HHsearch alignment for GI: 254780606 and conserved domain: PRK10636

>PRK10636 putative ABC transporter ATP-binding protein; Provisional.
Probab=90.73  E-value=0.24  Score=28.24  Aligned_cols=40  Identities=28%  Similarity=0.359  Sum_probs=27.9

Q ss_pred             EEECCHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEE
Q ss_conf             32112011484699707875344799999999998568011079
Q gi|254780606|r  404 SVIADLANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRM  447 (744)
Q Consensus       404 ~~~~dl~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~  447 (744)
T Consensus       330 ~vsl~i~~GeriaIvG~NGsGKSTLlk~-L~G~l---~p~~G~i  369 (638)
T PRK10636        330 SIKLNLVPGSRIGLLGRNGAGKSTLIKL-LAGEL---APVSGEI  369 (638)
T ss_pred             CCCCEECCCCEEEEECCCCCCHHHHHHH-HCCCC---CCCCCEE
T ss_conf             7750563784799974787138899999-72887---8888569