HHsearch alignment for GI: 254780606 and conserved domain: PRK11300

>PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional.
Probab=95.33  E-value=0.18  Score=29.05  Aligned_cols=41  Identities=15%  Similarity=0.294  Sum_probs=27.1

Q ss_pred             EECCHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEE
Q ss_conf             2112011484699707875344799999999998568011079
Q gi|254780606|r  405 VIADLANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRM  447 (744)
Q Consensus       405 ~~~dl~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~  447 (744)
T Consensus        24 vs~~v~~Gei~~liGpnGaGKSTL~~~-i~Gl~-~p~~G~I~~   64 (255)
T PRK11300         24 VNLEVREQEVVSLIGPNGAGKTTVFNC-LTGFY-KPTGGTILL   64 (255)
T ss_pred             EEEEECCCCEEEEECCCCCCHHHHHHH-HHCCC-CCCCEEEEE
T ss_conf             088989997999998999649999999-96798-898608999