIEALADEKLYIPIKGRA 237

Query: 261 KALNVSNAAAVALYIT 276
           ++LN + AA + +Y  
Sbjct: 238 ESLNAAVAAGIMIYHF 253


>gi|330828261|ref|YP_004391213.1| TrmH family RNA methyltransferase [Aeromonas veronii B565]
 gi|328803397|gb|AEB48596.1| RNA methyltransferase, TrmH family, group 3 [Aeromonas veronii
           B565]
          Length = 249

 Score =  132 bits (332), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 70/246 (28%), Positives = 113/246 (45%), Gaps = 14/246 (5%)

Query: 48  NLFLYGVHTVSAALNNPSRKIFQLLATKNALA-RLDWDANLPH--PFPVKTVPPQTIDKI 104
              +YG+H V+A L     +  ++ A K     RL             V++V  +T+D  
Sbjct: 3   TELIYGIHAVTALLERTPERFIEVWALKGRDDDRLQPLLTELESLGLKVQSVNRKTLDDK 62

Query: 105 VGKEAVHQGLALETAPLLS----------PTLDAVRNSQLLMVLDHVNDPHNIGAILRSA 154
             +   HQG+                     L A ++   L+VLD V DPHN+GA LRSA
Sbjct: 63  A-EGNNHQGIMARVKEAPKLAEHDLASLLDELAAQQSQPFLLVLDGVTDPHNLGACLRSA 121

Query: 155 VAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSS 214
            A     +I  +  +   + ++ K A GA E +P I+++NL   L+++   G   +G + 
Sbjct: 122 DAAGAHAVIVPRDKATGLTPIVRKVACGAAEVVPLIQVTNLARTLRELQERGVWIVGTAG 181

Query: 215 DSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALY 274
           ++   L Q      +AL++GAEGKG+R  T+E    +  + M G + +LNVS A  V L+
Sbjct: 182 EADHDLYQAKLTGPMALVMGAEGKGMRRLTREHCDELVSIPMAGAVSSLNVSVATGVCLF 241

Query: 275 ITQNHF 280
                 
Sbjct: 242 EAVRQR 247


>gi|313635070|gb|EFS01420.1| RNA methyltransferase, TrmH family, group 3 [Listeria seeligeri FSL
           N1-067]
          Length = 251

 Score =  132 bits (332), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 63/248 (25%), Positives = 116/248 (46%), Gaps = 13/248 (5%)

Query: 43  TSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWD---ANLPHPFPVKTVPPQ 99
             + E  ++ G + V   L +  R I ++   +     +              V+ VP Q
Sbjct: 2   EQENEQEWIGGRNPVLEVLRSD-RDIHKIYVQEGTQKGVLKQVLTLAKERKVQVQFVPKQ 60

Query: 100 TIDKIVGKEAVHQGLALETAPLLSPTLDA-------VRNSQLLMVLDHVNDPHNIGAILR 152
            I+K+V    VHQG+A + A      LD               ++LD + DPHN+G+I+R
Sbjct: 61  KIEKVVS--GVHQGVAAQVAAYQYAELDDLFNAAEAKGEMPFFIILDELEDPHNLGSIMR 118

Query: 153 SAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGL 212
           +A +    GII  KR +   +  +AK+++GA+E++P +R++N+   ++++   G    G 
Sbjct: 119 TADSVGAHGIIIPKRRAVGLTQTVAKASTGAMEYVPVVRVTNMVRTMEELQKRGLWIFGT 178

Query: 213 SSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVA 272
            +           +  +A+++G+EG G+    +E    + HL M G + +LN S AA++ 
Sbjct: 179 DAKGSSDYRTMDVDMPLAIVIGSEGFGMSRLVREKCDFLVHLPMRGKVTSLNASVAASLL 238

Query: 273 LYITQNHF 280
           LY      
Sbjct: 239 LYEVYRKR 246


>gi|293604389|ref|ZP_06686796.1| 23S rRNA (guanosine-2'-O-)-methyltransferase RlmB [Achromobacter
           piechaudii ATCC 43553]
 gi|292817266|gb|EFF76340.1| 23S rRNA (guanosine-2'-O-)-methyltransferase RlmB [Achromobacter
           piechaudii ATCC 43553]
          Length = 245

 Score =  132 bits (332), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 62/238 (26%), Positives = 110/238 (46%), Gaps = 7/238 (2%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLA---TKNALARLDWDANLPHPFPVKTVPPQTIDKIVG 106
            L G H V A L +    I ++      ++   +   +        V  VP + +D +  
Sbjct: 6   VLAGFHAVVARLRHAPESIKEIYVEASRRDKRMQTFIEQAEKAGRRVHPVPMERLDGLSR 65

Query: 107 KEAVHQG----LALETAPLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGI 162
                         + A  +   LD +    LL++LD V DPHN+GA LR+A A     +
Sbjct: 66  GTRHQGVVALADERQLAVDVDEVLDVIEGPPLLLILDGVTDPHNLGACLRTADAAGVHAV 125

Query: 163 ITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQ 222
           I  +  +   +A + + A GA + +PY+ ++NL   ++ +   G   +G    +   + +
Sbjct: 126 IAPRDRAVGLNATVQRVACGAADTVPYLMVTNLARTMRGLKDRGVWLVGTDDQATDSMHK 185

Query: 223 EIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
                 +A ++GAEG+G+R  T+ET   + ++ M G +++LNVS A+AV LY T    
Sbjct: 186 IDARQPMAWVMGAEGEGMRRLTRETCDQLVNIPMLGSVESLNVSVASAVCLYETVRQR 243


>gi|290956646|ref|YP_003487828.1| rRNA methyltransferase [Streptomyces scabiei 87.22]
 gi|260646172|emb|CBG69265.1| putative rRNA methyltransferase [Streptomyces scabiei 87.22]
          Length = 276

 Score =  132 bits (332), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 49/267 (18%), Positives = 96/267 (35%), Gaps = 6/267 (2%)

Query: 20  YAKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALA 79
             ++   +  ++++Q+         + +   + GV  ++ A+ +       L      L+
Sbjct: 3   VQRISTRNARFQQLQTLLNNRTKRGRAKEFLVQGVRPITMAVEHGWTVRSLLYDASRPLS 62

Query: 80  RLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSP-TLDAVRNSQLLMVL 138
           R   D           + PQ + ++  K      +           +   VR+  L +V 
Sbjct: 63  RWAEDLLRGVGAERVAMEPQLLAELSEKADGAAEVLAVVEMAPDSLSRIKVRDDFLGLVF 122

Query: 139 DHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALE-----HIPYIRIS 193
           D    P NIG+I+RSA AF   G+I T   +        ++++G+               
Sbjct: 123 DRPTQPGNIGSIVRSADAFGASGLIVTGHAADPYDPKSVRASTGSFFAVPVVRSQSHHEV 182

Query: 194 NLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAH 253
                 ++        +G   D    + +      + L++G E  GL    +E    +  
Sbjct: 183 MEWLEKERAQGRPVAVVGTDEDGDAEVSEFDLTQPVLLLIGNETAGLSSAWRELCDQVIS 242

Query: 254 LHMPGIIKALNVSNAAAVALYITQNHF 280
           + M G   +LN SNAA+V LY  +   
Sbjct: 243 IPMTGSASSLNASNAASVVLYEARRQR 269


>gi|330807239|ref|YP_004351701.1| 23S rRNA (guanosine-2-o-)-methyltransferase [Pseudomonas
           brassicacearum subsp. brassicacearum NFM421]
 gi|327375347|gb|AEA66697.1| Putative 23S rRNA (guanosine-2-o-)-methyltransferase [Pseudomonas
           brassicacearum subsp. brassicacearum NFM421]
          Length = 252

 Score =  132 bits (332), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 72/241 (29%), Positives = 115/241 (47%), Gaps = 12/241 (4%)

Query: 51  LYGVHTVSAALNNPSRKIFQLLATKNA---LARLDWDANLPHPFPVKTVPPQTIDKIVGK 107
           +YGVH V A L +  +++ Q+   +       +   +    +   +     + +D  V  
Sbjct: 6   IYGVHAVEALLRHHPKRVKQVWLAEGRSEPRVQALVELATQNKVAIGQAERREMDVWV-- 63

Query: 108 EAVHQGLALETAPLLSP-------TLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCD 160
           E VHQG+  + +P            LD    + LL+VLD V DPHN+GA LRSA A    
Sbjct: 64  EGVHQGVVADVSPSQVWGEAMLDELLDRTEGAPLLLVLDGVTDPHNLGACLRSADAAGAL 123

Query: 161 GIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPL 220
            +I  K  S + +  + K A GA E IP + ++NL   L+K+   G   +G + +++  +
Sbjct: 124 AVIVPKDKSATLTPAVRKVACGAAEVIPLVAVTNLARTLEKLQQRGLWVVGTAGEAEVSI 183

Query: 221 EQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
             +       LI+GAEGKG+R  T+E    +  L M G + +LNVS A  V L+      
Sbjct: 184 YDQDLTGPTILIMGAEGKGMRRLTREHCDYLVKLPMAGSVSSLNVSVATGVCLFEALRQR 243

Query: 281 A 281
           +
Sbjct: 244 S 244


>gi|313124170|ref|YP_004034429.1| tRNA/rRNA methyltransferase [Lactobacillus delbrueckii subsp.
           bulgaricus ND02]
 gi|312280733|gb|ADQ61452.1| TRNA/rRNA methyltransferase [Lactobacillus delbrueckii subsp.
           bulgaricus ND02]
          Length = 254

 Score =  132 bits (332), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 53/256 (20%), Positives = 96/256 (37%), Gaps = 5/256 (1%)

Query: 21  AKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALAR 80
            +   N+   K +    QK ++  +     + G H V  AL   S K  ++LAT+ AL+R
Sbjct: 3   ERTSVNNPQIKAIGKLQQK-KYREESGYYLIEGFHLVEEALKA-SVKYREILATEAALSR 60

Query: 81  LDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDH 140
           L           +  +           +                   +     LL   D 
Sbjct: 61  LAQLGLAYDEGKLIKISQSVASHFSSTKNSQDIFMTVKINQSEHFFFSYGKWVLL---DD 117

Query: 141 VNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQ 200
           + DP N+G I+R+A A   DG+I + +     +  + +S  G+  H+  I+         
Sbjct: 118 LADPGNVGTIIRTADAAGFDGVILSNKTVDLYNPKVQRSMQGSQFHLNLIKADLPDAIAS 177

Query: 201 KMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGII 260
              +       L   + K L       ++ALI+G E  G+ P+    A    ++ + G  
Sbjct: 178 LKAADIPVYASLLDPAAKQLGDFAPVAQVALIIGNEAHGVSPEIAALADEKLYIPIKGRA 237

Query: 261 KALNVSNAAAVALYIT 276
           ++LN + AA + +Y  
Sbjct: 238 ESLNAAVAAGIMIYHF 253


>gi|240146531|ref|ZP_04745132.1| RNA methyltransferase, TrmH family, group 3 [Roseburia intestinalis
           L1-82]
 gi|257201342|gb|EEU99626.1| RNA methyltransferase, TrmH family, group 3 [Roseburia intestinalis
           L1-82]
 gi|291535116|emb|CBL08228.1| rRNA methylase, putative, group 3 [Roseburia intestinalis M50/1]
          Length = 246

 Score =  132 bits (332), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 58/240 (24%), Positives = 108/240 (45%), Gaps = 9/240 (3%)

Query: 51  LYGVHTVSAALNNPSR--KIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKE 108
           + G + V  A  +     K+F L   ++   R        H   V  V  + +D++   +
Sbjct: 8   IEGRNAVLEAFRSGKTIDKLFVLDGCQDGPVRTIVREAKKHDTIVHFVEKERLDQLSETK 67

Query: 109 AVHQGLALETAPLLSPTLDAVR------NSQLLMVLDHVNDPHNIGAILRSAVAFSCDGI 162
                +A+  A   +   D ++          L +LD++ DPHN+GAI+R+A      G+
Sbjct: 68  KHQGVIAVAAAYEYAEVEDMLKLAEEKGEPPFLFILDNIEDPHNLGAIIRTANLAGAHGV 127

Query: 163 ITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQ 222
           I  KR +   +A +AK+++GA+ + P  +++NLT  ++++   G   +         +  
Sbjct: 128 IIPKRRAVGLTATVAKTSAGAINYTPVAKVTNLTATMKELKDKGMWFVCA-DMDGTCMYD 186

Query: 223 EIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHFAK 282
                 I L++G+EG+G+    +E    +A + M G I +LN S AA V  Y       +
Sbjct: 187 LDLKGPIGLVIGSEGEGVGRLVRENCDFVASIPMKGDIDSLNASVAAGVLAYEIVRQRMR 246


>gi|225866536|ref|YP_002751914.1| RNA methyltransferase, TrmH family [Bacillus cereus 03BB102]
 gi|225786909|gb|ACO27126.1| RNA methyltransferase, TrmH family [Bacillus cereus 03BB102]
          Length = 254

 Score =  132 bits (332), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 49/277 (17%), Positives = 100/277 (36%), Gaps = 29/277 (10%)

Query: 1   MNLISKKKSEKIFSLKDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAA 60
           M  I   ++ ++   K                        +   +    F+ G H V  A
Sbjct: 1   MKNIDSIQNPRVKQWKKLQTK-------------------KERDKKGLFFVEGFHLVEEA 41

Query: 61  LNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAP 120
           L      + +L+ +       DW  N      +  VP   +  +   E      A+    
Sbjct: 42  LKAG--VVTELIVSDQTDLPKDWTVN---DVEMYIVPEAIVKVLRETETTQGVFAVCEKH 96

Query: 121 LLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSA 180
                L   +     ++LD + DP N+G I+R+A A     ++  +    + ++ + +S 
Sbjct: 97  EKEVALTDGK----FLLLDGLQDPGNLGTIIRTADAAGIHAVVLGEGCVDAYNSKVLRST 152

Query: 181 SGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGL 240
            G++ H+P ++ +      +   +          ++  P  +       ALI+G EG G+
Sbjct: 153 QGSIFHLPIVKGNLEEWVDKLKENNVPVYGTA-LENGVPYGEVTPTGSFALIVGNEGNGV 211

Query: 241 RPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQ 277
           R +         ++ + G  ++LNV+ AA +  Y  Q
Sbjct: 212 RQEILAKTDQNLYIPIYGGAESLNVAVAAGILTYYLQ 248


>gi|196044916|ref|ZP_03112150.1| RNA methyltransferase, TrmH family [Bacillus cereus 03BB108]
 gi|229186815|ref|ZP_04313970.1| RNA methyltransferase, TrmH [Bacillus cereus BGSC 6E1]
 gi|196024404|gb|EDX63077.1| RNA methyltransferase, TrmH family [Bacillus cereus 03BB108]
 gi|228596552|gb|EEK54217.1| RNA methyltransferase, TrmH [Bacillus cereus BGSC 6E1]
          Length = 265

 Score =  132 bits (332), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 49/277 (17%), Positives = 100/277 (36%), Gaps = 29/277 (10%)

Query: 1   MNLISKKKSEKIFSLKDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAA 60
           M  I   ++ ++   K                        +   +    F+ G H V  A
Sbjct: 12  MKNIDSIQNPRVKQWKKLQTK-------------------KERDKKGLFFVEGFHLVEEA 52

Query: 61  LNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAP 120
           L      + +L+ +       DW  N      +  VP   +  +   E      A+    
Sbjct: 53  LKAG--VVTELIVSDQTDLPKDWTVN---DVEMYIVPEAIVKVLRETETTQGVFAVCEKH 107

Query: 121 LLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSA 180
                L   +     ++LD + DP N+G I+R+A A     ++  +    + ++ + +S 
Sbjct: 108 EKEVALTDGK----FLLLDGLQDPGNLGTIIRTADAAGIHAVVLGEGCVDAYNSKVLRST 163

Query: 181 SGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGL 240
            G++ H+P ++ +      +   +          ++  P  +       ALI+G EG G+
Sbjct: 164 QGSIFHLPIVKGNLEEWVDKLKENNVPVYGTA-LENGVPYGEVTPTGSFALIVGNEGNGV 222

Query: 241 RPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQ 277
           R +         ++ + G  ++LNV+ AA +  Y  Q
Sbjct: 223 RQEILAKTDQNLYIPIYGGAESLNVAVAAGILTYYLQ 259


>gi|210623156|ref|ZP_03293610.1| hypothetical protein CLOHIR_01560 [Clostridium hiranonis DSM 13275]
 gi|210153789|gb|EEA84795.1| hypothetical protein CLOHIR_01560 [Clostridium hiranonis DSM 13275]
          Length = 244

 Score =  132 bits (332), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 48/241 (19%), Positives = 104/241 (43%), Gaps = 11/241 (4%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLAT--KNALARLDWDANLPHPFPVKTVPPQTIDKIVGK 107
            + G + V  A+ N       L++   K    +            ++ V    +D++   
Sbjct: 3   IIEGRNPVIEAIKNDRHIEKLLISNSSKEGSIKKIIAMAKEKKIVIQYVDRHKLDEMSTS 62

Query: 108 EAVHQGLALETAPLLSPTLDA-------VRNSQLLMVLDHVNDPHNIGAILRSAVAFSCD 160
            A HQG+    +  +   ++              +++LD + DPHN+G+I+R+A A    
Sbjct: 63  HA-HQGVIATISDYIYKDIEEVVREVKEKGEDPFIIILDEITDPHNLGSIIRTADAVGAH 121

Query: 161 GIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPL 220
            ++  KR S   + V+AK+++GA+E++P  +++N+ + ++ +   G              
Sbjct: 122 AVVIPKRRSVDITPVVAKASAGAVEYVPVCKVTNIVNTIKMLKEEGLWIAAA-DMDGGVF 180

Query: 221 EQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
            ++     + L++G+EG G+    ++    +  + M G + +LN S A  + LY      
Sbjct: 181 YKQDLTGPLGLVVGSEGFGISRLVKQNCDFVVSMPMVGNVTSLNASVAGGILLYEVFRQR 240

Query: 281 A 281
            
Sbjct: 241 T 241


>gi|149196456|ref|ZP_01873511.1| putative rRNA methylase [Lentisphaera araneosa HTCC2155]
 gi|149140717|gb|EDM29115.1| putative rRNA methylase [Lentisphaera araneosa HTCC2155]
          Length = 265

 Score =  132 bits (332), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 46/259 (17%), Positives = 88/259 (33%), Gaps = 6/259 (2%)

Query: 26  NHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRK----IFQLLATKNALARL 81
           ++   K +    ++ R+  + + + + G  ++  A +N        I +          L
Sbjct: 7   SNPRIKHIVKLRER-RYRDKEQTMIIEGFRSIYRAADNGVYPKELYICRDFFLGKNEDEL 65

Query: 82  DWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDHV 141
                      +         KI  ++     LAL            + +  LL+V   +
Sbjct: 66  IQKLQDEGGTQIFETEQNVFKKISYRDRPEGLLALTGYFRKQVDDLELSDPPLLVVAQSI 125

Query: 142 NDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQK 201
             P N+G I+RSA     DG+I               +AS  +     I  +   D +  
Sbjct: 126 EKPGNLGTIIRSADGTGADGLILC-DKCTDLFNPNVITASTGMCFSLPIAEAASQDTINY 184

Query: 202 MHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIK 261
           +       +  +  + K          IA+I+GAE  GL  +  + ++    + M G   
Sbjct: 185 LKENNITILSATPHADKLYTDVDMTGPIAVIVGAEQYGLSEEWMKQSSINVKIPMLGKAD 244

Query: 262 ALNVSNAAAVALYITQNHF 280
           +LNV+ A  + LY      
Sbjct: 245 SLNVATATTLLLYEAVRQR 263


>gi|71735318|ref|YP_272875.1| RNA methyltransferase [Pseudomonas syringae pv. phaseolicola 1448A]
 gi|289624605|ref|ZP_06457559.1| RNA methyltransferase [Pseudomonas syringae pv. aesculi str.
           NCPPB3681]
 gi|71555871|gb|AAZ35082.1| RNA methyltransferase, TrmH family, group 3 [Pseudomonas syringae
           pv. phaseolicola 1448A]
 gi|320321875|gb|EFW77971.1| RNA methyltransferase [Pseudomonas syringae pv. glycinea str. B076]
 gi|320331020|gb|EFW86994.1| RNA methyltransferase [Pseudomonas syringae pv. glycinea str. race
           4]
 gi|330865903|gb|EGH00612.1| RNA methyltransferase [Pseudomonas syringae pv. aesculi str.
           0893_23]
 gi|330984552|gb|EGH82655.1| RNA methyltransferase [Pseudomonas syringae pv. lachrymans str.
           M301315]
          Length = 253

 Score =  132 bits (332), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 73/239 (30%), Positives = 113/239 (47%), Gaps = 8/239 (3%)

Query: 51  LYGVHTVSAALNNPSRKIFQLLATKNA-LARLDWDANLPHPFPVKTVPPQTIDKIVGKEA 109
           +YGVH V A L +  +++  +   +     R+     L     V     +  +     E 
Sbjct: 7   IYGVHAVEALLRHHPKRVKHIWLAEGRNDPRVQTLVALAGENRVTIGQAERREMDAWVEG 66

Query: 110 VHQGLALETAPLLSP-------TLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGI 162
           VHQG+  + +P            LD    S LL+VLD V DPHN+GA LR+A A     +
Sbjct: 67  VHQGVVADVSPSQVWGEAMLDELLDRSEGSPLLLVLDGVTDPHNLGACLRTADAAGALAV 126

Query: 163 ITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQ 222
           I  K  S + +  + K A GA E IP + ++NL   L+K+   G   +G + +++  L Q
Sbjct: 127 IVPKDKSATLTPAVRKVACGAAEVIPLVAVTNLARTLEKLQQRGLWVVGTAGEAEVELYQ 186

Query: 223 EIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHFA 281
           +       +I+GAEGKG+R  T+E    +  L M G + +LNVS A  V L+      +
Sbjct: 187 QDLTGPTIIIMGAEGKGMRRLTREHCDYLVRLPMAGSVSSLNVSVATGVCLFEALRQRS 245


>gi|39936427|ref|NP_948703.1| RNA methyltransferase TrmH group 3 [Rhodopseudomonas palustris
           CGA009]
 gi|192292212|ref|YP_001992817.1| RNA methyltransferase, TrmH family, group 3 [Rhodopseudomonas
           palustris TIE-1]
 gi|39650282|emb|CAE28805.1| putative rRNA methylase [Rhodopseudomonas palustris CGA009]
 gi|192285961|gb|ACF02342.1| RNA methyltransferase, TrmH family, group 3 [Rhodopseudomonas
           palustris TIE-1]
          Length = 275

 Score =  132 bits (332), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 114/258 (44%), Positives = 158/258 (61%), Gaps = 1/258 (0%)

Query: 17  DSHYAKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKN 76
           +  +++     R   +   F +  R       + LYG HTV+AAL NP RK  +L  T+N
Sbjct: 7   NPRFSRRDGPPRGKPRPAGFRRDPRERDGDGPVILYGWHTVTAALANPQRKFRKLWLTEN 66

Query: 77  ALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLM 136
           A  RL  + N+      + V P  ID+ +G +AVHQG+  E  PL  P +D +    +++
Sbjct: 67  AARRLAEE-NIDTRIAPEIVRPSEIDRQLGPDAVHQGMLAEADPLQGPRIDTLPQHGIVL 125

Query: 137 VLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLT 196
           VLD + DPHN+GAILRSA AF+   I+TT R+SP  + VLAKSASGALE +P + + NL 
Sbjct: 126 VLDQITDPHNVGAILRSAAAFAVQAIVTTARHSPEATGVLAKSASGALELVPLVLVQNLA 185

Query: 197 DALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHM 256
            AL +++  GF T+GL S+    L        +AL+LGAEGKGLR  T++T  ++A L M
Sbjct: 186 RALTELNDRGFLTVGLDSEGDDDLAAVELRQPLALVLGAEGKGLRQLTRQTCNTVARLDM 245

Query: 257 PGIIKALNVSNAAAVALY 274
           PG IK+LNVSNAAA+ALY
Sbjct: 246 PGEIKSLNVSNAAALALY 263


>gi|319901728|ref|YP_004161456.1| RNA methyltransferase, TrmH family, group 3 [Bacteroides helcogenes
           P 36-108]
 gi|319416759|gb|ADV43870.1| RNA methyltransferase, TrmH family, group 3 [Bacteroides helcogenes
           P 36-108]
          Length = 246

 Score =  132 bits (332), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 60/245 (24%), Positives = 105/245 (42%), Gaps = 13/245 (5%)

Query: 47  ENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPHP---FPVKTVPPQTIDK 103
           ++  ++GV  V  A+      I ++L  K+  + L  +          PV+ VP + I++
Sbjct: 4   KSEMIFGVRAVIEAIQAGKE-IDKILVKKDIQSDLSKELFAALKGTLIPVQRVPVERINR 62

Query: 104 IVGKEAVHQGLALETAPLLSP-------TLDAVRNSQLLMVLDHVNDPHNIGAILRSAVA 156
           +      HQG+    + +           L     + L ++LD + D  N GAI R+   
Sbjct: 63  MT--RKNHQGVIAFVSAVTYQKTEDLTPFLFEQGKNPLFVMLDGITDVRNFGAIARTCEC 120

Query: 157 FSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDS 216
            + D +I   + S S +A   K+++GAL  +P  R  NL + LQ + + GF  +  +   
Sbjct: 121 AAVDAVIIPAKNSVSVNADAVKTSAGALHTLPVCREQNLKETLQFLKNSGFHIVAATEKG 180

Query: 217 KKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYIT 276
                +      + +I+GAE KG+             + M G I++LNVS AA V +Y  
Sbjct: 181 DYDYTKADYTGPMCIIMGAEDKGVSYDNLALCDEWVKIPMLGTIESLNVSVAAGVLIYEA 240

Query: 277 QNHFA 281
                
Sbjct: 241 VKQRN 245


>gi|148984799|ref|ZP_01818052.1| TrmH family RNA methyltransferase group 3 [Streptococcus pneumoniae
           SP3-BS71]
 gi|148990265|ref|ZP_01821476.1| TrmH family RNA methyltransferase group 3 [Streptococcus pneumoniae
           SP6-BS73]
 gi|168486152|ref|ZP_02710660.1| RNA methyltransferase, TrmH family, group 3 [Streptococcus
           pneumoniae CDC1087-00]
 gi|225860774|ref|YP_002742283.1| RNA methyltransferase, TrmH family, group 3 [Streptococcus
           pneumoniae Taiwan19F-14]
 gi|298230952|ref|ZP_06964633.1| RNA methyltransferase, TrmH family, group 3 [Streptococcus
           pneumoniae str. Canada MDR_19F]
 gi|298254976|ref|ZP_06978562.1| RNA methyltransferase, TrmH family, group 3 [Streptococcus
           pneumoniae str. Canada MDR_19A]
 gi|298502589|ref|YP_003724529.1| TrmH family tRNA/rRNA methyltransferase [Streptococcus pneumoniae
           TCH8431/19A]
 gi|147922821|gb|EDK73937.1| TrmH family RNA methyltransferase group 3 [Streptococcus pneumoniae
           SP3-BS71]
 gi|147924404|gb|EDK75494.1| TrmH family RNA methyltransferase group 3 [Streptococcus pneumoniae
           SP6-BS73]
 gi|183570789|gb|EDT91317.1| RNA methyltransferase, TrmH family, group 3 [Streptococcus
           pneumoniae CDC1087-00]
 gi|225727049|gb|ACO22900.1| RNA methyltransferase, TrmH family, group 3 [Streptococcus
           pneumoniae Taiwan19F-14]
 gi|298238184|gb|ADI69315.1| TrmH family tRNA/rRNA methyltransferase [Streptococcus pneumoniae
           TCH8431/19A]
 gi|301800307|emb|CBW32933.1| SpoU rRNA methylase family protein [Streptococcus pneumoniae
           OXC141]
 gi|327389642|gb|EGE87987.1| RNA 2'-O ribose methyltransferase substrate binding family protein
           [Streptococcus pneumoniae GA04375]
 gi|332073794|gb|EGI84272.1| RNA 2'-O ribose methyltransferase substrate binding family protein
           [Streptococcus pneumoniae GA41301]
          Length = 242

 Score =  132 bits (332), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 75/240 (31%), Positives = 121/240 (50%), Gaps = 9/240 (3%)

Query: 48  NLFLYGVHTVSAAL-NNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVG 106
           N  +YGVH V+ AL  N   K++     +        +        +     +++ +I  
Sbjct: 4   NDIVYGVHAVTEALLANTGNKLYLQEDLRGKNVEKVKELATEKKVSISWTSKKSLSEIT- 62

Query: 107 KEAVHQGLALETAPLLSPTLDA------VRNSQLLMVLDHVNDPHNIGAILRSAVAFSCD 160
           + AVHQG  L  +      LD          + LL++LD + DPHN+G+ILR+A A +  
Sbjct: 63  EGAVHQGFVLRVSEFAYSELDYILAKTRQEENPLLLILDGLTDPHNLGSILRTADATNVS 122

Query: 161 GIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPL 220
           G+I  K  +   + V+AK+A+GA+EH+P  R++NL+  L K+   GF T G   +     
Sbjct: 123 GVIIPKHRAVGVTPVVAKTATGAIEHVPIARVTNLSQTLDKLKDEGFWTFGTDMNGTPCH 182

Query: 221 EQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
           +   K  KIALI+G EGKG+    ++    M  + M G +++LN S AAA+ +Y    + 
Sbjct: 183 KWNTK-GKIALIIGNEGKGISSNIKKQVDEMITIPMNGHVQSLNASVAAAILMYEVFRNR 241


>gi|56421244|ref|YP_148562.1| rRNA methylase [Geobacillus kaustophilus HTA426]
 gi|56381086|dbj|BAD76994.1| rRNA methylase [Geobacillus kaustophilus HTA426]
          Length = 251

 Score =  132 bits (332), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 56/277 (20%), Positives = 107/277 (38%), Gaps = 29/277 (10%)

Query: 1   MNLISKKKSEKIFSLKDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAA 60
           M  I   K+ ++   K                        +   +     L G H V  A
Sbjct: 1   MKRIESPKNARVKQWKKLLTK-------------------KGRDETGLFLLEGFHLVEEA 41

Query: 61  LNNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAP 120
           + + +  + +L+  +       W+       PV  V    +  I   E      A     
Sbjct: 42  IKSNA-PLVELIVDERTAVPPGWNV---TGVPVTIVTEAVMRAISSTETPQGIAA--VCR 95

Query: 121 LLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSA 180
            LS  L+ V+ + L+   D V DP N+G ++R+A +   D +I  +  +   +  + ++ 
Sbjct: 96  QLSTELEGVKTALLI---DAVQDPGNLGTMIRTADSAGIDAVILGEGCADLYNPKVVRAT 152

Query: 181 SGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGL 240
            G+L H+P ++       + +    G    G + ++        ++   AL++G EG G+
Sbjct: 153 QGSLFHLPVVKGDLA-QWIARFKEQGIPVYGTALENAVDYRTVPQSSSFALLVGNEGSGV 211

Query: 241 RPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQ 277
           RP      T   ++ + G  ++LNV+ AA + LY  Q
Sbjct: 212 RPDLLRLTTENVYIPIYGRAESLNVAVAAGILLYSLQ 248


>gi|120600217|ref|YP_964791.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Shewanella sp.
           W3-18-1]
 gi|146291855|ref|YP_001182279.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Shewanella
           putrefaciens CN-32]
 gi|120560310|gb|ABM26237.1| RNA methyltransferase, TrmH family, group 3 [Shewanella sp.
           W3-18-1]
 gi|145563545|gb|ABP74480.1| RNA methyltransferase, TrmH family, group 3 [Shewanella
           putrefaciens CN-32]
          Length = 246

 Score =  132 bits (332), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 65/244 (26%), Positives = 110/244 (45%), Gaps = 10/244 (4%)

Query: 46  PENLFLYGVHTVSAALNNPSRKIFQLLATKNALAR---LDWDANLPHPFPVKTVPPQTID 102
            +   ++G+H V A L +   +I +L   +        +  D        ++    + +D
Sbjct: 2   KKQDIIFGIHAVEALLKHSPERIIELWLLQGRDDERLTVLADQAKAFGTTIQVASRKALD 61

Query: 103 KIVGKEAVHQGLALET------APLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVA 156
               + + HQG+                 L A      L++LD V DPHN+GA LR+A A
Sbjct: 62  DKA-ESSQHQGIVARVKAAKVLNEQDLDVLLANTEQPFLLILDGVTDPHNLGACLRNADA 120

Query: 157 FSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDS 216
               GII  K  S   +A ++K A GA E +P  +++NL   ++ +   G   +G + ++
Sbjct: 121 AGVQGIIVPKDNSVGLTATVSKVACGAAETVPLFQVTNLARTMRHLQDKGVWIVGTAGEA 180

Query: 217 KKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYIT 276
              L Q      +A+ +GAE KGLR  ++E+  S+  + M G + +LNVS A  V L+  
Sbjct: 181 DCELYQADLKGPLAIAMGAEDKGLRRLSRESCDSLISIPMAGSVSSLNVSVATGVCLFEA 240

Query: 277 QNHF 280
               
Sbjct: 241 VRQR 244


>gi|300361215|ref|ZP_07057392.1| TrmH family RNA methyltransferase [Lactobacillus gasseri JV-V03]
 gi|300353834|gb|EFJ69705.1| TrmH family RNA methyltransferase [Lactobacillus gasseri JV-V03]
          Length = 253

 Score =  132 bits (332), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 54/251 (21%), Positives = 105/251 (41%), Gaps = 6/251 (2%)

Query: 26  NHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDA 85
           N+   K ++   QK ++  + +   + G H V  AL N    ++ +L T  AL +L    
Sbjct: 8   NNPTIKSLRKLEQK-KYRKKTQTYLIEGFHLVEEALKNHENYLY-ILGTSAALVKLTAHY 65

Query: 86  NLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDHVNDPH 145
            L     ++            K +    + L      S + +  +     +VLD++ DP 
Sbjct: 66  KLKDDKVIQITDAIAEHLSSTKNSQDIFMVLPINQPKSFSFEYGKW----VVLDNLTDPG 121

Query: 146 NIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSW 205
           N+G I+R+A A   DG++ ++      +  + +S  G+  HI  ++   L        + 
Sbjct: 122 NVGTIIRTADAAGFDGVVLSEESVDLYNPKVQRSMQGSQFHIQIVQNPILAAISSFKENG 181

Query: 206 GFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNV 265
               + +   + K L   I   ++AL++G E  G      ETA    ++ + G  ++LN 
Sbjct: 182 IPVYVSILDKTAKSLNNCISVPQLALVIGNEAHGASKDVIETADKKIYIPIKGKAESLNA 241

Query: 266 SNAAAVALYIT 276
           + AA + +Y  
Sbjct: 242 AVAAGIMIYHF 252


>gi|108761000|ref|YP_631271.1| RNA methyltransferase [Myxococcus xanthus DK 1622]
 gi|108464880|gb|ABF90065.1| RNA methyltransferase, TrmH family, group 3 [Myxococcus xanthus DK
           1622]
          Length = 282

 Score =  132 bits (332), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 66/242 (27%), Positives = 115/242 (47%), Gaps = 12/242 (4%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDANLPH----PFPVKTVPPQTIDKIV 105
           F+YGV+ V AAL     ++ +L   +  L        L         V+ V  + +  + 
Sbjct: 36  FVYGVNPVLAALRARPDEVERLFLVEGQLGARAAGELLSRAREFGIRVEKVTRERLGTLA 95

Query: 106 GKEAVHQGLALETAPLLSPTLDAV-------RNSQLLMVLDHVNDPHNIGAILRSAVAFS 158
            +  VHQG+ +E        L+ +           L++VLD + DPHN+GAI+RSA A  
Sbjct: 96  -EGGVHQGVVVELRGFKYAELEDLLEAAKALGQPPLVVVLDGIQDPHNLGAIIRSADALG 154

Query: 159 CDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKK 218
             G++  K  +   +  +AK+++GA+EH    R+ N++ AL+++   G        D+K+
Sbjct: 155 AHGVVIAKDRAVQVTGTVAKASAGAVEHSRIARVVNISRALEELKEAGLWVAAADVDAKE 214

Query: 219 PLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQN 278
           P+     +  +AL++GAEG G+R    +       + M G + +LN S +A + LY    
Sbjct: 215 PMWSARLDGPLALVVGAEGAGVRDGVLKHCDFRLRIPMAGQVGSLNASVSAGILLYEVAR 274

Query: 279 HF 280
             
Sbjct: 275 QR 276


>gi|319943471|ref|ZP_08017753.1| 23S rRNA (guanosine-2'-O-)-methyltransferase RlmB [Lautropia
           mirabilis ATCC 51599]
 gi|319743286|gb|EFV95691.1| 23S rRNA (guanosine-2'-O-)-methyltransferase RlmB [Lautropia
           mirabilis ATCC 51599]
          Length = 247

 Score =  132 bits (332), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 68/242 (28%), Positives = 105/242 (43%), Gaps = 12/242 (4%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLA---TKNALARLDWDANLPHPFPVKTVPPQTIDKIVG 106
            LYG H V A L         L       +   R            V  V    +D++ G
Sbjct: 2   LLYGFHAVMARLRQAPASFKSLYVDRHRDDNRVRDLLKLAQQQAVQVTRVEAGRLDRMAG 61

Query: 107 KEAVHQGLALETAPLLSP--------TLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFS 158
               HQG+  +                L+       L++LD V DP N+GA LRSA    
Sbjct: 62  -GKRHQGVVAQVETQTISTDLPTLLSDLEGRERPPFLLLLDGVTDPRNLGACLRSADGAG 120

Query: 159 CDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKK 218
            D +I  K ++   + V   +ASGA E +PYI ++NL   ++++   GF+  GL+ ++  
Sbjct: 121 VDAVIAPKDHAAPLTDVAMHTASGAGESVPYILVTNLVRTVEQLQDAGFRVYGLADEADA 180

Query: 219 PLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQN 278
            L +      +A+++GAE KGLR   +E   ++  + M G + +LNVS A  V LY    
Sbjct: 181 DLYRTDFAGPVAIVMGAEDKGLRRLVREQCDALVSIPMMGSVSSLNVSVATGVVLYEVLR 240

Query: 279 HF 280
             
Sbjct: 241 QR 242


>gi|152981297|ref|YP_001353804.1| RNA methyltransferase [Janthinobacterium sp. Marseille]
 gi|151281374|gb|ABR89784.1| RNA methyltransferase, TrmH family [Janthinobacterium sp.
           Marseille]
          Length = 247

 Score =  132 bits (332), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 70/238 (29%), Positives = 114/238 (47%), Gaps = 7/238 (2%)

Query: 51  LYGVHTVSAALNNPSRKIFQLLA---TKNALARLDWDANLPHPFPVKTVPPQTIDKIVGK 107
           ++G H V+A L + +  + ++       +   +    A       +       +  IVG 
Sbjct: 6   IFGFHAVTARLRHEASSVEEIYIDAGRHDQRMKDLIRAAEGAKVRIIPADDARLSSIVGT 65

Query: 108 EAVHQGLAL----ETAPLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGII 163
                 +A       A  L   LDA+    LL+VLD + DPHN+GA LR A       +I
Sbjct: 66  RRHQGVVAKAGELSLARNLDELLDAIEGPPLLLVLDGITDPHNLGACLRVADGAGAHAVI 125

Query: 164 TTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQE 223
             K  +   +A  AK ASGA + +PYI ++NL   L+++       IG + DS+K L + 
Sbjct: 126 APKDRAVGLNATAAKVASGAADTVPYITVTNLARTLRELKERDIMLIGTTDDSEKGLYEA 185

Query: 224 IKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHFA 281
             +   AL++G+EG+G+R  T+ET   +  + M G +++LNVS A+ V LY  +    
Sbjct: 186 DFSGPAALVMGSEGEGMRRLTRETCDVLVGIPMFGSVESLNVSVASGVCLYEARRQRI 243


>gi|16330947|ref|NP_441675.1| rRNA methylase [Synechocystis sp. PCC 6803]
 gi|3915481|sp|P74261|Y1673_SYNY3 RecName: Full=Uncharacterized tRNA/rRNA methyltransferase slr1673
 gi|1653441|dbj|BAA18355.1| rRNA methylase [Synechocystis sp. PCC 6803]
          Length = 274

 Score =  132 bits (331), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 55/255 (21%), Positives = 100/255 (39%), Gaps = 4/255 (1%)

Query: 26  NHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLL-ATKNALARLDWD 84
            +   K+++  +Q ++   Q   L L G H +  AL            A       +  D
Sbjct: 15  QNPLVKQLRQLHQ-TKGRKQQGQLLLEGTHLLEVALAQGKGFNHGCFTAMWQEKNPVLAD 73

Query: 85  ANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDHVNDP 144
             +        V  + + K+         +A  T      +        L++  + + DP
Sbjct: 74  RLMAQSVHSYLVSGEVLAKMASTVNPDGVVATLTMDQFWRSPPPHARLGLVL--ERLQDP 131

Query: 145 HNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHS 204
            N+G ILR+A A   +GI  T       S  + +S++G+   +P  ++ +L   L+K H+
Sbjct: 132 GNLGTILRTAAATGVEGIWLTADCVDPTSPKVLRSSAGSSLLLPQQQLQSLPPLLEKFHT 191

Query: 205 WGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALN 264
            G Q I     + + L +        +I G+EG+GL     E  T    +     +++LN
Sbjct: 192 QGLQLIATVPQATQTLWEIDFQRPTIVIFGSEGQGLSAPVLELTTHQVAIPQAPQVESLN 251

Query: 265 VSNAAAVALYITQNH 279
           V+ A  V LY  +  
Sbjct: 252 VAIAVGVMLYEARRQ 266


>gi|237654034|ref|YP_002890348.1| RNA methyltransferase, TrmH family, group 3 [Thauera sp. MZ1T]
 gi|237625281|gb|ACR01971.1| RNA methyltransferase, TrmH family, group 3 [Thauera sp. MZ1T]
          Length = 251

 Score =  132 bits (331), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 72/238 (30%), Positives = 117/238 (49%), Gaps = 7/238 (2%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLA---TKNALARLDWDANLPHPFPVKTVPPQTIDKIVG 106
            +YG H VSA L +    + ++      K+A  R            +       +D +VG
Sbjct: 12  LIYGFHAVSAKLRHAPDSVLEIFLTADRKDARVRKFLAQAESAGVRITQSEGDKLDALVG 71

Query: 107 KEAVH----QGLALETAPLLSPTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGI 162
                    +  A      L+  LD++  + L++VLD V DPHN+GA LR A A     +
Sbjct: 72  TRRHQGVVAKVDATRREIKLADVLDSLDENALILVLDGVQDPHNLGACLRVADAAGAHAV 131

Query: 163 ITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQ 222
           +  K  +   +A   K ASGA + +PYI ++NL  AL++M   G   +G + +++K L  
Sbjct: 132 VAPKDRAVGLNATAVKVASGAADTVPYITVTNLARALREMQDAGVWVVGAAGEAEKTLYG 191

Query: 223 EIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
             +   +A +LGAEG GLR  T+ET   +A + M G +++LNVS A+ + L+  +   
Sbjct: 192 VDQKVPVAWVLGAEGDGLRRLTRETCDELARIPMHGSVESLNVSVASGICLFEARRQR 249


>gi|197301392|ref|ZP_03166473.1| hypothetical protein RUMLAC_00123 [Ruminococcus lactaris ATCC
           29176]
 gi|197299549|gb|EDY34068.1| hypothetical protein RUMLAC_00123 [Ruminococcus lactaris ATCC
           29176]
          Length = 270

 Score =  132 bits (331), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 63/271 (23%), Positives = 115/271 (42%), Gaps = 15/271 (5%)

Query: 20  YAKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPS--RKIFQLLATKNA 77
             +  R +  Y +     +          L + G + V  A  +     K+F L   ++ 
Sbjct: 2   KEQRMRENSRYHE----AENHTGQDNSHTLVIEGRNAVLEAFRSGKPIDKVFVLDGCQDG 57

Query: 78  LARLDWDANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAV-------R 130
             R        H   +  V  + + +I  +   HQG+    A     T+D +        
Sbjct: 58  PVRTIVREAKKHDALLNFVTKERLSQIS-ETGKHQGVVAYAAAYEYSTVDDMLALAEERG 116

Query: 131 NSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYI 190
               +++LD++ DPHN+GAI+R+A      G+I  KR +   +A +AK+++GAL + P  
Sbjct: 117 EDPFILILDNIEDPHNLGAIIRTANLAGAHGVIIPKRRAVGLTATVAKTSAGALNYTPVA 176

Query: 191 RISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATS 250
           +++NL   ++++   G   +       +P+        I L++G EG+G+    +E    
Sbjct: 177 KVTNLVKTMEELKEKGLWFVCA-DMDGEPMYHLNLTGPIGLVIGNEGEGVSRLVKENCDF 235

Query: 251 MAHLHMPGIIKALNVSNAAAVALYITQNHFA 281
           +A + M G I +LN S AA V  Y       
Sbjct: 236 VAGIPMKGQINSLNASVAAGVLAYEIVRQRI 266


>gi|193216018|ref|YP_001997217.1| RNA methyltransferase, TrmH family, group 3 [Chloroherpeton
           thalassium ATCC 35110]
 gi|193089495|gb|ACF14770.1| RNA methyltransferase, TrmH family, group 3 [Chloroherpeton
           thalassium ATCC 35110]
          Length = 243

 Score =  132 bits (331), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 61/239 (25%), Positives = 115/239 (48%), Gaps = 9/239 (3%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLATKNALA---RLDWDANLPHPFPVKTVPPQTIDKIVG 106
            +YG + V   +     ++ ++    N      +        H   +       + ++ G
Sbjct: 4   VVYGRNAVLELIRTRPEEVEKIYFQFNTEQSKLKEILVTAKRHNISIGKARNNRLVELSG 63

Query: 107 KEAVHQGLALETAPLLSPTLD-----AVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDG 161
            +  HQG+      +    LD        + QL+++LD + DPHN+GAI+R+A A + D 
Sbjct: 64  TDK-HQGVCALVGKVKYFELDEILARPRNSKQLIVILDGLEDPHNVGAIIRTAEAAAVDA 122

Query: 162 IITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLE 221
           +I         +A +AK+++GAL HI   ++ NL+  ++++   GF   GL  D +K   
Sbjct: 123 VIIPHDSGCPINATVAKTSAGALSHIRLCKVVNLSQTIERLKKHGFWVYGLDMDGEKNYY 182

Query: 222 QEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
           +   ND  A+++G+EGKG+R   ++   ++  L + G +++LN S +AA+ LY      
Sbjct: 183 EIDFNDHCAIVVGSEGKGIRQLVRKNCDALIRLPIAGNVESLNASVSAAIPLYEAMRQR 241


>gi|167629448|ref|YP_001679947.1| RNA methyltransferase, trmh family [Heliobacterium modesticaldum
           Ice1]
 gi|167592188|gb|ABZ83936.1| RNA methyltransferase, trmh family [Heliobacterium modesticaldum
           Ice1]
          Length = 256

 Score =  132 bits (331), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 66/241 (27%), Positives = 116/241 (48%), Gaps = 14/241 (5%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLATKNAL---ARLDWDANLPHPFPVKTVPPQTIDKIVG 106
            L G   V  AL +  R I +L+  K A     R           P+  +    +D+ V 
Sbjct: 12  LLAGRQPVMEALKSG-RAINKLVVAKGAREGSIREILGMARDRGIPITELERTVLDREVR 70

Query: 107 KEAVHQGLALETAPLLSPTLDAV-------RNSQLLMVLDHVNDPHNIGAILRSAVAFSC 159
               HQG+    AP+    ++ +            +++LD + DPHNIGA+LR+A     
Sbjct: 71  H---HQGIIAHVAPVAYVEVEEILEKAKAKGEPPFVLLLDGLEDPHNIGALLRTAEGAGA 127

Query: 160 DGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKP 219
            G+I  KR   + ++ +AK+++GA+E++P  R++NL   + ++   G   IG + D+ +P
Sbjct: 128 HGVIIPKRRGGAITSTVAKASAGAVEYVPIARVTNLVQTVGQLKKAGLWIIGSAMDAPRP 187

Query: 220 LEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNH 279
             ++     + LI+G+EGKG+ P  +E    +  + M G + +LN S A A+ +Y     
Sbjct: 188 YFRQDFRGPVGLIVGSEGKGISPLLREHCDHLVSIPMGGKVDSLNASVAGALLMYERVRQ 247

Query: 280 F 280
            
Sbjct: 248 L 248


>gi|163867316|ref|YP_001608510.1| TrmH family tRNA methyltransferase [Bartonella tribocorum CIP
           105476]
 gi|161016957|emb|CAK00515.1| tRNA/rRNA methyltransferase protein, TrmH family [Bartonella
           tribocorum CIP 105476]
          Length = 284

 Score =  132 bits (331), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 49/275 (17%), Positives = 102/275 (37%), Gaps = 11/275 (4%)

Query: 7   KKSEKIFSLKDSHYAKLRRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSR 66
            K+ ++  +          ++   K +++ +QK ++ ++       G+  V  ALN    
Sbjct: 4   PKTGRVKEITSL-------SNPIIKDLKALSQK-KNRNREGLFMAEGLKLVIDALNLGWT 55

Query: 67  KIFQLLATKNALARLDWD---ANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLS 123
               + +          +     + +   V     + ++ +  ++     + +      S
Sbjct: 56  IQTLIFSKSEIGNATIENTAARAVANGGFVIKASQKVMESLTRRDNPQTVIGIFKQKWQS 115

Query: 124 PTLDAVRNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGA 183
             +   +   + + LD V DP N+G I+R+A A S  G+I     +   S    ++  G+
Sbjct: 116 LEMITGQAKDVYIALDRVRDPGNLGTIIRTADAVSAKGVILIGETTDPFSPETVRATMGS 175

Query: 184 LEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPK 243
           +  IP  R              G         S    + ++KN  I L++G E +GL   
Sbjct: 176 IFSIPLYRFDESAFLNWSSCFKGMIVGTHLKGSLDYRKLDLKNGPIILLMGNEKQGLSDI 235

Query: 244 TQETATSMAHLHMPGIIKALNVSNAAAVALYITQN 278
                  +A +   G   +LN++ A AV LY  + 
Sbjct: 236 LTNRCDKLARIPQSGRADSLNLAIATAVMLYEIRR 270


>gi|157150299|ref|YP_001449674.1| RNA methyltransferase [Streptococcus gordonii str. Challis substr.
           CH1]
 gi|157075093|gb|ABV09776.1| RNA methyltransferase, TrmH family, group 3 [Streptococcus gordonii
           str. Challis substr. CH1]
          Length = 243

 Score =  132 bits (331), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 71/242 (29%), Positives = 117/242 (48%), Gaps = 9/242 (3%)

Query: 46  PENLFLYGVHTVSAALNNP-SRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKI 104
            +N  +YGVH V+ AL      K++     +        D        +   P +T+ ++
Sbjct: 2   EKNDIVYGVHAVTEALAANTGNKLYIQDDLRGKKVDKIKDLAAEKKVSISWTPKKTLQEM 61

Query: 105 VGKEAVHQGLALETAPLLSPTLD------AVRNSQLLMVLDHVNDPHNIGAILRSAVAFS 158
               AVHQG  L  A       +         ++ LL++LD + DPHN+G+ILR+A A +
Sbjct: 62  TD-GAVHQGFVLRVAEFAYTDFEVLLKKAEQEDNPLLLILDGLTDPHNLGSILRTADATN 120

Query: 159 CDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKK 218
             G+I  K  +   + V+AK+++GA+EHIP  R++NL+  L K+   GF   G       
Sbjct: 121 VSGVIIPKHRAVGVTPVVAKTSTGAIEHIPIARVTNLSQTLDKLKEAGFWIFGTDMQGTP 180

Query: 219 PLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQN 278
             +      K+ LI+G EGKG+    ++    M  + M G +++LN S AAA+ +Y    
Sbjct: 181 SHKWNT-GGKLVLIIGNEGKGISSNIKKQVDEMISIPMNGHVQSLNASVAAAILMYEVFR 239

Query: 279 HF 280
           + 
Sbjct: 240 NR 241


>gi|153939007|ref|YP_001392409.1| RNA methyltransferase [Clostridium botulinum F str. Langeland]
 gi|152934903|gb|ABS40401.1| RNA methyltransferase, TrmH family [Clostridium botulinum F str.
           Langeland]
 gi|295320398|gb|ADG00776.1| RNA methyltransferase, TrmH family [Clostridium botulinum F str.
           230613]
          Length = 259

 Score =  132 bits (331), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 54/262 (20%), Positives = 107/262 (40%), Gaps = 9/262 (3%)

Query: 24  RRNHRDYKKMQSFNQKSRHTSQPENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDW 83
            ++++  K+++   +K ++ +Q ++  + G      AL + S  + ++   + +L +L+ 
Sbjct: 4   SKDNQLIKEVRKLREK-KYRTQNKSFIIEGFRFFEEALKSNS-SVNKVFIEEKSLNKLEE 61

Query: 84  ---DANLPHPFPVKTVPPQTIDKIVGKEAVHQGLALETAPLLSPTLDAVRNSQLLMVLDH 140
                N+ +      V    +  I G     QG+           LD      +L+  D 
Sbjct: 62  LYKKYNINNDIETYVVNYSVLKSI-GNTENPQGIVSVINYFKKEKLDLQNGFYILV--DK 118

Query: 141 VNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQ 200
           V DP N+G I+R+A A    G+ITTK      +    +S  G++ +IP I   NL     
Sbjct: 119 VQDPGNMGTIIRTAHAAGALGVITTKGTVDIYNEKTLRSTMGSIFYIPIIEDENLEVVKS 178

Query: 201 KMHSWGFQTIGLSSDSKKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGII 260
                    +     +    +  +KN  I + +G EG G+       +     + MPG  
Sbjct: 179 LQKKGFKLLVSSLDTNSNFYDVNMKN-NIIIAVGNEGNGISEVLNTLSDIKVKIPMPGAA 237

Query: 261 KALNVSNAAAVALYITQNHFAK 282
           ++LNV+ A ++  +       +
Sbjct: 238 ESLNVAVACSIMTFERIRQINE 259


>gi|296877290|ref|ZP_06901330.1| RNA methyltransferase [Streptococcus parasanguinis ATCC 15912]
 gi|296431810|gb|EFH17617.1| RNA methyltransferase [Streptococcus parasanguinis ATCC 15912]
          Length = 242

 Score =  132 bits (331), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 71/242 (29%), Positives = 117/242 (48%), Gaps = 9/242 (3%)

Query: 46  PENLFLYGVHTVSAALNNP-SRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKI 104
             N  +YGVH V+ AL      K++     +                 +   P +T+ ++
Sbjct: 2   ENNDIVYGVHAVTEALQANTGNKLYIQEDLRGKNVDKIKALAAEKKVSISWTPKKTLQEM 61

Query: 105 VGKEAVHQGLALETAPLLSPTL------DAVRNSQLLMVLDHVNDPHNIGAILRSAVAFS 158
             + AVHQG  L  A      L           + LL++LD + DPHN+G+ILR+A A +
Sbjct: 62  T-EGAVHQGFVLRVAAFAYTDLAVILKQTVQEENPLLLILDGLTDPHNLGSILRTADATN 120

Query: 159 CDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKK 218
             G+I  K  +   + V++K+++GA+EHIP  R++NL+  L K+   GF   G   +   
Sbjct: 121 VSGVIIPKHRAVGVTPVVSKTSTGAVEHIPIARVTNLSQTLDKLKEEGFWIFGTDMNGTP 180

Query: 219 PLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQN 278
             +      K+ALI+G EGKG+    ++    M  + M G +++LN S AAA+ +Y    
Sbjct: 181 SHQWNTA-GKLALIIGNEGKGISANIKKQVDEMITIPMNGHVQSLNASVAAAILMYEVFR 239

Query: 279 HF 280
           + 
Sbjct: 240 NR 241


>gi|269961411|ref|ZP_06175775.1| RNA methyltransferase [Vibrio harveyi 1DA3]
 gi|269833788|gb|EEZ87883.1| RNA methyltransferase [Vibrio harveyi 1DA3]
          Length = 247

 Score =  132 bits (331), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 71/243 (29%), Positives = 112/243 (46%), Gaps = 10/243 (4%)

Query: 48  NLFLYGVHTVSAALNNPSRKIFQLLATKNALA-RLDWDANLPH--PFPVKTVPPQTIDKI 104
           N F+YG+H V A L     +  +    K     RL    N        ++ +  +T+D  
Sbjct: 3   NEFIYGIHAVKAVLEREPERFIEAYVLKGRQDDRLMPILNDLQVCGVSIQQMTRKTLDDK 62

Query: 105 VGKEAVHQGLALETAPLLSPTLDA------VRNSQLLMVLDHVNDPHNIGAILRSAVAFS 158
               A HQG+            +          S LL+VLD V DPHN+GA LR+A A  
Sbjct: 63  A-HGANHQGIIARVKAAKQLNENDIDGILAQHESPLLLVLDGVTDPHNLGACLRNADAAG 121

Query: 159 CDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKK 218
              II  K  S   +A ++K A GA E +P IR++NL   ++ +   G   +G + ++  
Sbjct: 122 VAAIIVPKDRSAPMNATVSKVACGAAEVVPLIRVTNLARTMRTLQEQGIWFVGTAGEATH 181

Query: 219 PLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQN 278
            + Q      +A+++GAEG G+R  T+ET   +  + M G + +LNVS A+ + L+    
Sbjct: 182 DIYQAKLTGPLAIVMGAEGDGMRRLTRETCDDLIKIPMAGSVSSLNVSVASGICLFEAVR 241

Query: 279 HFA 281
              
Sbjct: 242 QRI 244


>gi|312898322|ref|ZP_07757712.1| RNA methyltransferase, TrmH family, group 3 [Megasphaera
           micronuciformis F0359]
 gi|310620241|gb|EFQ03811.1| RNA methyltransferase, TrmH family, group 3 [Megasphaera
           micronuciformis F0359]
          Length = 247

 Score =  132 bits (331), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 57/242 (23%), Positives = 109/242 (45%), Gaps = 10/242 (4%)

Query: 50  FLYGVHTVSAALNNPSRKIFQLLATKNALARLDWD--ANLPHPFPVKTVPPQTIDKIVGK 107
            + G ++V+ AL          +  K     L            PV+ V  + ++++   
Sbjct: 5   IIAGRNSVTEALKAGRSVTKIYMTAKKEAPPLARIRTLAKERKIPVEFVDNRAMERLAPG 64

Query: 108 EAVHQGLALETAPLLSPTLDA-------VRNSQLLMVLDHVNDPHNIGAILRSAVAFSCD 160
              HQ +    A +    LD              L++ D + D HN+GAI+R+A      
Sbjct: 65  IR-HQDVVALAAAVDFADLDDVLAKVREQGEMPFLVLADGIEDVHNLGAIIRTAECAGVH 123

Query: 161 GIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPL 220
            I+  +R+S   +  +AK+++GA+E++P +RI N+T  L+++   GF  +G     ++  
Sbjct: 124 AILVPQRHSAPINETVAKTSAGAVEYMPVVRIGNVTTTLKQLKKQGFWVLGADMVGEENY 183

Query: 221 EQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
                +  + L++G+EGKG+    ++    +  + M G I +LN S AAA+ +Y      
Sbjct: 184 YSLSADMPLVLVIGSEGKGISRLVKDNCDVLVRIPMFGRINSLNASVAAALLMYEVARKR 243

Query: 281 AK 282
            +
Sbjct: 244 HR 245


>gi|307702003|ref|ZP_07639011.1| RNA methyltransferase, TrmH family, group 3 [Streptococcus mitis
           NCTC 12261]
 gi|307616648|gb|EFN95837.1| RNA methyltransferase, TrmH family, group 3 [Streptococcus mitis
           NCTC 12261]
          Length = 242

 Score =  132 bits (331), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 74/240 (30%), Positives = 121/240 (50%), Gaps = 9/240 (3%)

Query: 48  NLFLYGVHTVSAAL-NNPSRKIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDKIVG 106
           N  +YGVH V+ AL  N   K++     +        +        +     +++ ++  
Sbjct: 4   NDIVYGVHAVTEALLANTGNKLYLQEDLRGKNVEKVKELATEKKVSISWTSKKSLSEMT- 62

Query: 107 KEAVHQGLALETAPLLSPTLDA------VRNSQLLMVLDHVNDPHNIGAILRSAVAFSCD 160
           + AVHQG  L  +      LD          + LL++LD + DPHN+G+ILR+A A +  
Sbjct: 63  EGAVHQGFVLRVSEFAYSELDQILAKTRQEENPLLLILDGLTDPHNLGSILRTADATNVS 122

Query: 161 GIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDSKKPL 220
           G+I  K  +   + V+AK+A+GA+EH+P  R++NL+  L K+   GF T G   +     
Sbjct: 123 GVIIPKHRAVGVTPVVAKTATGAIEHVPIARVTNLSQTLDKLKGEGFWTFGTDMNGTPCH 182

Query: 221 EQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
           +   K  KIALI+G EGKG+    ++    M  + M G +++LN S AAA+ +Y    + 
Sbjct: 183 KWNTK-GKIALIIGNEGKGISTNIKKQVDEMITIPMNGHVQSLNASVAAAILMYEVFRNR 241


>gi|240948309|ref|ZP_04752695.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Actinobacillus minor
           NM305]
 gi|240297348|gb|EER47889.1| 23S rRNA (guanosine-2'-O-)-methyltransferase [Actinobacillus minor
           NM305]
          Length = 246

 Score =  132 bits (331), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 67/238 (28%), Positives = 104/238 (43%), Gaps = 9/238 (3%)

Query: 51  LYGVHTVSAALNNPSRKIFQLLATKNA-LARLDWDANLPH--PFPVKTVPPQTIDKIVGK 107
           +YG+H V A L+N   ++ ++   K     RL    N        ++ V  QT+D     
Sbjct: 5   IYGIHAVKAFLDNAPERLIEVFVLKGREDKRLIPLLNELQRLGIAIQQVNRQTLDNKSQG 64

Query: 108 EAVHQGLALETAPLLSPTLDAV-----RNSQLLMVLDHVNDPHNIGAILRSAVAFSCDGI 162
           E     +A           D       +   LL++LD V DPHN+GA LR+A A   D +
Sbjct: 65  EVHQGIIAKVVPQKELNEHDLDRILASKPQPLLLILDGVTDPHNLGACLRTADAAGVDAV 124

Query: 163 ITTKRYSPSESAVLAKSASGALEHIPYIRISN-LTDALQKMHSWGFQTIGLSSDSKKPLE 221
           I  K  S   ++   K A GA E +P IR++N      +         +G + ++   + 
Sbjct: 125 IVPKDKSAQLTSTARKVACGAAETVPLIRVTNLARTMRELQEQHNVWIVGTAGEATSSIY 184

Query: 222 QEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYITQNH 279
                  IAL++GAEG G+R  T+E    +  + M G + +LNVS A  V L+     
Sbjct: 185 DAKLTGAIALVMGAEGDGMRRLTREHCDQLISIPMAGSVSSLNVSVATGVCLFEIIRQ 242


>gi|197119261|ref|YP_002139688.1| 23S rRNA (2'-O-methyl-G2251)-methyltransferase [Geobacter
           bemidjiensis Bem]
 gi|197088621|gb|ACH39892.1| 23S rRNA (2'-O-methyl-G2251)-methyltransferase [Geobacter
           bemidjiensis Bem]
          Length = 248

 Score =  132 bits (331), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 66/244 (27%), Positives = 118/244 (48%), Gaps = 11/244 (4%)

Query: 46  PENLFLYGVHTVSAALNNPSRKIFQLLA---TKNALARLDWDANLPHPFPVKTVPPQTID 102
            +   +YG++ V  AL   SR+I +L     + +               PV+      ++
Sbjct: 2   SKEEIIYGLNPVMEALR-GSREIHELFVAGTSADKRLEKLLKLAAERKIPVRQREKGDLN 60

Query: 103 KIVGKEAVHQGLALETAPLLSPTLD------AVRNSQLLMVLDHVNDPHNIGAILRSAVA 156
           ++ G E  HQG+AL+  P     LD            L++VLD V DPHN+GA++RSA  
Sbjct: 61  RLCGTE-HHQGVALKVEPFPYADLDDVLEGLQGTRDGLILVLDSVQDPHNLGALIRSAAC 119

Query: 157 FSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDS 216
              + ++  K  +   +AV  KS++GA E I   +++N++ AL+ +   GF   G    +
Sbjct: 120 AGANAVVIPKDRAAGVTAVAEKSSAGATETISVAQVTNISQALESLKKAGFWIYGADGSA 179

Query: 217 KKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYIT 276
           +  L Q+     +AL++G EG+G+RP  ++   ++  + + G + +LN S A  + L+  
Sbjct: 180 RHTLYQQDFTGPVALVIGGEGEGIRPLVRKGCDAVVSIPLQGGVNSLNASVAGGIFLFEV 239

Query: 277 QNHF 280
               
Sbjct: 240 VRQR 243


>gi|225010506|ref|ZP_03700977.1| RNA methyltransferase, TrmH family, group 3 [Flavobacteria
           bacterium MS024-3C]
 gi|225005335|gb|EEG43286.1| RNA methyltransferase, TrmH family, group 3 [Flavobacteria
           bacterium MS024-3C]
          Length = 246

 Score =  132 bits (331), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 64/245 (26%), Positives = 113/245 (46%), Gaps = 9/245 (3%)

Query: 46  PENLFLYGVHTVSAALNNPSR--KIFQLLATKNALARLDWDANLPHPFPVKTVPPQTIDK 103
            +  ++YG+  V  A+       K+F     +  L +   +           VP + +D+
Sbjct: 2   EKQTYIYGIRAVIEAIEAKETLDKVFIQKGLQGDLIKTLENLIRKQGLNTSYVPVEKLDR 61

Query: 104 IVGKEAVHQGLALETAPLLSPTLDAV-------RNSQLLMVLDHVNDPHNIGAILRSAVA 156
           +  +   HQG+    +P+    LD         + + L ++LD ++D  N GAI+R+A  
Sbjct: 62  LAKQHNNHQGVVASISPIEFHELDPFVESVLETKEAPLFLLLDQLSDVRNFGAIIRTASC 121

Query: 157 FSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDS 216
              DGII  K+ +   +A   K+++GA   +P I++ +L DA+  + + G Q I  +  +
Sbjct: 122 TGVDGIIIQKKGTAPVTADTIKTSAGAAFQVPIIKVDHLKDAVFHLQACGIQVIAATEKA 181

Query: 217 KKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYIT 276
           K  L +       A+++G+E  G+ P   + A + A L M G I +LNVS A  V LY  
Sbjct: 182 KNDLYEVSFTGPTAIVMGSEDMGITPSILKVANAQAKLPMQGPISSLNVSVACGVFLYEA 241

Query: 277 QNHFA 281
                
Sbjct: 242 VRQRK 246


>gi|160891918|ref|ZP_02072921.1| hypothetical protein BACUNI_04376 [Bacteroides uniformis ATCC 8492]
 gi|270296416|ref|ZP_06202616.1| RNA methyltransferase, TrmH family, group 3 [Bacteroides sp. D20]
 gi|317480388|ref|ZP_07939488.1| RNA methyltransferase [Bacteroides sp. 4_1_36]
 gi|156858396|gb|EDO51827.1| hypothetical protein BACUNI_04376 [Bacteroides uniformis ATCC 8492]
 gi|270273820|gb|EFA19682.1| RNA methyltransferase, TrmH family, group 3 [Bacteroides sp. D20]
 gi|316903466|gb|EFV25320.1| RNA methyltransferase [Bacteroides sp. 4_1_36]
          Length = 246

 Score =  132 bits (331), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 59/245 (24%), Positives = 105/245 (42%), Gaps = 13/245 (5%)

Query: 47  ENLFLYGVHTVSAALNNPSRKIFQLLATKNALARLDWDA-NLPHP--FPVKTVPPQTIDK 103
            +  ++GV  V  A+      I ++L  K+  + L  +   +      PV+ VP + I++
Sbjct: 4   NSEMIFGVRAVIEAIQAGKE-IDKILVKKDIQSDLSKELFAVLKGTLIPVQRVPVERINR 62

Query: 104 IVGKEAVHQGLALETAPLLSP-------TLDAVRNSQLLMVLDHVNDPHNIGAILRSAVA 156
           +      HQG+    + +           L     + L ++LD + D  N GAI R+   
Sbjct: 63  VT--RKNHQGVIAFISSVTYQKTEDLVPFLFEQGKNPLFVMLDGITDVRNFGAIARTCEC 120

Query: 157 FSCDGIITTKRYSPSESAVLAKSASGALEHIPYIRISNLTDALQKMHSWGFQTIGLSSDS 216
            + D +I   R S S +A   K+++GAL  +P  R  +L + LQ + + GF  +  +   
Sbjct: 121 AAVDAVIIPARNSVSVNADAMKTSAGALHTLPVCREHSLKETLQFLKNSGFHIVAATEKG 180

Query: 217 KKPLEQEIKNDKIALILGAEGKGLRPKTQETATSMAHLHMPGIIKALNVSNAAAVALYIT 276