HHsearch alignment for GI: 254780606 and conserved domain: PRK10253

>PRK10253 iron-enterobactin transporter ATP-binding protein; Provisional.
Probab=91.10  E-value=0.22  Score=28.42  Aligned_cols=54  Identities=24%  Similarity=0.433  Sum_probs=33.1

Q ss_pred             EEEEEEECCCCCEEECCHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEE
Q ss_conf             6898420578873211201148469970787534479999999999856801107999
Q gi|254780606|r  392 LALCLGKTISGESVIADLANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIM  449 (744)
Q Consensus       392 l~~~~g~~~~g~~~~~dl~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~l  449 (744)
T Consensus        13 Ls~~yg~~~~l~~isl~I~~Ge~~~iiGpNGaGKSTLlk~-i~Gll---~p~~G~I~l   66 (265)
T PRK10253         13 LTLGYGKYTVAENLTVEIPDGHFTAIIGPNGCGKSTLLRT-LSRLM---TPAHGHVWL   66 (265)
T ss_pred             EEEEECCEEEEEEEEEEECCCCEEEEECCCCCHHHHHHHH-HHCCC---CCCCEEEEE
T ss_conf             9999999999840288985997999999988399999999-97498---888529999