HHsearch alignment for GI: 254780606 and conserved domain: COG3842

>COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism].
Probab=95.04  E-value=0.031  Score=34.35  Aligned_cols=154  Identities=19%  Similarity=0.342  Sum_probs=77.2

Q ss_pred             CCEEECCH----HHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEEC--C------C---CCEECCCCCCCCE
Q ss_conf             87321120----114846997078753447999999999985680110799972--3------4---2100012577520
Q gi|254780606|r  402 GESVIADL----ANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVD--P------K---MLELSVYDGIPHL  466 (744)
Q Consensus       402 g~~~~~dl----~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD--~------k---~~~~~~~~~~ph~  466 (744)
T Consensus        17 ~~~al~~isl~i~~Gef~tlLGPSGcGKTTlLR-~IAGfe---~p~~G~I~l~g~~i~~lpp~kR~ig~VFQ~YALFPHm   92 (352)
T COG3842          17 DFTAVDDISLDIKKGEFVTLLGPSGCGKTTLLR-MIAGFE---QPSSGEILLDGEDITDVPPEKRPIGMVFQSYALFPHM   92 (352)
T ss_pred             CEEEEECCEEEECCCCEEEEECCCCCCHHHHHH-HHHCCC---CCCCCEEEECCEECCCCCHHHCCCCEEECCCCCCCCC
T ss_conf             726773214454488689998998888899999-996777---8888659999999888994226523260676668888


Q ss_pred             EEEEEECHHHHHHHHHH--HHHHHHHHHHHH-HH-----CCCCCHH----HHHHHHHHHHCCCCCCCCCCCCCCCEEEEE
Q ss_conf             00044441787689999--998667699999-98-----0778679----999988642026776665432338679998
Q gi|254780606|r  467 LTPVVTNPKKAVMALKW--AVREMEERYRKM-SH-----LSVRNIK----SYNERISTMYGEKPQGCGDDMRPMPYIVII  534 (744)
Q Consensus       467 ~~~v~~~~~~~~~~l~~--~~~em~~r~~~~-~~-----~~~~~i~----~~n~~~~~~~~~~~~~~~~~~~~~p~ivvv  534 (744)
T Consensus        93 t--V~~NVafGLk-~~~~~~~~ei~~rV~e~L~lV~L~~~~~R~p~qLSGGQqQRVALARA---------L~~~P~v-LL  159 (352)
T COG3842          93 T--VEENVAFGLK-VRKKLKKAEIKARVEEALELVGLEGFADRKPHQLSGGQQQRVALARA---------LVPEPKV-LL  159 (352)
T ss_pred             C--HHHHHHHHHH-HCCCCCHHHHHHHHHHHHHHCCCHHHHHHCHHHHCHHHHHHHHHHHH---------HHCCCCH-HH
T ss_conf             5--8997553331-05778778999999999987485444442766648278999999997---------4218354-43


Q ss_pred             HHH-HHHHHHHCCHHHHHHHHHHHHHHHCCEEEEEEEECCCC
Q ss_conf             445-68767531035899999999964201358999851654
Q gi|254780606|r  535 VDE-MADLMMVAGKEIEGAIQRLAQMARAAGIHLIMATQRPS  575 (744)
Q Consensus       535 iDE-~a~l~~~~~~~~e~~~~~la~~~ra~GihlilatQrp~  575 (744)
T Consensus       160 LDEPlSaLD~---kLR~~mr~Elk~lq~~~giT~i~VTHDqe  198 (352)
T COG3842         160 LDEPLSALDA---KLREQMRKELKELQRELGITFVYVTHDQE  198 (352)
T ss_pred             HCCCCCCHHH---HHHHHHHHHHHHHHHHCCCEEEEEECCHH
T ss_conf             4274002318---99999999999999855972999978989