HHsearch alignment for GI: 254780606 and conserved domain: PRK11664

>PRK11664 ATP-dependent RNA helicase HrpB; Provisional.
Probab=97.40  E-value=0.0022  Score=42.19  Aligned_cols=76  Identities=22%  Similarity=0.255  Sum_probs=42.5

Q ss_pred             CCCCCCCCHHHHHHCCCCEEEEECCCHHHCCHHCCC-CCH----HHHCCCCCEEEEC----CC-CCEEEE-EECCCCHHH
Q ss_conf             165444414678850563057203681110032676-316----8856898468646----89-843899-934389889
Q gi|254780606|r  572 QRPSVDVITGTIKANFPIRISFQVTSKIDSRTILGE-HGA----EQLLGRGDMLYMS----GG-GRIQRV-HGPLVSDIE  640 (744)
Q Consensus       572 Qrp~~~vi~~~ik~n~~~ri~~~v~~~~dsr~il~~-~ga----e~l~g~gd~l~~~----~~-~~~~r~-~~~~~~~~~  640 (744)
T Consensus       484 ~~~~~~~~g~lla~AfPDRIArrRg~--~gry~LanGrga~L~~~d~L~~~ewLvaadl~~~~~~~~~rI~lAa~i~~~~  561 (812)
T PRK11664        484 GEVDSSLIAPLLALAFPDRIARRRGQ--DGRYQLANGMGAMLDADDALSRHEWLVAPLLLQGSASPDARILLALPLDIDE  561 (812)
T ss_pred             CCCCHHHHHHHHHHHCHHHHHHHHCC--CCCEEEECCCEEEECCCCCCCCCCCEEEEEECCCCCCCHHEEEEECCCCHHH
T ss_conf             89986789999999785999886189--9867972687588788877778885899981367877522188626889999


Q ss_pred             HHHHHHHHH
Q ss_conf             999999998
Q gi|254780606|r  641 IEKVVQHLK  649 (744)
Q Consensus       641 ~~~~~~~~~  649 (744)
T Consensus       562 l~~~~~~~i  570 (812)
T PRK11664        562 LVQRCPQLV  570 (812)
T ss_pred             HHHHHHHHC
T ss_conf             998867562