HHsearch alignment for GI: 254780606 and conserved domain: PRK11650

>PRK11650 ugpC glycerol-3-phosphate transporter ATP-binding subunit; Provisional.
Probab=95.57  E-value=0.038  Score=33.69  Aligned_cols=163  Identities=20%  Similarity=0.273  Sum_probs=80.0

Q ss_pred             EECCHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEEC-------CC----CCEECCCCCCCCEEEEEEEC
Q ss_conf             21120114846997078753447999999999985680110799972-------34----21000125775200004444
Q gi|254780606|r  405 VIADLANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVD-------PK----MLELSVYDGIPHLLTPVVTN  473 (744)
Q Consensus       405 ~~~dl~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD-------~k----~~~~~~~~~~ph~~~~v~~~  473 (744)
T Consensus        23 vsl~i~~Ge~~~llGpsG~GKTTllr-~iaGl~---~p~~G~I~~~g~~v~~~~~~~R~i~~vfQ~~~L~p~lt--V~en   96 (358)
T PRK11650         23 IDLDVADGEFIVLVGPSGCGKSTLLR-MVAGLE---RITSGEIWIGGRVVNELEPADRDIAMVFQNYALYPHMS--VREN   96 (358)
T ss_pred             CEEEECCCCEEEEECCCCCHHHHHHH-HHHCCC---CCCCEEEEECCEECCCCCHHHCCEEEECCCCCCCCCCC--HHHH
T ss_conf             27798899899999998636999999-997699---98862999999999999977875767725554487874--8786


Q ss_pred             HHHHHHHHHHHHHHHHHHHHH-HHHCCCCCHHH---------HHHHHHHHHCCCCCCCCCCCCCCCEEEEEHHHH-HHHH
Q ss_conf             178768999999866769999-99807786799---------999886420267766654323386799984456-8767
Q gi|254780606|r  474 PKKAVMALKWAVREMEERYRK-MSHLSVRNIKS---------YNERISTMYGEKPQGCGDDMRPMPYIVIIVDEM-ADLM  542 (744)
Q Consensus       474 ~~~~~~~l~~~~~em~~r~~~-~~~~~~~~i~~---------~n~~~~~~~~~~~~~~~~~~~~~p~ivvviDE~-a~l~  542 (744)
T Consensus        97 i~~~l~~~~~~~~~~~~rv~~~l~~l~l~~~~~r~p~~LSGGq~QRvalARA---------L~~~P~v-lllDEP~s~LD  166 (358)
T PRK11650         97 MAYGLKIRGMPKAEIEERVAEAARILELEPLLDRKPRELSGGQRQRVAMGRA---------IVREPAV-FLFDEPLSNLD  166 (358)
T ss_pred             HHHHHHHCCCCHHHHHHHHHHHHHHHCCCCHHHCCHHHCCHHHHHHHHHHHH---------HHCCCCE-EEECCCCCCCC
T ss_conf             6557876288646788999999875226242248974789567899998357---------5049986-88738877679


Q ss_pred             HHCCHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCCCHHHHHHCCCCEEEE
Q ss_conf             531035899999999964201358999851654444146788505630572
Q gi|254780606|r  543 MVAGKEIEGAIQRLAQMARAAGIHLIMATQRPSVDVITGTIKANFPIRISF  593 (744)
Q Consensus       543 ~~~~~~~e~~~~~la~~~ra~GihlilatQrp~~~vi~~~ik~n~~~ri~~  593 (744)
T Consensus       167 ~---~~r~~~~~~l~~l~~~~g~T~i~vTHd~~-eA~------~laDri~v  207 (358)
T PRK11650        167 A---KLRVQMRLEIQRLHRRLGTTSLYVTHDQV-EAM------TLADRVVV  207 (358)
T ss_pred             H---HHHHHHHHHHHHHHHHHCCEEEEEECCHH-HHH------HHCCEEEE
T ss_conf             9---89999999999999975977999989999-999------86999999