HHsearch alignment for GI: 254780606 and conserved domain: PRK03992

>PRK03992 proteasome-activating nucleotidase; Provisional.
Probab=96.19  E-value=0.11  Score=30.56  Aligned_cols=247  Identities=23%  Similarity=0.301  Sum_probs=122.3

Q ss_pred             HHHHHHHHHHHHHHHHHCCCCEEEEEEEECCCEE-EEEEECCCCCCHHHHHHHHHHHHHHHCCCCCEEEEECCCCEEEEE
Q ss_conf             7889988999999874035513898676489258-999754888639999859999998714776327751898345442
Q gi|254780606|r  287 HEILEKNAGSLETILEEFGIKGEIINVNPGPVVT-LYEFEPAPGIKSSRVIGLADDIARSMSSLSARVAVIPKRNAIGIE  365 (744)
Q Consensus       287 ~~~~~~~~~~l~~~l~~~~~~~~~~~~~~gp~~~-~~~~~~~~g~~~~~~~~~~~d~~~~~~~~~~~~~~~pg~~~~~~~  365 (744)
T Consensus        32 ~~~l~~~~~~l~~e~~~l~~~p~~vg~~~~~~~~~~~iv~~~~g~~~--~v~~~~~~~~~~l~pg~~V~l~~~~~~i~~~  109 (390)
T PRK03992         32 NERLERELERLKSELEKLRTPPLIVATVLEVLDDGRVVVKSSTGPQF--VVTVSSFVDRDKLKPGARVALNQQTLAIVEV  109 (390)
T ss_pred             HHHHHHHHHHHHHHHHHHCCCCCEEEEEEEEECCCEEEEEECCCCEE--EEECCCCCCHHHCCCCCEEEECCCCCEEEEE
T ss_conf             99999999999999998548994899999983797499997899879--9965787688887999989985353030564


Q ss_pred             CCCCCCCEEEHHHHHCCHHHCCCCCCEEEEEEECCCC---------CEEECCH---------H-HCC-CEEEEECCCCCH
Q ss_conf             6888887076587512812114678368984205788---------7321120---------1-148-469970787534
Q gi|254780606|r  366 LPNETRETVYLRQIIESRSFSHSKANLALCLGKTISG---------ESVIADL---------A-NMP-HILVAGTTGSGK  425 (744)
Q Consensus       366 ~p~~~~~~v~~~~~~~~~~~~~~~~~l~~~~g~~~~g---------~~~~~dl---------~-~~P-H~lvaG~TgsGK  425 (744)
T Consensus       110 l~~~~d~~v~~m~v~e~P~---v~~-------~dIGGl~~~k~el~E~velPl~~pe~f~~~Gi~pPkGvLLyGPPGtGK  179 (390)
T PRK03992        110 LPSEKDPRVRAMEVIESPD---VTY-------EDIGGLDEQIREVREAVELPLKNPELFEEVGIEPPKGVLLYGPPGTGK  179 (390)
T ss_pred             CCCCCCCCCCCCCCCCCCC---CCH-------HHHCCHHHHHHHHHHHHHHHHHCHHHHHHCCCCCCCEEEEECCCCCCH
T ss_conf             6888786211042147999---984-------661498999999999999986598999976999997278689899978


Q ss_pred             HHHHHHHHHHHHHHCCHHHEEEEEECCCCCEECCCCCCCCEEEEEEECHHHHHHHHHHHHHHHHHHH-HHHHHCCCCCHH
Q ss_conf             4799999999998568011079997234210001257752000044441787689999998667699-999980778679
Q gi|254780606|r  426 SVAINTMIMSLLYRLRPDECRMIMVDPKMLELSVYDGIPHLLTPVVTNPKKAVMALKWAVREMEERY-RKMSHLSVRNIK  504 (744)
Q Consensus       426 S~~l~~~i~sl~~~~~p~~~~~~liD~k~~~~~~~~~~ph~~~~v~~~~~~~~~~l~~~~~em~~r~-~~~~~~~~~~i~  504 (744)
T Consensus       180 TllAkAvA~e~-------~~~fi~v~~--s~l---------~sk~v--------------Gesek~vr~lF~~A------  221 (390)
T PRK03992        180 TLLAKAVAHET-------NATFIRVVG--SEL---------VQKFI--------------GEGARLVRELFELA------  221 (390)
T ss_pred             HHHHHHHHHHH-------CCCEEEEEH--HHH---------HHCCC--------------CHHHHHHHHHHHHH------
T ss_conf             99999999874-------888799667--997---------52454--------------17999999999999------


Q ss_pred             HHHHHHHHHHCCCCCCCCCCCCCCCEEEEEHHHHHHHHHHC-------CHHHHHHH-HHHHHH---HHCCEEEEEEEECC
Q ss_conf             99998864202677666543233867999844568767531-------03589999-999996---42013589998516
Q gi|254780606|r  505 SYNERISTMYGEKPQGCGDDMRPMPYIVIIVDEMADLMMVA-------GKEIEGAI-QRLAQM---ARAAGIHLIMATQR  573 (744)
Q Consensus       505 ~~n~~~~~~~~~~~~~~~~~~~~~p~ivvviDE~a~l~~~~-------~~~~e~~~-~~la~~---~ra~GihlilatQr  573 (744)
T Consensus       222 ----r~----------------~aP-~IiFiDEiDai~~~R~~~~~~g~~ev~r~l~qLL~emDG~~~~~~V~VIaATNr  280 (390)
T PRK03992        222 ----RE----------------KAP-SIIFIDEIDAIAAKRTDSGTSGDREVQRTLMQLLAEMDGFDPRGNVKIIAATNR  280 (390)
T ss_pred             ----HH----------------HCC-CEEEHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCEEEEEECCC
T ss_conf             ----97----------------099-089714325663356778886208899999999997448777788279960698


Q ss_pred             CCCCCCHHHHH--HCCCCEEEEECCCHHHCCHHCC
Q ss_conf             54444146788--5056305720368111003267
Q gi|254780606|r  574 PSVDVITGTIK--ANFPIRISFQVTSKIDSRTILG  606 (744)
Q Consensus       574 p~~~vi~~~ik--~n~~~ri~~~v~~~~dsr~il~  606 (744)
T Consensus       281 pd--~LDpAllRpGRFDr~I~iplPd~~~R~~Ilk  313 (390)
T PRK03992        281 PD--ILDPALLRPGRFDRIIEVPLPDEEGRLEILK  313 (390)
T ss_pred             CH--HCCHHHHCCCCCCEEEEECCCCHHHHHHHHH
T ss_conf             10--0597775477652388708949999999999