HHsearch alignment for GI: 254780606 and conserved domain: COG1643

>COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair].
Probab=97.40  E-value=0.0037  Score=40.63  Aligned_cols=191  Identities=19%  Similarity=0.344  Sum_probs=90.8

Q ss_pred             HHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCCCEECCCCCCCCEEEEEEECHHHHHHHHHHHHHHH
Q ss_conf             01148469970787534479999999999856801107999723421000125775200004444178768999999866
Q gi|254780606|r  409 LANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKMLELSVYDGIPHLLTPVVTNPKKAVMALKWAVREM  488 (744)
Q Consensus       409 l~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~~~~~~~~~~ph~~~~v~~~~~~~~~~l~~~~~em  488 (744)
T Consensus        62 i~~~~vvii~getGsGKTTqlP~~lle~g~---~~~g~I~~tQPRRlA--------------------ArsvA~RvAeel  118 (845)
T COG1643          62 IEQNQVVIIVGETGSGKTTQLPQFLLEEGL---GIAGKIGCTQPRRLA--------------------ARSVAERVAEEL  118 (845)
T ss_pred             HHHCCEEEEECCCCCCHHHHHHHHHHHHHC---CCCCEEEECCCHHHH--------------------HHHHHHHHHHHH
T ss_conf             986978998679988758788999996001---668759965843899--------------------999999999983


Q ss_pred             HHHHHHHHHCCCCCHHHHHHHHHHHHCCCCC-------------CCCCCCCCCCEEEEEHHHHHHHHHHCCHHHHHHHHH
Q ss_conf             7699999980778679999988642026776-------------665432338679998445687675310358999999
Q gi|254780606|r  489 EERYRKMSHLSVRNIKSYNERISTMYGEKPQ-------------GCGDDMRPMPYIVIIVDEMADLMMVAGKEIEGAIQR  555 (744)
Q Consensus       489 ~~r~~~~~~~~~~~i~~~n~~~~~~~~~~~~-------------~~~~~~~~~p~ivvviDE~a~l~~~~~~~~e~~~~~  555 (744)
T Consensus       119 ~~~--------~G~~VGY~iRfe~~~s~~Trik~mTdGiLlrei~~D~~Ls--~ys~vIiDEaHERSl~t-DilLgllk~  187 (845)
T COG1643         119 GEK--------LGETVGYSIRFESKVSPRTRIKVMTDGILLREIQNDPLLS--GYSVVIIDEAHERSLNT-DILLGLLKD  187 (845)
T ss_pred             CCC--------CCCEEEEEEEEECCCCCCCEEEEECCHHHHHHHHHCCCCC--CCCEEEEECHHHHHHHH-HHHHHHHHH
T ss_conf             898--------6765437999622678771468951479999984380204--58779970133556888-999999999


Q ss_pred             HHHHHHCCEEEEEEEECCCCCCCCHHHHHH---------CCCCEEEEECCCHHHCC------HHCCCCCHHHHCCCCCEE
Q ss_conf             999642013589998516544441467885---------05630572036811100------326763168856898468
Q gi|254780606|r  556 LAQMARAAGIHLIMATQRPSVDVITGTIKA---------NFPIRISFQVTSKIDSR------TILGEHGAEQLLGRGDML  620 (744)
Q Consensus       556 la~~~ra~GihlilatQrp~~~vi~~~ik~---------n~~~ri~~~v~~~~dsr------~il~~~gae~l~g~gd~l  620 (744)
T Consensus       188 ~~~-~rr~DLKiIimSATld~~rfs~~f~~apvi~i~GR~fPVei~Y~~~~~~d~~l~~ai~~~v~~~---~~~~~GdIL  263 (845)
T COG1643         188 LLA-RRRDDLKLIIMSATLDAERFSAYFGNAPVIEIEGRTYPVEIRYLPEAEADYILLDAIVAAVDIH---LREGSGSIL  263 (845)
T ss_pred             HHH-HCCCCCEEEEEECCCCHHHHHHHCCCCCEEEECCCCCCEEEEECCCCCCCHHHHHHHHHHHHHH---CCCCCCCEE
T ss_conf             986-4688705999725358899997628998787558866447886577775136999999999996---368999889


Q ss_pred             -EECCCCCEEEEEECCCCHHHHHHHHHHHHH
Q ss_conf             -646898438999343898899999999984
Q gi|254780606|r  621 -YMSGGGRIQRVHGPLVSDIEIEKVVQHLKK  650 (744)
Q Consensus       621 -~~~~~~~~~r~~~~~~~~~~~~~~~~~~~~  650 (744)
T Consensus       264 vFLpG-------------~~EI~~~~~~L~~  281 (845)
T COG1643         264 VFLPG-------------QREIERTAEWLEK  281 (845)
T ss_pred             EECCC-------------HHHHHHHHHHHHH
T ss_conf             97786-------------8999999999973