HHsearch alignment for GI: 254780606 and conserved domain: COG4988

>COG4988 CydD ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones].
Probab=91.12  E-value=0.39  Score=26.75  Aligned_cols=64  Identities=22%  Similarity=0.304  Sum_probs=35.6

Q ss_pred             CEEECCHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCCCE-------ECCCCCCCCEEE
Q ss_conf             732112011484699707875344799999999998568011079997234210-------001257752000
Q gi|254780606|r  403 ESVIADLANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKMLE-------LSVYDGIPHLLT  468 (744)
Q Consensus       403 ~~~~~dl~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~~~-------~~~~~~~ph~~~  468 (744)
T Consensus       338 ~~l~~t~~~g~~talvG~SGaGKSTLl~l-L~G~~~~-~~G~I~vng~~l~~l~~~~~~k~i~~v~Q~p~lf~  408 (559)
T COG4988         338 SDLNLTIKAGQLTALVGASGAGKSTLLNL-LLGFLAP-TQGEIRVNGIDLRDLSPEAWRKQISWVSQNPYLFA  408 (559)
T ss_pred             CCCEEEECCCCEEEEECCCCCCHHHHHHH-HHCCCCC-CCCEEEECCCCCCCCCHHHHHHHEEEECCCCCCCC
T ss_conf             67106754896799988999978999999-8475777-78448889931000687788867246279984056