HHsearch alignment for GI: 254780606 and conserved domain: PRK13632

>PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional.
Probab=96.07  E-value=0.058  Score=32.45  Aligned_cols=190  Identities=15%  Similarity=0.229  Sum_probs=87.6

Q ss_pred             EEECCHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHCCHHHEEEEEECCCCCEEC--------CCCCCC--CEEEE-EEE
Q ss_conf             3211201148469970787534479999999999856801107999723421000--------125775--20000-444
Q gi|254780606|r  404 SVIADLANMPHILVAGTTGSGKSVAINTMIMSLLYRLRPDECRMIMVDPKMLELS--------VYDGIP--HLLTP-VVT  472 (744)
Q Consensus       404 ~~~~dl~~~PH~lvaG~TgsGKS~~l~~~i~sl~~~~~p~~~~~~liD~k~~~~~--------~~~~~p--h~~~~-v~~  472 (744)
T Consensus        28 ~isl~i~~Ge~vaivG~nGsGKSTLlk~-l~Gll~-p~~G~I~v~G~~i~~~~~~~~~~~ig~VfQ~-Pd~q~~~~tV~e  104 (273)
T PRK13632         28 NVSFTINEGEYVAILGHNGSGKSTISKI-LTGLLK-PQSGEIKIFGITISKENLKYLRKKIGIIFQN-PDNQFIGITVED  104 (273)
T ss_pred             EEEEEECCCCEEEEECCCCCHHHHHHHH-HHCCCC-CCCCEEEECCEECCCCCHHHHHHHEEEEEEC-CCHHCCCCCHHH
T ss_conf             4288984998999999999869999999-973877-8887599999999968989987435699877-102027751788


Q ss_pred             CHHHHHHHHHHHHHHHHHHHHH-HHHCCCCCHHHH---------HHHHHHHHCCCCCCCCCCCCCCCEEEEEHHHHHHHH
Q ss_conf             4178768999999866769999-998077867999---------998864202677666543233867999844568767
Q gi|254780606|r  473 NPKKAVMALKWAVREMEERYRK-MSHLSVRNIKSY---------NERISTMYGEKPQGCGDDMRPMPYIVIIVDEMADLM  542 (744)
Q Consensus       473 ~~~~~~~~l~~~~~em~~r~~~-~~~~~~~~i~~~---------n~~~~~~~~~~~~~~~~~~~~~p~ivvviDE~a~l~  542 (744)
T Consensus       105 ~iafgl~~~~~~~~~~~~~v~~~l~~~gl~~~~~~~p~~LSGGqkQRvaiA~a---------La~~P~i-liLDEPTs~L  174 (273)
T PRK13632        105 DIAFGLENKKIPPKKMKDIIDDLAKKVGMEDYLKKEPQNLSGGQKQRVAIASV---------LALNPEI-IIFDESTSML  174 (273)
T ss_pred             HHHHHHHHCCCCHHHHHHHHHHHHHHCCCHHHHHCCCHHCCHHHHHHHHHHHH---------HHCCCCE-EEEECCCCCC
T ss_conf             88867866799999999999999998698887747820099999999999999---------9719999-9980775569


Q ss_pred             H-HCCHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCCCHHHHHHCCCCEEEEECCCHHHCCHHCCCCCHHHHCCCCCEEE
Q ss_conf             5-310358999999999642013589998516544441467885056305720368111003267631688568984686
Q gi|254780606|r  543 M-VAGKEIEGAIQRLAQMARAAGIHLIMATQRPSVDVITGTIKANFPIRISFQVTSKIDSRTILGEHGAEQLLGRGDMLY  621 (744)
Q Consensus       543 ~-~~~~~~e~~~~~la~~~ra~GihlilatQrp~~~vi~~~ik~n~~~ri~~~v~~~~dsr~il~~~gae~l~g~gd~l~  621 (744)
T Consensus       175 D~~~~~~l~~~---l~~l~~~~g~TvI~iTHd~~--~----~~-~-aDrv~vm~----~G~-iv~~G~p~el~~~~e~l~  238 (273)
T PRK13632        175 DPKGKREIKKI---MVDLRKDRKKTLISITHDMD--E----AI-L-ADKVIVFS----NGK-LIAQGKPKEILNDKEILE  238 (273)
T ss_pred             CHHHHHHHHHH---HHHHHHHCCCEEEEEEECHH--H----HH-C-CCEEEEEE----CCE-EEEECCHHHHHCCHHHHH
T ss_conf             98999999999---99999846989999942888--9----97-1-99999998----999-999769999877999999


Q ss_pred             E
Q ss_conf             4
Q gi|254780606|r  622 M  622 (744)
Q Consensus       622 ~  622 (744)
T Consensus       239 ~  239 (273)
T PRK13632        239 K  239 (273)
T ss_pred             H
T ss_conf             7