HHsearch alignment for GI: 254780606 and conserved domain: COG1136

>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms].
Probab=96.92  E-value=0.0029  Score=41.35  Aligned_cols=152  Identities=18%  Similarity=0.258  Sum_probs=72.8

Q ss_pred             ECCHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCC---CE------------ECCCCCCCCEEEEE
Q ss_conf             1120114846997078753447999999999985680110799972342---10------------00125775200004
Q gi|254780606|r  406 IADLANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKM---LE------------LSVYDGIPHLLTPV  470 (744)
Q Consensus       406 ~~dl~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~---~~------------~~~~~~~ph~~~~v  470 (744)
T Consensus        25 ~l~i~~Ge~vaI~GpSGSGKSTLLn-iig~l-d~pt~G~v~i~g~~~~~l~~~~~~~~R~~~iGfvFQ~~nLl~~l----   98 (226)
T COG1136          25 NLEIEAGEFVAIVGPSGSGKSTLLN-LLGGL-DKPTSGEVLINGKDLTKLSEKELAKLRRKKIGFVFQNFNLLPDL----   98 (226)
T ss_pred             EEEECCCCEEEEECCCCCCHHHHHH-HHHCC-CCCCCCEEEECCEECCCCCHHHHHHHHHHHEEEECCCCCCCCCC----
T ss_conf             5887499899998999998999999-99646-67888469999888675898899999777489987567778988----


Q ss_pred             EECHHHHHHHHHH--H-HHHHHHHHHH-HHHCCCCCHHH----------HHHHHHHHHCCCCCCCCCCCCCCCEEEEEHH
Q ss_conf             4441787689999--9-9866769999-99807786799----------9998864202677666543233867999844
Q gi|254780606|r  471 VTNPKKAVMALKW--A-VREMEERYRK-MSHLSVRNIKS----------YNERISTMYGEKPQGCGDDMRPMPYIVIIVD  536 (744)
Q Consensus       471 ~~~~~~~~~~l~~--~-~~em~~r~~~-~~~~~~~~i~~----------~n~~~~~~~~~~~~~~~~~~~~~p~ivvviD  536 (744)
T Consensus        99 -tv~ENv~lpl~~~~~~~~~~~~~~~~l~~~lgl~~~~~~~~p~~LSGGqqQRVAIARAL~---------~~P~iilADE  168 (226)
T COG1136          99 -TVLENVELPLLIAGKSAGRRKRAAEELLEVLGLEDRLLKKKPSELSGGQQQRVAIARALI---------NNPKIILADE  168 (226)
T ss_pred             -CHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCHHHHCCCCCHHCCHHHHHHHHHHHHHH---------CCCCEEEEEC
T ss_conf             -899999869987478736799999999986698123235881226979999999999982---------4998699607


Q ss_pred             HHHHHHHHCCHHHHHHHHHHHHHHHCCEEEEEEEECCCCC
Q ss_conf             5687675310358999999999642013589998516544
Q gi|254780606|r  537 EMADLMMVAGKEIEGAIQRLAQMARAAGIHLIMATQRPSV  576 (744)
Q Consensus       537 E~a~l~~~~~~~~e~~~~~la~~~ra~GihlilatQrp~~  576 (744)
T Consensus       169 PTgnLD~~t~~~V~~l---l~~~~~~~g~tii~VTHD~~l  205 (226)
T COG1136         169 PTGNLDSKTAKEVLEL---LRELNKERGKTIIMVTHDPEL  205 (226)
T ss_pred             CCCCCCHHHHHHHHHH---HHHHHHHCCCEEEEECCCHHH
T ss_conf             6665886789999999---999987469899999089899