HHsearch alignment for GI: 254780606 and conserved domain: PRK10535

>PRK10535 macrolide transporter ATP-binding /permease protein; Provisional.
Probab=95.30  E-value=0.013  Score=36.86  Aligned_cols=153  Identities=22%  Similarity=0.338  Sum_probs=70.1

Q ss_pred             EECCHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCCC---E--------EC-CCCCCCCEEEEEEE
Q ss_conf             211201148469970787534479999999999856801107999723421---0--------00-12577520000444
Q gi|254780606|r  405 VIADLANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKML---E--------LS-VYDGIPHLLTPVVT  472 (744)
Q Consensus       405 ~~~dl~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~~---~--------~~-~~~~~ph~~~~v~~  472 (744)
T Consensus        27 vsl~i~~Ge~v~i~G~nGsGKSTll~-~l~gl-~~p~~G~v~~~G~~~~~~~~~~~~~~rr~~ig~v~Q~-~~l~~-~~t  102 (648)
T PRK10535         27 ISLTIYAGEMVAIVGASGSGKSTLMN-ILGCL-DKPTSGTYRVAGQDVATLDADALAQLRREHFGFIFQR-YHLLS-HLT  102 (648)
T ss_pred             EEEEECCCCEEEEECCCCCHHHHHHH-HHHCC-CCCCCEEEEECCEECCCCCHHHHHHHHCCCEEEECCC-CCCCC-CCC
T ss_conf             69999899899999999962999999-99569-9999669999999988599899999865868998679-74379-995


Q ss_pred             CHHHHHHHHHH---HHHHHHHH-HHHHHHCCCCCHHHH---------HHHHHHHHCCCCCCCCCCCCCCCEEEEEHHHHH
Q ss_conf             41787689999---99866769-999998077867999---------998864202677666543233867999844568
Q gi|254780606|r  473 NPKKAVMALKW---AVREMEER-YRKMSHLSVRNIKSY---------NERISTMYGEKPQGCGDDMRPMPYIVIIVDEMA  539 (744)
Q Consensus       473 ~~~~~~~~l~~---~~~em~~r-~~~~~~~~~~~i~~~---------n~~~~~~~~~~~~~~~~~~~~~p~ivvviDE~a  539 (744)
T Consensus       103 v~env~~~~~~~g~~~~~~~~~~~~~l~~~gl~~~~~~~p~~LSgGq~QRvaiAra---------l~~~p~-vlllDEPT  172 (648)
T PRK10535        103 AAQNVEVPAVYAGLERKQRLERAQELLQRLGLEDRVEYQPSQLSGGQQQRVSIARA---------LMNGGQ-VILADEPT  172 (648)
T ss_pred             HHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCHHHHCCCHHHCCHHHHHHHHHHHH---------HHHCCC-EEEECCCC
T ss_conf             99999989987799989999999999997799667557823389999999999999---------972898-99956885


Q ss_pred             -HHHHHCCHHHHHHHHHHHHHHHCCEEEEEEEECCCC
Q ss_conf             -767531035899999999964201358999851654
Q gi|254780606|r  540 -DLMMVAGKEIEGAIQRLAQMARAAGIHLIMATQRPS  575 (744)
Q Consensus       540 -~l~~~~~~~~e~~~~~la~~~ra~GihlilatQrp~  575 (744)
T Consensus       173 ~~LD~~~~~~v~~ll~~l~----~~G~tii~vtHd~~  205 (648)
T PRK10535        173 GALDSHSGEEVMAILHQLR----DRGHTVIIVTHDPQ  205 (648)
T ss_pred             CCCCHHHHHHHHHHHHHHH----HCCCEEEEECCCHH
T ss_conf             5579999999999999999----77999999764869