HHsearch alignment for GI: 254780606 and conserved domain: PRK04301

>PRK04301 radA DNA repair and recombination protein RadA; Validated.
Probab=93.17  E-value=0.66  Score=25.20  Aligned_cols=46  Identities=15%  Similarity=0.286  Sum_probs=30.4

Q ss_pred             CEEEEEHHHHHHHHHHC----CH------HHHHHHHHHHHHHHCCEEEEEEEECCC
Q ss_conf             67999844568767531----03------589999999996420135899985165
Q gi|254780606|r  529 PYIVIIVDEMADLMMVA----GK------EIEGAIQRLAQMARAAGIHLIMATQRP  574 (744)
Q Consensus       529 p~ivvviDE~a~l~~~~----~~------~~e~~~~~la~~~ra~GihlilatQrp  574 (744)
T Consensus       199 ~v~LvVvDSi~alfR~e~~grg~l~~Rq~~L~~~l~~L~~lA~~~niaVvvTNQV~  254 (318)
T PRK04301        199 NIKLVIVDSLTAHFRAEYVGRGNLAERQQKLNKHLHDLLRLADLYNAAVVVTNQVM  254 (318)
T ss_pred             CCEEEEEECCHHHEEECCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCEEEEEEEEE
T ss_conf             80499994342321210468530999999999999999999998595799961367