HHsearch alignment for GI: 254780606 and conserved domain: COG0444

>COG0444 DppD ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism].
Probab=93.75  E-value=0.54  Score=25.82  Aligned_cols=186  Identities=22%  Similarity=0.269  Sum_probs=91.8

Q ss_pred             EECCHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEE--EEEECCCC-CEEC--------------CCCCCCCEE
Q ss_conf             211201148469970787534479999999999856801107--99972342-1000--------------125775200
Q gi|254780606|r  405 VIADLANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECR--MIMVDPKM-LELS--------------VYDGIPHLL  467 (744)
Q Consensus       405 ~~~dl~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~--~~liD~k~-~~~~--------------~~~~~ph~~  467 (744)
T Consensus        24 vs~~i~~GE~lgiVGESGsGKS~~~~aim-~llp~-~~~~i~~G~i~f~g~~l~~l~~~~~~~iRG~~I~mIfQ~p~~sL  101 (316)
T COG0444          24 VSFELKKGEILGIVGESGSGKSVLAKAIM-GLLPK-PNARIVGGEILFDGKDLLSLSEKELRKIRGKEIAMIFQDPMTSL  101 (316)
T ss_pred             EEEEECCCCEEEEECCCCCCHHHHHHHHH-HCCCC-CCCEEEEEEEEECCCCCCCCCHHHHHHHCCCEEEEEECCCHHHC
T ss_conf             05887589689998389788999999998-46688-89748611899889646669999998631756899974815644


Q ss_pred             EEEEECHHHHHHHHHHHH-----HH-HHHHHHHHHHCCCCCHHH-HHHHHHHHHCCCCCCCCCC--------CCCCCEEE
Q ss_conf             004444178768999999-----86-676999999807786799-9998864202677666543--------23386799
Q gi|254780606|r  468 TPVVTNPKKAVMALKWAV-----RE-MEERYRKMSHLSVRNIKS-YNERISTMYGEKPQGCGDD--------MRPMPYIV  532 (744)
Q Consensus       468 ~~v~~~~~~~~~~l~~~~-----~e-m~~r~~~~~~~~~~~i~~-~n~~~~~~~~~~~~~~~~~--------~~~~p~iv  532 (744)
T Consensus       102 nPv~~Ig~Qi~E~l~~h~~~~~~~ea~~~a~~~L~~Vgi~~~~~~~~~------YPhelSGGMrQRV~IAmal~~~P~L-  174 (316)
T COG0444         102 NPVMTIGDQIAEVLRLHGKGLSKKEAKERAIELLELVGIPDPERRLKS------YPHELSGGMRQRVMIAMALALNPKL-  174 (316)
T ss_pred             CCHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHCCCCCHHHHHHH------CCCCCCCCHHHHHHHHHHHHCCCCE-
T ss_conf             970349999999999851411368999999999997699987899861------9835587189999999998589988-


Q ss_pred             EEHHHHHH-HHHHCCHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCCCHHHHHHCCCCEEE----EECCCHHHCCHHCCC
Q ss_conf             98445687-6753103589999999996420135899985165444414678850563057----203681110032676
Q gi|254780606|r  533 IIVDEMAD-LMMVAGKEIEGAIQRLAQMARAAGIHLIMATQRPSVDVITGTIKANFPIRIS----FQVTSKIDSRTILGE  607 (744)
Q Consensus       533 vviDE~a~-l~~~~~~~~e~~~~~la~~~ra~GihlilatQrp~~~vi~~~ik~n~~~ri~----~~v~~~~dsr~il~~  607 (744)
T Consensus       175 lIADEPTTALDvtvQaqIl~ll~~l---~~e~~~siilITHDl~--v-----va~~aDrv~VMYaG~iVE~g~~~~i~~~  244 (316)
T COG0444         175 LIADEPTTALDVTVQAQILDLLKEL---QREKGTALILITHDLG--V-----VAEIADRVAVMYAGRIVEEGPVEEIFKN  244 (316)
T ss_pred             EEECCCCCHHHHHHHHHHHHHHHHH---HHHCCCEEEEEECCHH--H-----HHHHCCEEEEEECCEEEEECCHHHHHCC
T ss_conf             9967986045199999999999999---9854978999948889--9-----9974566899877589986788887438


Q ss_pred             CC
Q ss_conf             31
Q gi|254780606|r  608 HG  609 (744)
Q Consensus       608 ~g  609 (744)
T Consensus       245 P~  246 (316)
T COG0444         245 PK  246 (316)
T ss_pred             CC
T ss_conf             99