HHsearch alignment for GI: 254780606 and conserved domain: PRK09165

>PRK09165 replicative DNA helicase; Provisional.
Probab=96.73  E-value=0.015  Score=36.51  Aligned_cols=151  Identities=15%  Similarity=0.174  Sum_probs=74.8

Q ss_pred             HCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEE---EEEECCCCCEECCC---------------CCCC--CEEEEE
Q ss_conf             148469970787534479999999999856801107---99972342100012---------------5775--200004
Q gi|254780606|r  411 NMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECR---MIMVDPKMLELSVY---------------DGIP--HLLTPV  470 (744)
Q Consensus       411 ~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~---~~liD~k~~~~~~~---------------~~~p--h~~~~v  470 (744)
T Consensus       204 ~GdLiIIAARPsmGKTafaLniA~n~A~~~~~~~~~~~~~~~~~g~~V~~FSLEMs~~ql~~Rlls~~s~V~~~~ir~g~  283 (484)
T PRK09165        204 PSDLIILAGRPSMGKTALATNIAFNAAKAYLREAQPDGSKKAVNGGVVGFFSLEMSAEQLATRILSEQSEISSSKIRRGK  283 (484)
T ss_pred             CCCEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCEEEEEECCCCHHHHHHHHHHHHHCCCHHHHHCCC
T ss_conf             77379996079997789999999999987410222233211368984899947799999999999997268613554489


Q ss_pred             EECHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCEEEEEHHHHHHHHHHCC----
Q ss_conf             4441787689999998667699999980778679999988642026776665432338679998445687675310----
Q gi|254780606|r  471 VTNPKKAVMALKWAVREMEERYRKMSHLSVRNIKSYNERISTMYGEKPQGCGDDMRPMPYIVIIVDEMADLMMVAG----  546 (744)
Q Consensus       471 ~~~~~~~~~~l~~~~~em~~r~~~~~~~~~~~i~~~n~~~~~~~~~~~~~~~~~~~~~p~ivvviDE~a~l~~~~~----  546 (744)
T Consensus       284 l~~~e~--~~i~~a~~~l~~~~l~IdD~~~~ti~~Ira~~Rr~k~~~---------gl~--livIDYLq-Li~~~~~~~~  349 (484)
T PRK09165        284 ISEEDF--EKLVDASQELQKLPLYIDDTPALSISALRARARRLKRQH---------GLD--LLVIDYLQ-LIRGSSKRSQ  349 (484)
T ss_pred             CCHHHH--HHHHHHHHHHHCCCEEEECCCCCCHHHHHHHHHHHHHHH---------CCC--EEEEECHH-HCCCCCCCCC
T ss_conf             999999--999999999971984897799987999999999999860---------998--89995176-3578888861


Q ss_pred             ----HHHHHHHHHHHHHHHCCEEEEEEEECCCC
Q ss_conf             ----35899999999964201358999851654
Q gi|254780606|r  547 ----KEIEGAIQRLAQMARAAGIHLIMATQRPS  575 (744)
Q Consensus       547 ----~~~e~~~~~la~~~ra~GihlilatQrp~  575 (744)
T Consensus       350 ~~R~~ev~~Isr~LK~lAkel~ipVi~LsQLnR  382 (484)
T PRK09165        350 DNRVQEISEITQGLKALAKELNIPVIALSQLSR  382 (484)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHCCCEEEECCCCC
T ss_conf             219999999999999999996996999745784