HHsearch alignment for GI: 254780606 and conserved domain: KOG0064

>KOG0064 consensus.
Probab=91.80  E-value=0.98  Score=24.04  Aligned_cols=150  Identities=22%  Similarity=0.305  Sum_probs=71.9

Q ss_pred             CCCCCEEECCH----HHCCCEEEEECCCCCHHHHHHHHHHHHHHH-----CCHHHEEEEEECCCCCEECCCCCCCCEEEE
Q ss_conf             57887321120----114846997078753447999999999985-----680110799972342100012577520000
Q gi|254780606|r  399 TISGESVIADL----ANMPHILVAGTTGSGKSVAINTMIMSLLYR-----LRPDECRMIMVDPKMLELSVYDGIPHLLTP  469 (744)
Q Consensus       399 ~~~g~~~~~dl----~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~-----~~p~~~~~~liD~k~~~~~~~~~~ph~~~~  469 (744)
T Consensus       491 tP~~~vvv~~Ltf~i~~G~hLLItGPNGCGKSSLfR-ILggLWPvy~g~L~~P~~~~mFYIPQR-----PYms~gtlRDQ  564 (728)
T KOG0064         491 TPAGDVLVPKLTFQIEPGMHLLITGPNGCGKSSLFR-ILGGLWPVYNGLLSIPRPNNIFYIPQR-----PYMSGGTLRDQ  564 (728)
T ss_pred             CCCCCEEECCEEEEECCCCEEEEECCCCCCHHHHHH-HHHCCCCCCCCEEECCCCCCEEECCCC-----CCCCCCCCCCE
T ss_conf             567546522215874588269987899765889999-986447232775634897636853688-----75676753121


Q ss_pred             EEE-C----HH-------HHHHHHHHHHHHHHHHHHHH-HHCCCCCHHHHH--------HHHHHHHCCCCCCCCCCCCCC
Q ss_conf             444-4----17-------87689999998667699999-980778679999--------988642026776665432338
Q gi|254780606|r  470 VVT-N----PK-------KAVMALKWAVREMEERYRKM-SHLSVRNIKSYN--------ERISTMYGEKPQGCGDDMRPM  528 (744)
Q Consensus       470 v~~-~----~~-------~~~~~l~~~~~em~~r~~~~-~~~~~~~i~~~n--------~~~~~~~~~~~~~~~~~~~~~  528 (744)
T Consensus       565 IIYPdS~e~m~~kg~td~dL~~IL~~V~-----Lehi~qR~~g~dav~dWkDvLSgGeKQRm~mARmfYHr---------  630 (728)
T KOG0064         565 IIYPDSSEQMKRKGYTDQDLEAILDIVH-----LEHILQREGGWDAVRDWKDVLSGGEKQRMGMARMFYHR---------  630 (728)
T ss_pred             EECCCCHHHHHHCCCCHHHHHHHHHHHH-----HHHHHHHCCCHHHHHCHHHHCCHHHHHHHHHHHHHHCC---------
T ss_conf             3358869999866996788999999973-----99999741671354057877050388888899997428---------


Q ss_pred             CEEEEEHHHHHHHHHHCCHHHHHHHHHHHHHHHCCEEEEEEEECCCC
Q ss_conf             67999844568767531035899999999964201358999851654
Q gi|254780606|r  529 PYIVIIVDEMADLMMVAGKEIEGAIQRLAQMARAAGIHLIMATQRPS  575 (744)
Q Consensus       529 p~ivvviDE~a~l~~~~~~~~e~~~~~la~~~ra~GihlilatQrp~  575 (744)
T Consensus       631 P-kyalLDEcT---SAVSiDvE~~i---fq~aK~~gisllSIthRps  670 (728)
T KOG0064         631 P-KYALLDECT---SAVSIDVEGKI---FQAAKDAGISLLSITHRPS  670 (728)
T ss_pred             C-CHHHHHHHH---CCCCCCHHHHH---HHHHHHCCCEEEEEECCCC
T ss_conf             5-147777673---02661247899---9998745924998516851