RPSBLAST alignment of GI: 254780603 and protein with PDBid: 3ilk

>3ilk_A Uncharacterized tRNA/RRNA methyltransferase HI0380; APC63004, methylase family protein, haemophilus influenzae RD KW20; 2.01A {Haemophilus influenzae} Length = 244
 Score = 72.6 bits (177), Expect = 1e-13
 Identities = 27/157 (17%), Positives = 51/157 (32%), Gaps = 10/157 (6%)

Query: 132 SQLLMVLDHVNDPHNIGAILRSAVAFSCDGIITTKRYSPSESAVLAKSASGALEHIPYIR 191
             + +VL   +   NIG+  R+        +      S  E +     ++GA   +   R
Sbjct: 6   ENIRIVLIETSHSGNIGSAARAMKTMGLTQLCLVSPKSVDEQSY--ALSAGAENIVKNAR 63

Query: 192 ISNLTDALQKMHSWGFQTIGLSSDSKKPL--------EQEIKNDKIALILGAEGKGLRPK 243
           + +  D      S    T       +  L        +      KIA++ G E  GL  +
Sbjct: 64  VVDSFDEAVDDCSLVIGTSARLRHLQNTLIEPRECAEKVVAYKGKIAIVFGRERIGLTNE 123

Query: 244 TQETATSMAHLHMPGIIKALNVSNAAAVALYITQNHF 280
                    ++       +LN++ A  +  Y  +  F
Sbjct: 124 ELLKCHYHLNIPANPDYSSLNLAMAVQLVSYELRMAF 160