HHsearch alignment for GI: 254780606 and conserved domain: COG2804

>COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion].
Probab=96.29  E-value=0.0028  Score=41.49  Aligned_cols=86  Identities=28%  Similarity=0.341  Sum_probs=49.1

Q ss_pred             ECCCCCCCEEEHHHHHCCHHHCCCCCCEEEEEEECCCCCEEECCHHHCCCE--EEEECCCCCHHHHHHHHHHHHHHHCCH
Q ss_conf             268888870765875128121146783689842057887321120114846--997078753447999999999985680
Q gi|254780606|r  365 ELPNETRETVYLRQIIESRSFSHSKANLALCLGKTISGESVIADLANMPHI--LVAGTTGSGKSVAINTMIMSLLYRLRP  442 (744)
Q Consensus       365 ~~p~~~~~~v~~~~~~~~~~~~~~~~~l~~~~g~~~~g~~~~~dl~~~PH~--lvaG~TgsGKS~~l~~~i~sl~~~~~p  442 (744)
T Consensus       214 tlP~~~GEkvVlRil~~~~~-~l~l~----~Lg~~~~~~~~~~~~~~~p~GliLvTGPTGSGKTTTLY~~L~~l---n~~  285 (500)
T COG2804         214 TLPTFYGEKVVLRILDKDQV-ILDLE----KLGMSPFQLARLLRLLNRPQGLILVTGPTGSGKTTTLYAALSEL---NTP  285 (500)
T ss_pred             CCCCCCCCEEEEEEECCCCC-CCCHH----HHCCCHHHHHHHHHHHHCCCEEEEEECCCCCCHHHHHHHHHHHH---CCC
T ss_conf             57887785789998333124-68887----83899889999999972897089996899998899999999986---278


Q ss_pred             HHEEEEEECCCCCEEC
Q ss_conf             1107999723421000
Q gi|254780606|r  443 DECRMIMVDPKMLELS  458 (744)
Q Consensus       443 ~~~~~~liD~k~~~~~  458 (744)
T Consensus       286 ~~nI~TiEDPVE~~~~  301 (500)
T COG2804         286 ERNIITIEDPVEYQLP  301 (500)
T ss_pred             CCEEEEEECCEEEECC
T ss_conf             8508984078045159