HHsearch alignment for GI: 254780606 and conserved domain: COG0419

>COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair].
Probab=95.99  E-value=0.015  Score=36.46  Aligned_cols=39  Identities=23%  Similarity=0.388  Sum_probs=29.8

Q ss_pred             CEEECCHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCC
Q ss_conf             732112011484699707875344799999999998568
Q gi|254780606|r  403 ESVIADLANMPHILVAGTTGSGKSVAINTMIMSLLYRLR  441 (744)
Q Consensus       403 ~~~~~dl~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~  441 (744)
T Consensus        16 ~~~~~~~f~~gi~lI~G~nGsGKSSIldAI~~ALyG~~~   54 (908)
T COG0419          16 DIDIEKLFDSGIFLIVGPNGAGKSSILDAITFALYGKTP   54 (908)
T ss_pred             CCCCCCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCCC
T ss_conf             562231578883799899999788999999999828987