HHsearch alignment for GI: 254780606 and conserved domain: COG1223

>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only].
Probab=95.76  E-value=0.07  Score=31.88  Aligned_cols=82  Identities=21%  Similarity=0.379  Sum_probs=58.4

Q ss_pred             EEEEHHHHHHHHHHCC---------HHHHHHHHHHHHHHHCCEEEEEEEECCCCCCCCHHHHHHCCCCEEEEECCCHHHC
Q ss_conf             9998445687675310---------3589999999996420135899985165444414678850563057203681110
Q gi|254780606|r  531 IVIIVDEMADLMMVAG---------KEIEGAIQRLAQMARAAGIHLIMATQRPSVDVITGTIKANFPIRISFQVTSKIDS  601 (744)
Q Consensus       531 ivvviDE~a~l~~~~~---------~~~e~~~~~la~~~ra~GihlilatQrp~~~vi~~~ik~n~~~ri~~~v~~~~ds  601 (744)
T Consensus       212 civFiDE~DAiaLdRryQelRGDVsEiVNALLTelDgi~eneGVvtIaaTN~p~--~LD~aiRsRFEeEIEF~LP~~eEr  289 (368)
T COG1223         212 CIVFIDELDAIALDRRYQELRGDVSEIVNALLTELDGIKENEGVVTIAATNRPE--LLDPAIRSRFEEEIEFKLPNDEER  289 (368)
T ss_pred             EEEEEHHHHHHHHHHHHHHHCCCHHHHHHHHHHHCCCCCCCCCEEEEEECCCHH--HCCHHHHHHHHHEEEEECCCHHHH
T ss_conf             499840024555304578864549999999998501744577569995059846--507888865565065648885899


Q ss_pred             CHHCCCCCHHHHCC
Q ss_conf             03267631688568
Q gi|254780606|r  602 RTILGEHGAEQLLG  615 (744)
Q Consensus       602 r~il~~~gae~l~g  615 (744)
T Consensus       290 ~~il-e~y~k~~Pl  302 (368)
T COG1223         290 LEIL-EYYAKKFPL  302 (368)
T ss_pred             HHHH-HHHHHHCCC
T ss_conf             9999-998985897