HHsearch alignment for GI: 254780606 and conserved domain: PRK09270

>PRK09270 frcK putative fructose transport system kinase; Reviewed.
Probab=92.83  E-value=0.14  Score=29.80  Aligned_cols=37  Identities=24%  Similarity=0.251  Sum_probs=25.2

Q ss_pred             EEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEEC
Q ss_conf             6997078753447999999999985680110799972
Q gi|254780606|r  415 ILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVD  451 (744)
Q Consensus       415 ~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD  451 (744)
T Consensus        37 IgIaG~pGSGKSTlA~~l~~~L~~~~~~~~~~~vpmD   73 (230)
T PRK09270         37 VGIAGPPGAGKSTLAETLWEALSQQGPELPAIQVPMD   73 (230)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHHHCCCCCCEEEECCC
T ss_conf             9998999889999999999998623799857997365